(data stored in SCRATCH zone)

EMBL: CP002059

ID   CP002059; SV 1; circular; genomic DNA; STD; PRO; 5354700 BP.
XX
AC   CP002059; ACIR01000000-ACIR01000216;
XX
PR   Project:PRJNA30807;
XX
DT   15-JUN-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   'Nostoc azollae' 0708, complete genome.
XX
KW   .
XX
OS   'Nostoc azollae' 0708
OC   Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
XX
RN   [1]
RC   Erratum:[PLoS One. 2010;5(9) doi:
RC   10.1371/annotation/835c5766-5128-41c4-b636-adfe0c503103] Publication
RC   Status: Online-Only
RP   1-5354700
RX   DOI; 10.1371/journal.pone.0011486.
RX   PUBMED; 20628610.
RA   Ran L., Larsson J., Vigil-Stenman T., Nylander J.A., Ininbergs K.,
RA   Zheng W.W., Lapidus A., Lowry S., Haselkorn R., Bergman B.;
RT   "Genome erosion in a nitrogen-fixing vertically transmitted endosymbiotic
RT   multicellular cyanobacterium";
RL   PLoS One 5(7):E11486-E11486(2010).
XX
RN   [2]
RP   1-5354700
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Lowry S., Clum A., Sun H., Land M., Hauser L., Kyrpides N.,
RA   Ovchinnikova G., Bergman B., Woyke T.;
RT   "Complete sequence of chromosome of 'Nostoc azollae' 0708";
RL   Unpublished.
XX
RN   [3]
RP   1-5354700
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Lowry S., Clum A., Sun H., Land M., Hauser L., Kyrpides N.,
RA   Ovchinnikova G., Bergman B., Woyke T.;
RT   ;
RL   Submitted (03-JUN-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 78295c62faa894ff105eef0e350fa7c8.
DR   BioSample; SAMN02598476.
DR   EnsemblGenomes-Gn; Aazo_R0001.
DR   EnsemblGenomes-Gn; Aazo_R0002.
DR   EnsemblGenomes-Gn; Aazo_R0003.
DR   EnsemblGenomes-Gn; Aazo_R0004.
DR   EnsemblGenomes-Gn; Aazo_R0005.
DR   EnsemblGenomes-Gn; Aazo_R0006.
DR   EnsemblGenomes-Gn; Aazo_R0007.
DR   EnsemblGenomes-Gn; Aazo_R0008.
DR   EnsemblGenomes-Gn; Aazo_R0009.
DR   EnsemblGenomes-Gn; Aazo_R0010.
DR   EnsemblGenomes-Gn; Aazo_R0011.
DR   EnsemblGenomes-Gn; Aazo_R0012.
DR   EnsemblGenomes-Gn; Aazo_R0013.
DR   EnsemblGenomes-Gn; Aazo_R0014.
DR   EnsemblGenomes-Gn; Aazo_R0015.
DR   EnsemblGenomes-Gn; Aazo_R0016.
DR   EnsemblGenomes-Gn; Aazo_R0017.
DR   EnsemblGenomes-Gn; Aazo_R0018.
DR   EnsemblGenomes-Gn; Aazo_R0019.
DR   EnsemblGenomes-Gn; Aazo_R0020.
DR   EnsemblGenomes-Gn; Aazo_R0021.
DR   EnsemblGenomes-Gn; Aazo_R0022.
DR   EnsemblGenomes-Gn; Aazo_R0023.
DR   EnsemblGenomes-Gn; Aazo_R0024.
DR   EnsemblGenomes-Gn; Aazo_R0025.
DR   EnsemblGenomes-Gn; Aazo_R0026.
DR   EnsemblGenomes-Gn; Aazo_R0027.
DR   EnsemblGenomes-Gn; Aazo_R0028.
DR   EnsemblGenomes-Gn; Aazo_R0029.
DR   EnsemblGenomes-Gn; Aazo_R0030.
DR   EnsemblGenomes-Gn; Aazo_R0031.
DR   EnsemblGenomes-Gn; Aazo_R0032.
DR   EnsemblGenomes-Gn; Aazo_R0033.
DR   EnsemblGenomes-Gn; Aazo_R0034.
DR   EnsemblGenomes-Gn; Aazo_R0035.
DR   EnsemblGenomes-Gn; Aazo_R0036.
DR   EnsemblGenomes-Gn; Aazo_R0037.
DR   EnsemblGenomes-Gn; Aazo_R0038.
DR   EnsemblGenomes-Gn; Aazo_R0039.
DR   EnsemblGenomes-Gn; Aazo_R0040.
DR   EnsemblGenomes-Gn; Aazo_R0041.
DR   EnsemblGenomes-Gn; Aazo_R0042.
DR   EnsemblGenomes-Gn; Aazo_R0043.
DR   EnsemblGenomes-Gn; Aazo_R0044.
DR   EnsemblGenomes-Gn; Aazo_R0045.
DR   EnsemblGenomes-Gn; Aazo_R0046.
DR   EnsemblGenomes-Gn; Aazo_R0047.
DR   EnsemblGenomes-Gn; Aazo_R0048.
DR   EnsemblGenomes-Gn; Aazo_R0049.
DR   EnsemblGenomes-Gn; Aazo_R0050.
DR   EnsemblGenomes-Gn; Aazo_R0051.
DR   EnsemblGenomes-Gn; Aazo_R0052.
DR   EnsemblGenomes-Gn; Aazo_R0053.
DR   EnsemblGenomes-Gn; Aazo_R0054.
DR   EnsemblGenomes-Gn; Aazo_R0055.
DR   EnsemblGenomes-Gn; Aazo_R0056.
DR   EnsemblGenomes-Gn; Aazo_R0057.
DR   EnsemblGenomes-Gn; Aazo_R0058.
DR   EnsemblGenomes-Gn; Aazo_R0059.
DR   EnsemblGenomes-Gn; EBG00001247587.
DR   EnsemblGenomes-Gn; EBG00001247588.
DR   EnsemblGenomes-Gn; EBG00001247589.
DR   EnsemblGenomes-Gn; EBG00001247590.
DR   EnsemblGenomes-Gn; EBG00001247591.
DR   EnsemblGenomes-Gn; EBG00001247592.
DR   EnsemblGenomes-Gn; EBG00001247593.
DR   EnsemblGenomes-Gn; EBG00001247594.
DR   EnsemblGenomes-Gn; EBG00001247595.
DR   EnsemblGenomes-Gn; EBG00001247596.
DR   EnsemblGenomes-Gn; EBG00001247597.
DR   EnsemblGenomes-Gn; EBG00001247598.
DR   EnsemblGenomes-Gn; EBG00001247599.
DR   EnsemblGenomes-Gn; EBG00001247600.
DR   EnsemblGenomes-Gn; EBG00001247601.
DR   EnsemblGenomes-Gn; EBG00001247602.
DR   EnsemblGenomes-Gn; EBG00001247603.
DR   EnsemblGenomes-Gn; EBG00001247604.
DR   EnsemblGenomes-Gn; EBG00001247605.
DR   EnsemblGenomes-Gn; EBG00001247606.
DR   EnsemblGenomes-Gn; EBG00001247607.
DR   EnsemblGenomes-Gn; EBG00001247608.
DR   EnsemblGenomes-Gn; EBG00001247609.
DR   EnsemblGenomes-Gn; EBG00001247610.
DR   EnsemblGenomes-Gn; EBG00001247611.
DR   EnsemblGenomes-Gn; EBG00001247612.
DR   EnsemblGenomes-Gn; EBG00001247613.
DR   EnsemblGenomes-Gn; EBG00001247614.
DR   EnsemblGenomes-Gn; EBG00001247615.
DR   EnsemblGenomes-Gn; EBG00001247616.
DR   EnsemblGenomes-Gn; EBG00001247617.
DR   EnsemblGenomes-Gn; EBG00001247618.
DR   EnsemblGenomes-Gn; EBG00001247619.
DR   EnsemblGenomes-Gn; EBG00001247620.
DR   EnsemblGenomes-Gn; EBG00001247621.
DR   EnsemblGenomes-Gn; EBG00001247622.
DR   EnsemblGenomes-Gn; EBG00001247623.
DR   EnsemblGenomes-Gn; EBG00001247624.
DR   EnsemblGenomes-Gn; EBG00001247625.
DR   EnsemblGenomes-Gn; EBG00001247626.
DR   EnsemblGenomes-Gn; EBG00001247627.
DR   EnsemblGenomes-Gn; EBG00001247628.
DR   EnsemblGenomes-Gn; EBG00001247629.
DR   EnsemblGenomes-Gn; EBG00001247630.
DR   EnsemblGenomes-Gn; EBG00001247631.
DR   EnsemblGenomes-Gn; EBG00001247632.
DR   EnsemblGenomes-Gn; EBG00001247633.
DR   EnsemblGenomes-Gn; EBG00001247634.
DR   EnsemblGenomes-Gn; EBG00001247635.
DR   EnsemblGenomes-Gn; EBG00001247636.
DR   EnsemblGenomes-Gn; EBG00001247637.
DR   EnsemblGenomes-Gn; EBG00001247638.
DR   EnsemblGenomes-Gn; EBG00001247639.
DR   EnsemblGenomes-Gn; EBG00001247640.
DR   EnsemblGenomes-Gn; EBG00001247641.
DR   EnsemblGenomes-Gn; EBG00001247642.
DR   EnsemblGenomes-Gn; EBG00001247643.
DR   EnsemblGenomes-Gn; EBG00001247644.
DR   EnsemblGenomes-Gn; EBG00001247645.
DR   EnsemblGenomes-Gn; EBG00001247646.
DR   EnsemblGenomes-Gn; EBG00001247647.
DR   EnsemblGenomes-Gn; EBG00001247648.
DR   EnsemblGenomes-Gn; EBG00001247649.
DR   EnsemblGenomes-Gn; EBG00001247650.
DR   EnsemblGenomes-Gn; EBG00001247651.
DR   EnsemblGenomes-Gn; EBG00001247652.
DR   EnsemblGenomes-Gn; EBG00001247653.
DR   EnsemblGenomes-Gn; EBG00001247654.
DR   EnsemblGenomes-Gn; EBG00001247655.
DR   EnsemblGenomes-Gn; EBG00001247656.
DR   EnsemblGenomes-Gn; EBG00001247657.
DR   EnsemblGenomes-Gn; EBG00001247658.
DR   EnsemblGenomes-Gn; EBG00001247659.
DR   EnsemblGenomes-Gn; EBG00001247660.
DR   EnsemblGenomes-Gn; EBG00001247661.
DR   EnsemblGenomes-Gn; EBG00001247662.
DR   EnsemblGenomes-Gn; EBG00001247663.
DR   EnsemblGenomes-Gn; EBG00001247664.
DR   EnsemblGenomes-Gn; EBG00001247665.
DR   EnsemblGenomes-Gn; EBG00001247666.
DR   EnsemblGenomes-Gn; EBG00001247667.
DR   EnsemblGenomes-Gn; EBG00001247668.
DR   EnsemblGenomes-Gn; EBG00001247669.
DR   EnsemblGenomes-Tr; Aazo_R0001-1.
DR   EnsemblGenomes-Tr; Aazo_R0002-1.
DR   EnsemblGenomes-Tr; Aazo_R0003-1.
DR   EnsemblGenomes-Tr; Aazo_R0004-1.
DR   EnsemblGenomes-Tr; Aazo_R0005-1.
DR   EnsemblGenomes-Tr; Aazo_R0006-1.
DR   EnsemblGenomes-Tr; Aazo_R0007-1.
DR   EnsemblGenomes-Tr; Aazo_R0008-1.
DR   EnsemblGenomes-Tr; Aazo_R0009-1.
DR   EnsemblGenomes-Tr; Aazo_R0010-1.
DR   EnsemblGenomes-Tr; Aazo_R0011-1.
DR   EnsemblGenomes-Tr; Aazo_R0012-1.
DR   EnsemblGenomes-Tr; Aazo_R0013-1.
DR   EnsemblGenomes-Tr; Aazo_R0014-1.
DR   EnsemblGenomes-Tr; Aazo_R0015-1.
DR   EnsemblGenomes-Tr; Aazo_R0016-1.
DR   EnsemblGenomes-Tr; Aazo_R0017-1.
DR   EnsemblGenomes-Tr; Aazo_R0018-1.
DR   EnsemblGenomes-Tr; Aazo_R0019-1.
DR   EnsemblGenomes-Tr; Aazo_R0020-1.
DR   EnsemblGenomes-Tr; Aazo_R0021-1.
DR   EnsemblGenomes-Tr; Aazo_R0022-1.
DR   EnsemblGenomes-Tr; Aazo_R0023-1.
DR   EnsemblGenomes-Tr; Aazo_R0024-1.
DR   EnsemblGenomes-Tr; Aazo_R0025-1.
DR   EnsemblGenomes-Tr; Aazo_R0026-1.
DR   EnsemblGenomes-Tr; Aazo_R0027-1.
DR   EnsemblGenomes-Tr; Aazo_R0028-1.
DR   EnsemblGenomes-Tr; Aazo_R0029-1.
DR   EnsemblGenomes-Tr; Aazo_R0030-1.
DR   EnsemblGenomes-Tr; Aazo_R0031-1.
DR   EnsemblGenomes-Tr; Aazo_R0032-1.
DR   EnsemblGenomes-Tr; Aazo_R0033-1.
DR   EnsemblGenomes-Tr; Aazo_R0034-1.
DR   EnsemblGenomes-Tr; Aazo_R0035-1.
DR   EnsemblGenomes-Tr; Aazo_R0036-1.
DR   EnsemblGenomes-Tr; Aazo_R0037-1.
DR   EnsemblGenomes-Tr; Aazo_R0038-1.
DR   EnsemblGenomes-Tr; Aazo_R0039-1.
DR   EnsemblGenomes-Tr; Aazo_R0040-1.
DR   EnsemblGenomes-Tr; Aazo_R0041-1.
DR   EnsemblGenomes-Tr; Aazo_R0042-1.
DR   EnsemblGenomes-Tr; Aazo_R0043-1.
DR   EnsemblGenomes-Tr; Aazo_R0044-1.
DR   EnsemblGenomes-Tr; Aazo_R0045-1.
DR   EnsemblGenomes-Tr; Aazo_R0046-1.
DR   EnsemblGenomes-Tr; Aazo_R0047-1.
DR   EnsemblGenomes-Tr; Aazo_R0048-1.
DR   EnsemblGenomes-Tr; Aazo_R0049-1.
DR   EnsemblGenomes-Tr; Aazo_R0050-1.
DR   EnsemblGenomes-Tr; Aazo_R0051-1.
DR   EnsemblGenomes-Tr; Aazo_R0052-1.
DR   EnsemblGenomes-Tr; Aazo_R0053-1.
DR   EnsemblGenomes-Tr; Aazo_R0054-1.
DR   EnsemblGenomes-Tr; Aazo_R0055-1.
DR   EnsemblGenomes-Tr; Aazo_R0056-1.
DR   EnsemblGenomes-Tr; Aazo_R0057-1.
DR   EnsemblGenomes-Tr; Aazo_R0058-1.
DR   EnsemblGenomes-Tr; Aazo_R0059-1.
DR   EnsemblGenomes-Tr; EBT00001593515.
DR   EnsemblGenomes-Tr; EBT00001593516.
DR   EnsemblGenomes-Tr; EBT00001593517.
DR   EnsemblGenomes-Tr; EBT00001593518.
DR   EnsemblGenomes-Tr; EBT00001593519.
DR   EnsemblGenomes-Tr; EBT00001593520.
DR   EnsemblGenomes-Tr; EBT00001593523.
DR   EnsemblGenomes-Tr; EBT00001593526.
DR   EnsemblGenomes-Tr; EBT00001593528.
DR   EnsemblGenomes-Tr; EBT00001593529.
DR   EnsemblGenomes-Tr; EBT00001593530.
DR   EnsemblGenomes-Tr; EBT00001593531.
DR   EnsemblGenomes-Tr; EBT00001593532.
DR   EnsemblGenomes-Tr; EBT00001593533.
DR   EnsemblGenomes-Tr; EBT00001593534.
DR   EnsemblGenomes-Tr; EBT00001593536.
DR   EnsemblGenomes-Tr; EBT00001593538.
DR   EnsemblGenomes-Tr; EBT00001593541.
DR   EnsemblGenomes-Tr; EBT00001593544.
DR   EnsemblGenomes-Tr; EBT00001593547.
DR   EnsemblGenomes-Tr; EBT00001593549.
DR   EnsemblGenomes-Tr; EBT00001593551.
DR   EnsemblGenomes-Tr; EBT00001593553.
DR   EnsemblGenomes-Tr; EBT00001593554.
DR   EnsemblGenomes-Tr; EBT00001593556.
DR   EnsemblGenomes-Tr; EBT00001593558.
DR   EnsemblGenomes-Tr; EBT00001593560.
DR   EnsemblGenomes-Tr; EBT00001593562.
DR   EnsemblGenomes-Tr; EBT00001593564.
DR   EnsemblGenomes-Tr; EBT00001593566.
DR   EnsemblGenomes-Tr; EBT00001593568.
DR   EnsemblGenomes-Tr; EBT00001593570.
DR   EnsemblGenomes-Tr; EBT00001593572.
DR   EnsemblGenomes-Tr; EBT00001593574.
DR   EnsemblGenomes-Tr; EBT00001593576.
DR   EnsemblGenomes-Tr; EBT00001593578.
DR   EnsemblGenomes-Tr; EBT00001593580.
DR   EnsemblGenomes-Tr; EBT00001593583.
DR   EnsemblGenomes-Tr; EBT00001593585.
DR   EnsemblGenomes-Tr; EBT00001593587.
DR   EnsemblGenomes-Tr; EBT00001593589.
DR   EnsemblGenomes-Tr; EBT00001593591.
DR   EnsemblGenomes-Tr; EBT00001593594.
DR   EnsemblGenomes-Tr; EBT00001593595.
DR   EnsemblGenomes-Tr; EBT00001593598.
DR   EnsemblGenomes-Tr; EBT00001593600.
DR   EnsemblGenomes-Tr; EBT00001593602.
DR   EnsemblGenomes-Tr; EBT00001593604.
DR   EnsemblGenomes-Tr; EBT00001593605.
DR   EnsemblGenomes-Tr; EBT00001593608.
DR   EnsemblGenomes-Tr; EBT00001593611.
DR   EnsemblGenomes-Tr; EBT00001593612.
DR   EnsemblGenomes-Tr; EBT00001593613.
DR   EnsemblGenomes-Tr; EBT00001593614.
DR   EnsemblGenomes-Tr; EBT00001593615.
DR   EnsemblGenomes-Tr; EBT00001593616.
DR   EnsemblGenomes-Tr; EBT00001593617.
DR   EnsemblGenomes-Tr; EBT00001593618.
DR   EnsemblGenomes-Tr; EBT00001593619.
DR   EnsemblGenomes-Tr; EBT00001593620.
DR   EnsemblGenomes-Tr; EBT00001593621.
DR   EnsemblGenomes-Tr; EBT00001593622.
DR   EnsemblGenomes-Tr; EBT00001593623.
DR   EnsemblGenomes-Tr; EBT00001593624.
DR   EnsemblGenomes-Tr; EBT00001593625.
DR   EnsemblGenomes-Tr; EBT00001593626.
DR   EnsemblGenomes-Tr; EBT00001593627.
DR   EnsemblGenomes-Tr; EBT00001593628.
DR   EnsemblGenomes-Tr; EBT00001593629.
DR   EnsemblGenomes-Tr; EBT00001593630.
DR   EnsemblGenomes-Tr; EBT00001593631.
DR   EnsemblGenomes-Tr; EBT00001593632.
DR   EnsemblGenomes-Tr; EBT00001593633.
DR   EnsemblGenomes-Tr; EBT00001593634.
DR   EnsemblGenomes-Tr; EBT00001593635.
DR   EnsemblGenomes-Tr; EBT00001593636.
DR   EnsemblGenomes-Tr; EBT00001593637.
DR   EnsemblGenomes-Tr; EBT00001593638.
DR   EnsemblGenomes-Tr; EBT00001593639.
DR   EnsemblGenomes-Tr; EBT00001593640.
DR   EnsemblGenomes-Tr; EBT00001593641.
DR   EnsemblGenomes-Tr; EBT00001593642.
DR   EnsemblGenomes-Tr; EBT00001593643.
DR   EuropePMC; PMC2900214; 20628610.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00028; Intron_gpI.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01116; Yfr1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01318; CRISPR-DR5.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01701; Cyano-1.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02033; HEARO.
DR   SILVA-LSU; CP002059.
DR   SILVA-SSU; CP002059.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4084143
CC   Source DNA and organism available from Birgitta Bergman
CC   (Birgitta.Bergman@botan.su.se)
CC   Contacts: Birgitta Bergman (Birgitta.Bergman@botan.su.se)
CC      Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: 'Nostoc azollae' 0708
CC   GOLD Stamp ID         :: Gi03474
CC   Greengenes ID         :: 708
CC   Isolation Site        :: water fern Azolla commonly known as
CC                            duckweed
CC   Oxygen Requirement    :: Aerobe
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Host
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5354700
FT                   /organism="'Nostoc azollae' 0708"
FT                   /strain="0708"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:551115"
FT   gene            96..1758
FT                   /pseudo
FT                   /locus_tag="Aazo_0001"
FT                   /product="hypothetical protein"
FT   gene            2007..2231
FT                   /locus_tag="Aazo_0002"
FT   CDS_pept        2007..2231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0002"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mitochondrial protein Fmp25, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62669"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62669.1"
FT                   /translation="MPFFTAYVSFYAPLDFFSPQFLPVALYGAECGLYATFITDIKLSD
FT                   SKNNSLGEQGDFVSWGKDCAFSYSNYRYR"
FT   gene            2814..2942
FT                   /locus_tag="Aazo_0003"
FT   CDS_pept        2814..2942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62670"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVL9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62670.1"
FT                   /translation="MRQKILAKDLSQTELVQSIDRKGIAEESMGQKVEILLSLIEQ"
FT   gene            3380..4228
FT                   /locus_tag="Aazo_0004"
FT   CDS_pept        3380..4228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_1210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62671"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVM0"
FT                   /inference="similar to AA sequence:KEGG:RoseRS_1210"
FT                   /protein_id="ADI62671.1"
FT                   /translation="MTQGKLLEFLENIDLLEHFQLPTKWQNPLEVLPQETVLSEAEFHT
FT                   LLDTHLPKLGSQQRTRIMEAVAIAFYHQQTDWPVVQTLVCDDAPQLKLLTDNIALCWVD
FT                   EERNYKKLSAFIACHQKVLDKFLDDFWNYYRDLLPCQDSPSQQTADKLRYKFWKLFHTD
FT                   SGYQQLDERKPLTLVKISELLYVLEHPELPLHNNPVELGARTMVQRGNISYATQTLEGT
FT                   QAWDTFMYLVATTRKLGISFFEYIRDRISKVGNIPCLATTFYEKSALNPFGCSWIPHSA
FT                   P"
FT   gene            complement(4168..4305)
FT                   /locus_tag="Aazo_0005"
FT   CDS_pept        complement(4168..4305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62672"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVM1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62672.1"
FT                   /translation="MPFFTAYVSFYAPLDFFSPQFLPVALYGAECGIHEQPKGLRADFS
FT                   "
FT   gene            complement(4554..6230)
FT                   /pseudo
FT                   /locus_tag="Aazo_0006"
FT                   /product="hypothetical protein"
FT   gene            complement(6909..7676)
FT                   /locus_tag="Aazo_0007"
FT   CDS_pept        complement(6909..7676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62673"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVM2"
FT                   /inference="similar to AA sequence:KEGG:Ava_1804"
FT                   /protein_id="ADI62673.1"
FT                   /translation="MRNSIITSRQVIKYLQFPALAVILGANLAITTLAPKVLAQTTLAS
FT                   FVGNAVTFTCNDSEATIKAKNGPKAIFGTRTIYIGYQQVTSVNKDPRMIRFDNGVRKWC
FT                   RSDYETTSDDGTGYGLLWNGSGVLYGVFTSTGSQTGNNFWRFAAGRWLPSYGSGGGAKV
FT                   AVIARINPTTGDVNYATFVSARKLSDGKTNSLVIRGLSWNGTTLTVEADSWSSPRRADR
FT                   SSMTCSGSSPFKYTAVFTGDLIKVNSATAVTCN"
FT   gene            complement(7739..8306)
FT                   /pseudo
FT                   /locus_tag="Aazo_0008"
FT                   /product="hypothetical protein"
FT   gene            8358..8510
FT                   /locus_tag="Aazo_0009"
FT   CDS_pept        8358..8510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62674"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVM3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62674.1"
FT                   /translation="MILNVRRASLKEIVKNLRDTIAYGTLPVHAVSQRDTLGYHYDISP
FT                   SLTRL"
FT   gene            complement(8529..11656)
FT                   /pseudo
FT                   /locus_tag="Aazo_0010"
FT                   /product="hypothetical protein"
FT   gene            complement(8762..10203)
FT                   /pseudo
FT                   /locus_tag="Aazo_0011"
FT                   /product="hypothetical protein"
FT   gene            complement(10818..11150)
FT                   /locus_tag="Aazo_0012"
FT   CDS_pept        complement(10818..11150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr0622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62675"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVM4"
FT                   /inference="similar to AA sequence:KEGG:alr0622"
FT                   /protein_id="ADI62675.1"
FT                   /translation="MMKLKTGITSFGINQLLYPGGLLSYLEQSQTTPNNAHQLVELSLD
FT                   NSNKTNITPESEQNQRPNITLVYEKLGNNFSQKGEYAPAINNYNQALQHKPCNADIYYK
FT                   LELSYY"
FT   gene            complement(11783..12535)
FT                   /locus_tag="Aazo_0013"
FT   CDS_pept        complement(11783..12535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R6094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62676"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVM5"
FT                   /inference="similar to AA sequence:KEGG:Npun_R6094"
FT                   /protein_id="ADI62676.1"
FT                   /translation="MYFTWLDSNSWLMEIGKQRILVDPWLVDCLTFNNLDWLFKGYRLQ
FT                   DRPIPENIDLILLSQGLEDHAHPPTLKQLDKNIQVVASPNAAKVVEKLGYKNLITLNHG
FT                   ETFTLNNQVEIKAFPGSPIGPTVLENGYLLKELSSDLTLYYEPHGYHSPQLKQLAPINI
FT                   VITPIVDLTLPLLGSMIKGMNSALEVTKWLQPQIILPTAAGGDILFEGFLKKFLQAKGS
FT                   TEEFQALLEKNNLATRLVAPKPGEQVGF"
FT   gene            complement(12594..13349)
FT                   /locus_tag="Aazo_0014"
FT   CDS_pept        complement(12594..13349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0014"
FT                   /product="KaiB domain protein"
FT                   /note="PFAM: KaiB domain protein; KEGG: npu:Npun_F2508 KaiB
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62677"
FT                   /db_xref="GOA:D7DVM6"
FT                   /db_xref="InterPro:IPR011649"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039022"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVM6"
FT                   /inference="protein motif:PFAM:PF07689"
FT                   /protein_id="ADI62677.1"
FT                   /translation="MTDKLSTPELFKGIALFTPGGDLIYCIDPSKQGRWHLHLCGALQE
FT                   ILDLPEPPHFLVPCYTATIDHWLNPRTEQVQTFAEAYPAVMRHQSVLRAIFGTGELVWQ
FT                   TAPWQEDLCDRMVLGTYRSSFPQLWEDHDLIVRLDRADIAPQYQQHKLNPQQGIAHTQG
FT                   YVLRLFVAGHSVATERILQNLHELLERSLKYPYTLKVIDVLTHPEQAEIDQVSATPTLV
FT                   KVWPHPIRRIVGDLDNVDKLLQTLGAKEI"
FT   gene            complement(13394..14638)
FT                   /locus_tag="Aazo_0015"
FT   CDS_pept        complement(13394..14638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0015"
FT                   /product="twitching motility protein"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; KEGG: ava:Ava_3660 pilus
FT                   retraction protein PilT; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62678"
FT                   /db_xref="GOA:D7DVM7"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVM7"
FT                   /inference="protein motif:TFAM:TIGR01420"
FT                   /protein_id="ADI62678.1"
FT                   /translation="MIQPQGCSLPPGPPAPPPPTSATPRPTQIMQMQTEIKSNPPGKNA
FT                   PPPPQIPPAPATLKQPSGLTLAQLIQEAFDQGYSDVHVGIGEIPRFRNRGEIQMTNYPE
FT                   VDKPTFISWLREIMTDAEIQRFQDTLEFDGATQYEFARIRVNVFDSLRGYAMVLRLIPL
FT                   KILSMDQLRLPPIFRDICHYHKGFILVTGPTGSGKSTTMAAMVDYINREMPKHIITIED
FT                   PIEFVHPSRKSLIKQREVGMHTLKFDNALKAALREDPDLILVGEMRDKETVNTALKAAQ
FT                   TGHLVMGTLHTNSAVKTIERILNFYSGDQQDAVRVAFSESLVAIIAQGLCRTTDGKRAA
FT                   FHDILINTEAVKEWIKDGKYDDIGELMKQAGFDGMMTMNQSLFNLYQEGRITEETAIEM
FT                   SPTPNEMMQFLRGRV"
FT   gene            complement(14774..16188)
FT                   /pseudo
FT                   /locus_tag="Aazo_0016"
FT                   /product="hypothetical protein"
FT   gene            complement(16241..16858)
FT                   /pseudo
FT                   /locus_tag="Aazo_0017"
FT                   /product="hypothetical protein"
FT   gene            16966..17157
FT                   /locus_tag="Aazo_0018"
FT   CDS_pept        16966..17157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asl4482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62679"
FT                   /db_xref="InterPro:IPR021291"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVM8"
FT                   /inference="similar to AA sequence:KEGG:asl4482"
FT                   /protein_id="ADI62679.1"
FT                   /translation="MEIGQKVKVIRIRDRVSAPITKKLGQFGMIEGYKVTDGGGFGVVV
FT                   KFDDNSSTWFFEDEIKAI"
FT   gene            17227..18330
FT                   /locus_tag="Aazo_0019"
FT   CDS_pept        17227..18330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0019"
FT                   /product="anion-transporting ATPase"
FT                   /note="KEGG: ava:Ava_3342 anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62680"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVM9"
FT                   /inference="similar to AA sequence:KEGG:Ava_3342"
FT                   /protein_id="ADI62680.1"
FT                   /translation="MALILTFLGTSSIARSKIAIAASKLLANQGKRVLLAGLAEPTLSI
FT                   LLGTSLSPDPQEIAPNFQAVQFVSSVLLERNWEEVKKLEAQYLRTPIFKEVYGQELVVL
FT                   PGMDNALALNAIREYDASGKYDAIIYDGRGESSTLRMLGMPESLSWYVRRFRQLFVNSD
FT                   LGKTISESPLIQSVITSFFNVNWTVDNSAQPTNQVNNFLEHGKTALADPQRVAAFLVTT
FT                   PDPIDVANSRYLWGTAQQVGLTIGGAILLAADEENSNLSAEFTPLPITILPDVLNGEWQ
FT                   PLIDALPNFVEQALQAPKPIEIDVHNREVRLFLPGFDKKQVKLTQYGPEVTVEAGDQRR
FT                   NIFLPPALSGKPVTGAKFQNSYLIISF"
FT   gene            18437..19468
FT                   /locus_tag="Aazo_0020"
FT   CDS_pept        18437..19468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0020"
FT                   /product="bacteriochlorophyll/chlorophyll synthetase"
FT                   /note="KEGG: ana:all4480 bacteriochlorophyll/chlorophyll a
FT                   synthase; TIGRFAM: bacteriochlorophyll/chlorophyll
FT                   synthetase; chlorophyll synthase, ChlG; PFAM: UbiA
FT                   prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62681"
FT                   /db_xref="GOA:D7DVN0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006372"
FT                   /db_xref="InterPro:IPR011799"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVN0"
FT                   /inference="protein motif:TFAM:TIGR01476"
FT                   /protein_id="ADI62681.1"
FT                   /translation="MSESTPINPNPQPSEAVESTSAEVTSAERTAKTRQLLGMKGAAPG
FT                   ETSIWKIRLQLMKPITWIPLIWGVVCGAASSGNYTWTLENVLKSALCMLLSGPLLTGYT
FT                   QTINDYYDRDIDAINEPYRPIPSGAISEKEVITQVIVLVLLGYGVAYTLDLWAGHTFPN
FT                   VLMLSIFGTFIAYIYSAPPLKLKQNGWLGNYALGASYIALPWWAGHALFGELNWWIVVL
FT                   TLFYSLAGLGIAIVNDFKSVDGDRQLGLQSLPVMFGVQTAALICVVMIDLFQGLVAAYL
FT                   VSIHENLYAAILVLLIIPQITFQDMYFLRDPIANDVKYQASAQPFLVLGMLVTGIALGH
FT                   AGV"
FT   gene            19620..19889
FT                   /locus_tag="Aazo_0021"
FT   CDS_pept        19620..19889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R4524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62682"
FT                   /db_xref="GOA:D7DVN1"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVN1"
FT                   /inference="similar to AA sequence:KEGG:Npun_R4524"
FT                   /protein_id="ADI62682.1"
FT                   /translation="MLNFISFLINGIQPLLIPICFVIAWTVIILVFMNLWAATKDTIKT
FT                   AQKMHKIPCHNCQFFTKNYRLKCTVNPYIANTEEAIGCKDYQSN"
FT   gene            19895..20083
FT                   /locus_tag="Aazo_0022"
FT   CDS_pept        19895..20083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyn:Cyan7425_2403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62683"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVH1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62683.1"
FT                   /translation="MFLSESGFREHQKINYPKIQGGLRWANPIHINVGIGLQDIVPAMA
FT                   TVVHEVGKKLKIEGKSE"
FT   gene            20109..20240
FT                   /pseudo
FT                   /locus_tag="Aazo_0023"
FT                   /product="hypothetical protein"
FT   gene            complement(20246..21225)
FT                   /pseudo
FT                   /locus_tag="Aazo_0024"
FT                   /product="hypothetical protein"
FT   gene            complement(21277..21996)
FT                   /locus_tag="Aazo_0025"
FT   CDS_pept        complement(21277..21996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amr:AM1_0779 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62684"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVH2"
FT                   /inference="similar to AA sequence:KEGG:AM1_0779"
FT                   /protein_id="ADI62684.1"
FT                   /translation="MKQVTAFIEKKKQEFAQTPFMKFLQDKSIDPRQRLTWAPAFAPFA
FT                   MSFKDLNRNVLRKEPASSKLQEMINQHTYEDGRHWVWFLQDMKVMGYDHSINFTDTLKF
FT                   LWGEETIKVRQMAYDLFAICTFEEDILMKLVVIESIEATGNVALYEIAQVAKELQQITK
FT                   QHHPYFGESHFAKETGHIQADIDHDVEYFVESIQLTEAQRKKAFMLVEKVFADFTEAMS
FT                   EMLVFAQKHPYNQPFKL"
FT   gene            complement(22085..22291)
FT                   /locus_tag="Aazo_0026"
FT   CDS_pept        complement(22085..22291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62685"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVH3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62685.1"
FT                   /translation="MEGQKACAARLLQSEIQDPKSRIQNLKWYNVYYFHLILCKLTRYK
FT                   LVGLNAHLILEKPINNFIEHHHQ"
FT   gene            complement(22596..23405)
FT                   /locus_tag="Aazo_0027"
FT   CDS_pept        complement(22596..23405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0027"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: npu:Npun_F4521
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62686"
FT                   /db_xref="GOA:D7DVH4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVH4"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ADI62686.1"
FT                   /translation="MNDFWNTILEFSETTTTRVGQQLMQDFGKVEASQKADGSLVTQAD
FT                   KWADQEIRDAIASNFSGYGILSEESDQTFPNTEWCWVIDPLDGTTNFTRGIPIWSISLG
FT                   LLYQGMPIFGYVYAPPLNHQSFYGFWPDSSGLTTPTGAFLNHHAIHTSQDTPSGNHFFN
FT                   LCSRSTGIIQPGFPCKLRMLGVASYNFLTVATGAVLGGIEATPKVWDIAGAWVIVQAAG
FT                   GSWISLKDEPFPLSPGTDYSDHSFPTMVVSQPELVPVFTPFIEGVKL"
FT   gene            complement(23465..24898)
FT                   /locus_tag="Aazo_0028"
FT   CDS_pept        complement(23465..24898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0028"
FT                   /product="PUCC protein"
FT                   /note="PFAM: PUCC protein; KEGG: ava:Ava_3332 PucC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62687"
FT                   /db_xref="GOA:D7DVH5"
FT                   /db_xref="InterPro:IPR004896"
FT                   /db_xref="InterPro:IPR026036"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVH5"
FT                   /inference="protein motif:PFAM:PF03209"
FT                   /protein_id="ADI62687.1"
FT                   /translation="MTSGDVFDTQTESLAVPKVNLMTMFRLGLFQMGLSMMSILTLGVL
FT                   NRVMIQEIAIPATLVSLVLALPAFVSPTRILFGQISDAKPMLGYHRTAYVWIGAGIFAI
FT                   AAFLAVQVMWQLNTVNIADTWIWTTQTIGWTGVLGLVFAVYGLAICVSGTTFAALLVDI
FT                   SEEDNRSQVVGIVWSMLMVGIIVGAIISSSLLKQLTAGAAIETLQAAINRLFMIVPGIV
FT                   FVLAIVATIGVEKKYSRFSKRSIPGNREDSITLAKAWSILTASPQTGIFFTFLLVMTIS
FT                   LFMQDPILEPYAGEVFKMPLAESTRLNIFYGTGILIAYGVTGFLIVPRLGKRRTIKLGC
FT                   ILVALSALLLGLSGFSANPNFLKFGLVIFGLSTGFLTTAAVSLMLDLTVAEAAGTFIGA
FT                   WGLAQSISRGIAVVIGGAVLDLGRNLLPNNLVLAYGSVFSLEAVGMLVSIWFLSRVNVT
FT                   EFQTNTKQALASVLESDLD"
FT   gene            24988..25211
FT                   /pseudo
FT                   /locus_tag="Aazo_0029"
FT                   /product="hypothetical protein"
FT   gene            complement(25591..25713)
FT                   /locus_tag="Aazo_0030"
FT   CDS_pept        complement(25591..25713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62688"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVH6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62688.1"
FT                   /translation="MALAKLAYSVLLTADEKIPVYPDEQKFIRRMVQCLRTLNW"
FT   gene            complement(26841..26945)
FT                   /locus_tag="Aazo_0031"
FT   CDS_pept        complement(26841..26945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62689"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVH7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62689.1"
FT                   /translation="MFEKLVNDQRDIFGVSLKKLTADGCSGSLRLGIS"
FT   gene            27160..28447
FT                   /pseudo
FT                   /locus_tag="Aazo_0032"
FT                   /product="hypothetical protein"
FT   gene            28730..31201
FT                   /locus_tag="Aazo_0033"
FT   CDS_pept        28730..31201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0033"
FT                   /product="heterocyst differentiation protein HetF"
FT                   /note="KEGG: npu:Npun_F3553 heterocyst differentiation
FT                   protein HetF"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62690"
FT                   /db_xref="GOA:D7DVH8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVH8"
FT                   /inference="similar to AA sequence:KEGG:Npun_F3553"
FT                   /protein_id="ADI62690.1"
FT                   /translation="MTQEFHISVTPVGQNDYLVRTEQVAPGVPLAEELVTWPVAEWLAA
FT                   AGHLMNDPLQLVLQGDAIARNSVNLVALGQQLYNALFQGTLRDSWITAQGIAQNQQQVL
FT                   RLRLGLKDTKLARLPWEVMHAGDRPLATGPYIAFSRYQSGIPSTSRLPTRNLPTQQEDY
FT                   GVKVLMIISSPTDQVHLDLLKQEAINLQTELHRQNPRGENDHYLPEIDLTVLDQPGREE
FT                   LTQALEQGRYQVLHYSGHSNVGANGGEIYLVSRRTGLTETLSGDDLAGLLINNNIQMAV
FT                   FNSCLGAYRAKSETSGDTGERNLTESLVKRGLKSVLAMSERIPDEVALTLTQLFYRNLS
FT                   QGYPLDLCVSRVRQGLISAYGSHQMYWALPILYLHREFEGFLSPQISFSGNGELLNEYQ
FT                   SPMGTSANSMYASADDLEIPLNFEDIMPSDLSRESSELDWLGDDTWGDLLDEVDYEHPD
FT                   YDEDSAIVADLFRQLGNPQVLTEETSMKAELESSVRENHRQEIQASEKQEDIDFWGDKS
FT                   TSRTPNLSDTEGNQVVSPQIALLPIRQPRRLRRRWPMAGIIGVSVLAAIIGLIWWSNHR
FT                   QSRGVKIPPIPVQNGPQNKAVAVDFKKSSTGIVTATATEQLSQGNLQPGLEAVEELLNR
FT                   GALASADTALALIPTKQTEDPAVNFMRGRLAWQFAQTRETKYSINDARRYWEIAVRDQP
FT                   NSVLYNNAVGFAYYAEGNLNRANDAWFKAVNLALKNQNTNFPLTPNANSIMPPEALTAY
FT                   AGLALGLYKSVNNQPSAKQAQYMNEAIKLRQLVIQNDPVSFTVDKLAQNWLWTEKAIAD
FT                   WRSLLQQQKKR"
FT   gene            31313..31651
FT                   /locus_tag="Aazo_0034"
FT   CDS_pept        31313..31651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0034"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   ava:Ava_0137 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62691"
FT                   /db_xref="GOA:D7DVH9"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVH9"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADI62691.1"
FT                   /translation="MRKVEAIIRPFKLDEVKIALVNAGIVGMTISEVRGFGRQKGQTER
FT                   YRGSEYTVEFLQKLKVEIVVEDAQVDMVVDKIIGAARTGEIGDGKIFISPVEQVIRIRT
FT                   GEKNTEAV"
FT   gene            31832..31945
FT                   /locus_tag="Aazo_0035"
FT   CDS_pept        31832..31945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:asl2923 virulence-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62692"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVI0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62692.1"
FT                   /translation="MNWQKNYELRLAEQKIGKEMKASISPWISTGNMEITI"
FT   gene            32183..32386
FT                   /locus_tag="Aazo_0036"
FT   CDS_pept        32183..32386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62693"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62693.1"
FT                   /translation="MMILQGFVKGVRNVLAHIHGQQEEVKKPYEYLLHLFFAYALMRLP
FT                   KQNHKIANFFFFSYSFALFVVR"
FT   gene            complement(32428..33006)
FT                   /locus_tag="Aazo_0037"
FT   CDS_pept        complement(32428..33006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0037"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="KEGG: npu:Npun_R4467 RdgB/HAM1 family non-canonical
FT                   purine NTP pyrophosphatase; TIGRFAM: non-canonical purine
FT                   NTP pyrophosphatase, rdgB/HAM1 family; PFAM: Ham1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62694"
FT                   /db_xref="GOA:D7DVI2"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVI2"
FT                   /inference="protein motif:TFAM:TIGR00042"
FT                   /protein_id="ADI62694.1"
FT                   /translation="MTKTLVVATGNPGKLREMQAYLADSGWELTLKPEDLDVDETGETF
FT                   LANACLKASEVAKATGNWAIADDSGLAVDALNASPGVYSARYGKTDAERISRLLRELGD
FT                   TENRQAQFVCAVAVANPTGEIVLQSEGICRGEILYATSGEGGFGYDPIFYVPENQLTFA
FT                   EMSPELKKSISHRGNALKNLVPQLVKVLG"
FT   gene            complement(33087..34529)
FT                   /locus_tag="Aazo_0038"
FT   CDS_pept        complement(33087..34529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0038"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase; KEGG: ana:all5089
FT                   phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62695"
FT                   /db_xref="GOA:D7DVI3"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVI3"
FT                   /inference="protein motif:PFAM:PF02878"
FT                   /protein_id="ADI62695.1"
FT                   /translation="MPVVTNPIKFGTDGWRGVIGDEFTFERLALVAPVAAKVLYNTYYS
FT                   HVSSRTIIVGYDRRFMAEEFARVVADAVTAVGFDVLFSESYAPTPAFSWAAKELNALGA
FT                   LVITASHNPGTYLGLKVKSAFGGSVPPEVTKEIEGLLTVEVPTAPIPGKEEKFDPWPSY
FT                   CGALQGKVDIDKIRQAIATSKLTLFVDVMHGAAASGLGRLLGEKVQEINSNRDPLFEGG
FT                   APEPLPKYLSRLFAEIKTHGESNNSGLTVGLVFDGDCDRIAAVDKNPNFLSSQILIPIL
FT                   IDHLTRRRNFTGEIVKTVSSSDLIPLVAKLLNLSVFETAVGYKYIANRMLATEVLLGGE
FT                   ESGGIGYGSHIPERDALLSALYVLEAVVESGLDLGDYYHELQQKTNFTSAYDRIDLPLA
FT                   NMELRGKLLQQLQTQPLTEIAGKKVIDCNTIDGYKFSLADQSWLMIRFSGTEPVLRLYC
FT                   EAPTIEQVHQTLAWAKNWAESN"
FT   gene            complement(34631..35308)
FT                   /locus_tag="Aazo_0039"
FT   CDS_pept        complement(34631..35308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0039"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="KEGG: npu:Npun_F3274 phosphoribosylglycinamide
FT                   formyltransferase; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62696"
FT                   /db_xref="GOA:D7DVI4"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVI4"
FT                   /inference="protein motif:TFAM:TIGR00639"
FT                   /protein_id="ADI62696.1"
FT                   /translation="MNQYYPTEVVSSLICPDISQENFQSMKSLKLGIMASGNGSNFEVV
FT                   AQAIEERKLNAKIQVLIYNNPSAKAALRAKNHGLEAVLLNHRDYNKREDLDQKIVQTLR
FT                   QYDVDMVIMAGWMRLVTQKLIDAFPDKIINIHPSLLPSFKGVQAVEQALEAGVKITGCT
FT                   VHLLRLEMDSGPILMQAAVPVFPEDTAETLHARIQIQEHRILPLAIASLAEGIAYLGAR
FT                   GNQ"
FT   gene            35351..36241
FT                   /pseudo
FT                   /locus_tag="Aazo_0040"
FT                   /product="hypothetical protein"
FT   gene            complement(36303..37082)
FT                   /locus_tag="Aazo_0041"
FT   CDS_pept        complement(36303..37082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0041"
FT                   /product="ABC-2 type transporter"
FT                   /note="KEGG: npu:Npun_R1225 ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62697"
FT                   /db_xref="GOA:D7DVI5"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVI5"
FT                   /inference="similar to AA sequence:KEGG:Npun_R1225"
FT                   /protein_id="ADI62697.1"
FT                   /translation="MNPSRTFVMAKNVFQEVIRDRILYIIGFYAIILAVGNRAIFEFAA
FT                   TTQDKIFLDFGLAGMNIIGLIVVVFIGTALVNKEIEKRTILMLIAKPISRSEFITSKYL
FT                   GLSGVLAVLIAAMTAIYLVFLQLGKIPYPTTTILIAVLFLFLQLTLISAVAITLGVFTS
FT                   SLIATPLTFAVYLMGNITQDLVALGHLSQNPGVERITQGLYLILPNLSRLDLKNDAVYG
FT                   LQAIPDPVTLIGNATYGLLYSFMLLAITIFIFLRREF"
FT   gene            complement(37124..38134)
FT                   /locus_tag="Aazo_0042"
FT   CDS_pept        complement(37124..38134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R1226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62698"
FT                   /db_xref="GOA:D7DVI6"
FT                   /db_xref="InterPro:IPR020360"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVI6"
FT                   /inference="similar to AA sequence:KEGG:Npun_R1226"
FT                   /protein_id="ADI62698.1"
FT                   /translation="MNSSLFKEVILIFKFIQDLFLGIQKVIMPLKAFSWQTLIYLSVFS
FT                   WGISYLAIGFIKDIIAFSGWLFLIAGTAWYTTDNPLRVPGTFMPVGALITGFLVSVFAF
FT                   GHEVNVVTPKTIVFWPTIAAIITAIPEFFAGTGTTSKAAIPKLEVRQKVIILLAWSMLI
FT                   SCWLQFYFVLDQWLKEYPSLSAQNFLRSTFVIRLEPKSKTPQNGNIILNRMQPLIEEQI
FT                   FKKPWSEVEKWLIEANQQMGNLGKGVIYKNLEKYDEQGLWGIEARVVNVKSGYRLDILT
FT                   IWTGPSANTRGFYLQKSCLIQPVAAVNKPENQNAVAEIECDRTNKFFIGSPPPKQ"
FT   gene            complement(38168..38716)
FT                   /locus_tag="Aazo_0043"
FT   CDS_pept        complement(38168..38716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0043"
FT                   /product="filament integrity protein"
FT                   /note="KEGG: ana:alr2392 filament integrity protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62699"
FT                   /db_xref="GOA:D7DVI7"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVI7"
FT                   /inference="similar to AA sequence:KEGG:alr2392"
FT                   /protein_id="ADI62699.1"
FT                   /translation="MPEELSLPRILPIGAMLFETLFLLVAISIEGYVLHRWLKFDKKTS
FT                   IFYALAINVFSSVFGWNIFFLVEPRLDVKLKSELISYIFFNNFKNPGTQSTIIFLASLI
FT                   FLGTFLIKFLLLKVLIITLSEIGEKEKIETSQQQKLYRIEKMQLQNTNLITTTLIANSM
FT                   SYTAITLILLIRNLSIGLN"
FT   gene            38943..40079
FT                   /locus_tag="Aazo_0044"
FT   CDS_pept        38943..40079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0044"
FT                   /product="ATP:corrinoid adenosyltransferase BtuR/CobO/CobP"
FT                   /note="PFAM: ATP:corrinoid adenosyltransferase
FT                   BtuR/CobO/CobP; KEGG: npu:Npun_F1228 corrinoid
FT                   adenosyltransferase BtuR/CobO/CobP"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62700"
FT                   /db_xref="GOA:D7DVI8"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVI8"
FT                   /inference="protein motif:PFAM:PF02572"
FT                   /protein_id="ADI62700.1"
FT                   /translation="MTRNGIGIRTAQVRSERLTGQIHVYDGIGKGKSQAALGVVLRSIG
FT                   LGINTPSDSNRVLLLRFLKGPERDYDEDGAIAALQRGFPHLIDQVRTGRAEFFGHDEIT
FT                   PFDRTEAARGWDVAKGAIASGLYSVVVLDEINPVLDLGLLAVNEVVQTLKSKPQELEII
FT                   ATGRGAPQQLLDIADLHSEMKPQHHPTAEALFLEGIEIYTGLGKGKSTSALGKALQAIG
FT                   RGINHPGSTRVLIMQWLKGGSGYTEDAAIAALQKSYPEVVDHQRCGRDAIVWRNSRQEL
FT                   DYVEAERGWEIAKTAIASGIYKTIILDELNPTVDLELLPVDPIVQALLRKPRDTEVIIT
FT                   GRCQNQPAYFDLASIHSEVYCHKHYANQGVELKRGVDF"
FT   gene            complement(40393..40842)
FT                   /pseudo
FT                   /locus_tag="Aazo_0045"
FT                   /product="hypothetical protein"
FT   gene            complement(40812..41195)
FT                   /pseudo
FT                   /locus_tag="Aazo_0046"
FT                   /product="hypothetical protein"
FT   gene            41345..41578
FT                   /locus_tag="Aazo_0047"
FT   CDS_pept        41345..41578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62701"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62701.1"
FT                   /translation="MVIEGYLGTELLIHHFDGSQGQYQGYVVRRRVYLLGARIFDELTT
FT                   EVANLSDSLRVYMSCIINVNFKWFGHWLTYLS"
FT   gene            complement(41729..42781)
FT                   /locus_tag="Aazo_0048"
FT   CDS_pept        complement(41729..42781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0048"
FT                   /product="cytochrome c-type biogenesis protein CcsB"
FT                   /note="KEGG: npu:Npun_F5955 cytochrome c assembly protein;
FT                   TIGRFAM: cytochrome c-type biogenesis protein CcsB; PFAM:
FT                   cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62702"
FT                   /db_xref="GOA:D7DVJ0"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVJ0"
FT                   /inference="protein motif:TFAM:TIGR03144"
FT                   /protein_id="ADI62702.1"
FT                   /translation="MNLIVLQNWLDNASFAVLFCTMLVYWVGAAFPSLSVTTALGTGGM
FT                   AIANLCIAALLGARWIEAGYFPLSNLYESLFFLTWGITAVHLIAENTSRSRLVGVVTAP
FT                   VAMGIAAFATLTLPSTMQVSEPLVPALKSNWLMMHVSVMMLSYSALMVGSLLGIAFLIV
FT                   TRGQNIQLQGSSVGTGSYRRNGYKLLKAGELVTQPSTPSPENNGFSRLESSNNGHGTAV
FT                   LDLVTVAETQNIASSERLSPQRLSLAETLDNISYRIIGLGFPLLTIGIIAGGVWANEAW
FT                   GSYWSWDPKETWALITWLVFAAYLHSRITRGWQGRKPAILAAGGFVVVWICYLGVNILG
FT                   KGLHSYGWFF"
FT   gene            complement(42970..44670)
FT                   /locus_tag="Aazo_0049"
FT   CDS_pept        complement(42970..44670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F5954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62703"
FT                   /db_xref="InterPro:IPR021787"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVJ1"
FT                   /inference="similar to AA sequence:KEGG:Npun_F5954"
FT                   /protein_id="ADI62703.1"
FT                   /translation="MTLPIVSEKKKKKRSLVLTLSAAALLIGVGSFAHWFFTQGRPFSR
FT                   SLPVGANIIPQDALFAVSLTTDTKQWQKLREFGTPETQKELDKNLVQLRDRWLTNNGYN
FT                   FEKDIQPWVGDEVTIAVLPPPVVKPVLKPVATEANIPYEQSMVMVLPIKNPAIAKKMLA
FT                   QSQTLKQGKSTELTYRGIAIKQTEGKAGEKLSATLINQQLLVITDNAKATEKTIDAYKN
FT                   QTSVATLVGFAENFSKTSSYQPFAQFYINVPLAAKIAATAPNRRLPVQVLAQLQNNQGL
FT                   AGTLNLESEGVRLKGISWLSPNSQRVLAVENKAGSMQNRLPSETLMMLSGSNLKRLWAD
FT                   YVSTSGGNPLAPIKPEELRRGVKSLTNLDLDQDLLSWMKGEFSVSVIPNTSRDGSPDNF
FT                   RAGLVFMVKVSDGKAGVRQSAETALQNLDDVLKNQYQFKVESATVGGKPVVNWISPFGT
FT                   LTATHGWLDDNVVFFGFGAPISDKIVPKPNNTLANTLRFQQTVPKELNPAKGQFFLDME
FT                   RTVKSFPLNLESPGQQALLSAIQTIGITTAVNDNRSQEYDIFVELKKGK"
FT   gene            complement(44808..45425)
FT                   /locus_tag="Aazo_0050"
FT   CDS_pept        complement(44808..45425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0050"
FT                   /product="protein of unknown function DUF564"
FT                   /note="PFAM: protein of unknown function DUF564; KEGG:
FT                   npu:Npun_F5952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62704"
FT                   /db_xref="InterPro:IPR002800"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVJ2"
FT                   /inference="protein motif:PFAM:PF04482"
FT                   /protein_id="ADI62704.1"
FT                   /translation="MTTIVTPTNNLILPTDWHRLNPIWQGGEEDIQKGLPHTQLAPAWQ
FT                   LLLLGDGSPTRHLQLLTCEPIEVDVIDMSLIGMNSDNAPSLIQAVRGPRLRRQVWLRTP
FT                   SGQRLGYATSWWEASHVDEFLQNRSLPIWASLARIRTELYRDIKGIYCGYSAPLESGFD
FT                   EVGPFWGRHYLFWHHGHPLTLIYEVFSPYLTKYLGQQEGCKL"
FT   gene            complement(45582..45662)
FT                   /locus_tag="Aazo_R0001"
FT                   /note="tRNA-Leu4"
FT   tRNA            complement(45582..45662)
FT                   /locus_tag="Aazo_R0001"
FT                   /product="tRNA-Leu"
FT   gene            45996..47342
FT                   /locus_tag="Aazo_0051"
FT   CDS_pept        45996..47342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0051"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   biotin carboxylase domain protein; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; KEGG: npu:Npun_R5951
FT                   acetyl-CoA carboxylase, biotin carboxylase; SMART: biotin
FT                   carboxylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62705"
FT                   /db_xref="GOA:D7DVJ3"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVJ3"
FT                   /inference="protein motif:TFAM:TIGR00514"
FT                   /protein_id="ADI62705.1"
FT                   /translation="MKFDKILIANRGEIALRILRACEEMGIATVAIHSTVDRNALHVQL
FT                   ADEAVCIGEPASSKSYLNIPNIIAAALTRGATAIHPGYGFLAENARFAEICADHQIVFI
FT                   GPTPEAIRLMGDKSTAKETMQKAGVPTVPGSDGLVESDQEGKLIAKDIGYPVMIKATAG
FT                   GGGRGMRLVLSEDEFVKLFLAAQGEAGAAFGNAGVYIEKSIERPRHIEFQILADSYGNV
FT                   IHLGERDCSIQRRNQKLLEEAPSPALDEELRERMGQAAVKAARFINYTGAGTIEFLLDK
FT                   SGKFYFMEMNTRIQVEHPVTEMVTGIDLLVEQIRIAQGERLQLTQEQVILRGHAIECRI
FT                   NAEDPEHDFRPSPGKISGYLPPGGPGVRIDSHVYTDYQIPPYYDSLIGKLIVWGPDRST
FT                   AINRMKRALRECAITGLPTTIGFHQKIMETPQFLQGNVYTNFVQEMKEQ"
FT   gene            complement(47506..47799)
FT                   /locus_tag="Aazo_0052"
FT   CDS_pept        complement(47506..47799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0052"
FT                   /product="protein of unknown function YGGT"
FT                   /note="PFAM: protein of unknown function YGGT; KEGG:
FT                   npu:Npun_F5950 protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62706"
FT                   /db_xref="GOA:D7DVD1"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVD1"
FT                   /inference="protein motif:PFAM:PF02325"
FT                   /protein_id="ADI62706.1"
FT                   /translation="MTGINLTVWILSPVLGIMTFLFIFRIILTWYPQVNLNRLPFNLIA
FT                   WPTEPFLVLLRKVVQPIGGVDITPIIWVGIFSFIREILLGQQGLLTMMACVN"
FT   gene            complement(47796..47918)
FT                   /locus_tag="Aazo_0053"
FT   CDS_pept        complement(47796..47918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62707"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVD2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62707.1"
FT                   /translation="MTAFGYNVRENALESLNFSGLRPQVFFDLISSQIDSNSKP"
FT   gene            48022..48141
FT                   /locus_tag="Aazo_0054"
FT   CDS_pept        48022..48141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0054"
FT                   /product="photosystem II protein PsbX"
FT                   /note="PFAM: photosystem II protein PsbX; KEGG:
FT                   npu:Npun_R5949 photosystem II protein PsbX"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62708"
FT                   /db_xref="GOA:D7DVD3"
FT                   /db_xref="InterPro:IPR009518"
FT                   /db_xref="InterPro:IPR023431"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVD3"
FT                   /inference="protein motif:PFAM:PF06596"
FT                   /protein_id="ADI62708.1"
FT                   /translation="MTPSLANFLWSLVWGTAIVVIPATVGLIFISQKDKIQRS"
FT   gene            48374..49294
FT                   /locus_tag="Aazo_0055"
FT   CDS_pept        48374..49294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0055"
FT                   /product="Ycf66 family protein"
FT                   /note="PFAM: Ycf66 family protein; KEGG: npu:Npun_R5948
FT                   Ycf66 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62709"
FT                   /db_xref="GOA:D7DVD4"
FT                   /db_xref="InterPro:IPR010004"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVD4"
FT                   /inference="protein motif:PFAM:PF07444"
FT                   /protein_id="ADI62709.1"
FT                   /translation="MINFGLNSASVLAQVNFGANSASILGIFLAVAGAALYFLRTVRPE
FT                   LSRDQDIFFAAVGLLCGFILIFQGWRLDPILQFGQLLLVGSTVFFAVESIRLRSIATQQ
FT                   AKRNTPIVDDEREVSRKYSYSDRRNYQAEMDADLEPLPYYEEEEEDRPVRAKIRGSKDE
FT                   RSGREDYYEDQAPRRLERRNTREKPETTEKKRRTSSYSRSVNRPSESYEQENWGSVSRE
FT                   VDDWESSQEEVRKTPRRTTSNRPQRPASSEDDVAPRPRKGRPPVDSSPPRERYDEAIPT
FT                   DYVPYNPIEKPNDGSDNANDFDDEI"
FT   gene            49341..49895
FT                   /locus_tag="Aazo_0056"
FT   CDS_pept        49341..49895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0056"
FT                   /product="WD40 domain protein beta Propeller"
FT                   /note="PFAM: WD40 domain protein beta Propeller; KEGG:
FT                   ava:Ava_0520 WD-40-like beta propeller repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62710"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVD5"
FT                   /inference="protein motif:PFAM:PF07676"
FT                   /protein_id="ADI62710.1"
FT                   /translation="MKTFTFTLWLQRRIHWSLVFSLTGLLMSCGSGDIPLGVSSLNSRF
FT                   TEEQPALSGNGRFLAFVSNRNGNQQLLMYDLQTQSFIPTPGLNRRATIAESPSLSYTGR
FT                   YICYLTSEQGRPVIALYDRAMQQSQILTPTYRGWVRNPDISPDGRYVVFESASRGQWDV
FT                   EVLDRGPTVELDISNGSTVSN"
FT   gene            49954..50481
FT                   /locus_tag="Aazo_0057"
FT   CDS_pept        49954..50481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0057"
FT                   /product="WD-40-like beta propeller repeat-containing
FT                   protein"
FT                   /note="KEGG: ava:Ava_0522 WD-40-like beta propeller
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62711"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVD6"
FT                   /inference="similar to AA sequence:KEGG:Ava_0522"
FT                   /protein_id="ADI62711.1"
FT                   /translation="MTNYKLPIISFLSSSLLTGCFGYPRILSYPFDPGGRGLNSLASEL
FT                   NPQLSGRYILFTTDRRGSQDVYMFDTVSQNLVDLPGLNAFDTIASHPSVTQDGRYVVFV
FT                   ASHLGRSSIFLYDRETRQSRNLTANLQAEVCNPTISADGNTIAFEFSNNGQWDILLYDR
FT                   SGQQLNIPQEPR"
FT   gene            complement(50529..51536)
FT                   /locus_tag="Aazo_0058"
FT   CDS_pept        complement(50529..51536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0058"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="KEGG: npu:Npun_F5945 succinate dehydrogenase and
FT                   fumarate reductase iron-sulfur protein; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62712"
FT                   /db_xref="GOA:D7DVD7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVD7"
FT                   /inference="protein motif:TFAM:TIGR00384"
FT                   /protein_id="ADI62712.1"
FT                   /translation="MVIMEVIFKIIRQQENSAAVVQTYPLQVEPGNTILDCLNRIKWEQ
FT                   DGTLAFRKNCRNTICGSCSMQINGLSALACKENVGSQLARLQHIQSPKTQNKTIHEITI
FT                   APLGNMPVIKDLVVDMSIFWNNLEAVAPYVSTAARQVPEKEFLQTPQERSLLDQTGNCI
FT                   MCGACYSECNAREVNSDFVGPHALAKAYRMVADSRDSNTENRLENYNEGTKGVWGCTRC
FT                   FYCDSVCPMEVAPLEQITKIKQEILARKQASDSRSIRHRKVLIELVKAGGWIDERQFGI
FT                   QIVGNYFRDLQGLLSLAPLGLRMLVRGKFPLYFEPSEGTQQVRSLIESVQKAES"
FT   gene            51915..52085
FT                   /locus_tag="Aazo_0059"
FT   CDS_pept        51915..52085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0059"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eat:EAT1b_1283 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62713"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVD8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62713.1"
FT                   /translation="MPFTPTNQKNIDDASVNHKFTVHTSHFFRQALVIKSLQAVVKQKF
FT                   FEYREVSKRQK"
FT   gene            52447..52578
FT                   /locus_tag="Aazo_0060"
FT   CDS_pept        52447..52578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62714"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVD9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62714.1"
FT                   /translation="MKLRTNKTSTNRRTSAAVAALFIRNVEPRKFMSLLAGQQGVCP"
FT   gene            53034..53471
FT                   /locus_tag="Aazo_0061"
FT   CDS_pept        53034..53471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0061"
FT                   /product="transcriptional regulator AbrB"
FT                   /note="KEGG: npu:Npun_R5944 transcriptional regulator AbrB"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62715"
FT                   /db_xref="GOA:D7DVE0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVE0"
FT                   /inference="similar to AA sequence:KEGG:Npun_R5944"
FT                   /protein_id="ADI62715.1"
FT                   /translation="MTETATAPLTGKALLAKVKELSNLPRRERAKQCGYYTVTKNNQVR
FT                   VNLTDFYDALLSARGIPLSPEAPKDGRGREPTYRVSVHQNRQIVIGATYTKAMGLKPGD
FT                   EFEIRLGYKHIHLIQLGESDKKLTAPDIDADEADLEDEEEN"
FT   gene            53663..54535
FT                   /locus_tag="Aazo_0062"
FT   CDS_pept        53663..54535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0062"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: ava:Ava_0525
FT                   abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62716"
FT                   /db_xref="GOA:D7DVE1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVE1"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADI62716.1"
FT                   /translation="MIFLSAFLSLLEPSVNTLLAFLKNAPVVFLVMAFFIVWVGCWLPL
FT                   AGIITVLLNWQVNKPLQTEQKIPLLVSLYSLAPLILWGVNWLGFGSFADYGLVENHTIW
FT                   VSLLLGFGLGVLGLVMLFTCQLWLGWCYLEKSNIKLIPSILLPIYLVALFVGGIEELVF
FT                   RGFLLTTLEKDYPIWMAAIISSLIFALLHLVWEQRETLPEIPGLWLMGMVLVVARLADN
FT                   KNLGIAWGLHAGWVWVIATIDTAGLITYTGKVSDWFTGKNKKSLAGLAGVLYVLATGVI
FT                   LWWFSQNEF"
FT   gene            54525..54686
FT                   /locus_tag="Aazo_0063"
FT   CDS_pept        54525..54686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62717"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVE2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62717.1"
FT                   /translation="MSFKQKDSQFFREVGDLSQTEKRVWSVGKDSLSWTIKVTSLDPSL
FT                   RLGRFAIY"
FT   gene            complement(54793..55914)
FT                   /locus_tag="Aazo_0064"
FT   CDS_pept        complement(54793..55914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0064"
FT                   /product="geranylgeranyl reductase"
FT                   /note="KEGG: ava:Ava_0630 geranylgeranyl reductase;
FT                   TIGRFAM: geranylgeranyl reductase; PFAM: FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62718"
FT                   /db_xref="GOA:D7DVB0"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVB0"
FT                   /inference="protein motif:TFAM:TIGR02032"
FT                   /protein_id="ADI62718.1"
FT                   /translation="MYDCIIIGAGPAGGTAAYHLAKRGRSVLVLEKESLPRYKPCGGGV
FT                   SPAITQWFDFDFSPAISVKVDSLRFTWKLEDPVEAKIGIKEPVWMVRRHVFDHFLVQQA
FT                   QKQGAELKDYTEVTGIEFQGDYWQVNTANGSVTGHYLIAADGAKGPMAKWLGFKDRKRR
FT                   LAGALEAEVPAEVINNNMAYFEFGLLKNGYIWNFPKADGYSIGVGTFIGGEPQDFKKIL
FT                   DDYAKSFNLDVKTTKQYGHPICLWNGNQKLHTQNAVLAGEAACVVDPFTAEGIRPSIFS
FT                   GVLAAQFIHDALSGDINALENYTQAINEQWGTDMAWAQKLAGTFYRFPSIGYKVGVKRP
FT                   SGAQIMGKILCGELRYGDVVGRALKRLIPGFGG"
FT   gene            complement(56152..56700)
FT                   /locus_tag="Aazo_0065"
FT   CDS_pept        complement(56152..56700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0065"
FT                   /product="ribosome recycling factor"
FT                   /note="KEGG: ava:Ava_0629 ribosome recycling factor;
FT                   TIGRFAM: ribosome recycling factor; PFAM: ribosome
FT                   recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62719"
FT                   /db_xref="GOA:D7DVB1"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVB1"
FT                   /inference="protein motif:TFAM:TIGR00496"
FT                   /protein_id="ADI62719.1"
FT                   /translation="MKLAEAESKMQKTVESTQQAFNTIRTGRANASLLDRIQVEYYGSP
FT                   TPLKSLANISTPDASTILIQPYDRSSLNILEKAISLSDIGITPSNDGSVIRLNIPPLTS
FT                   DRRKEFAKLAAKYAEEGRVGIRNIRRDALDSIRKQEKAAEISEDESRDQQDKLQKLTNK
FT                   YTEKIDHLLTEKEKDITTV"
FT   gene            complement(56687..57415)
FT                   /locus_tag="Aazo_0066"
FT   CDS_pept        complement(56687..57415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0066"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /note="TIGRFAM: uridylate kinase; KEGG: npu:Npun_F6136
FT                   uridylate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62720"
FT                   /db_xref="GOA:D7DVB2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVB2"
FT                   /inference="protein motif:TFAM:TIGR02075"
FT                   /protein_id="ADI62720.1"
FT                   /translation="MGTNYRRVLLKLSGEALMGNMGYGIDPEVVKGIAQELGEVVATGV
FT                   QVAIVVGGGNIFRGVKAASAGMDRATGDYIGMIATVMNAMTLQDSLERIGVQTRVQTAI
FT                   AMQELAEPYIRRRAIRHLEKGRVVIFGAGSGNPFFTTDTTAALRAAEIEAEVIFKATKV
FT                   DGIYDADPEIYPEAKRYSTLTYTHVLAKDLRVMDSTAIALCKENNIPILVFDLTVRGNI
FT                   HRAVMGESIGTLVGGSCEIS"
FT   gene            complement(57883..58419)
FT                   /locus_tag="Aazo_0067"
FT   CDS_pept        complement(57883..58419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0067"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: ava:Ava_0627 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62721"
FT                   /db_xref="GOA:D7DVB3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVB3"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADI62721.1"
FT                   /translation="MLLILSCQELIHVHHMSRYRENLRTVCVIYMCKLCPYMQLYLDRL
FT                   KRIQTEFSADAFTLLGLNTANGNNDVSAESEFGAVSTFENMKAFAQQHELNFPYIWDSN
FT                   QDVTCSFGAISTPTGDLIDNEGILGYKGQIDNHPRHPLIEGVDFLKNVSAALFQGQEIH
FT                   PAQTEQIGTPLIWRK"
FT   gene            58757..59650
FT                   /locus_tag="Aazo_0068"
FT   CDS_pept        58757..59650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0068"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   npu:Npun_R6133 alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62722"
FT                   /db_xref="GOA:D7DVB4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVB4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADI62722.1"
FT                   /translation="MTTYTNAFISTKTWTWQGFPISYQTQGNAGPAVILVHGFGASWLH
FT                   WRKNIPALAEKCRVYAIDLIGFGASAKPVPGERITYTLESWGQQIADFCREVVGEPAFL
FT                   VGNSIGCIVVMQAAVSNPDIALGTALLNCSLRLLHDCKRVTLPWTKRVGAPILQKLLSI
FT                   PTVGEFFFSQLAKPKTVRKILLQAYGNGETVTDELVDILMKPANDPGAAAVFLAFTSYS
FT                   SGPLPEDLLPVLSCPAIILWGTADPWEPINLGKELANFPQVQKFIALDGVGHCPQDEAP
FT                   ELVNPILQDWIRELSI"
FT   gene            complement(59862..60762)
FT                   /pseudo
FT                   /locus_tag="Aazo_0069"
FT                   /product="hypothetical protein"
FT   gene            complement(60945..61157)
FT                   /locus_tag="Aazo_0070"
FT   CDS_pept        complement(60945..61157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0070"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62723"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62723.1"
FT                   /translation="MSVQILKSELFVDLPTEEQELASGRLGYAGLGGYSYGLPGAGLGY
FT                   GGSLGYGAYPSMGCYGVLPGAVFGY"
FT   gene            complement(61419..61658)
FT                   /locus_tag="Aazo_0071"
FT   CDS_pept        complement(61419..61658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GJ15071 gene product from transcript
FT                   GJ15071-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62724"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62724.1"
FT                   /translation="MSEKHITSDLVQEISSEEQQLLSGGWGGGPWGGGPWGGGPWGGGP
FT                   WGGGPWGGGPWGGGPWGGGPWGGGPWGRRHHYWY"
FT   gene            complement(62192..62371)
FT                   /locus_tag="Aazo_0072"
FT   CDS_pept        complement(62192..62371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62725"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVB7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62725.1"
FT                   /translation="MSNQINKSNLVELTIEAQQLISGGYCDYSPCYKPPKCCGYKPYCK
FT                   STPYKDYDYSSWYS"
FT   gene            complement(62641..62910)
FT                   /locus_tag="Aazo_0073"
FT   CDS_pept        complement(62641..62910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK13847 gene product from transcript
FT                   GK13847-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62726"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVB8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62726.1"
FT                   /translation="MSDKIKKSDLVAELCTEEQQLLSGGQYGMGRYPGSSYQGGDGYPG
FT                   SSYQGGDGYPGGGYQGGDGYPGGGYQGRKRYPTYICRPIYGYGY"
FT   gene            complement(63333..63650)
FT                   /locus_tag="Aazo_0074"
FT   CDS_pept        complement(63333..63650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F6131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62727"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVB9"
FT                   /inference="similar to AA sequence:KEGG:Npun_F6131"
FT                   /protein_id="ADI62727.1"
FT                   /translation="MADNHTSNHQALFHDLSEANQEILIAGQGFNVIGKTDFFFQKTDI
FT                   DSAADSDLNLEGSESITQSSKYKLSQISIGTSFTFGIPIINYPGNKLSDFLPNFLNKLF
FT                   S"
FT   gene            complement(63685..65853)
FT                   /locus_tag="Aazo_0075"
FT   CDS_pept        complement(63685..65853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0075"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: npu:Npun_F6130 ABC transporter related; PFAM:
FT                   ABC transporter related; peptidase C39 bacteriocin
FT                   processing; ABC transporter transmembrane region; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62728"
FT                   /db_xref="GOA:D7DVC0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVC0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI62728.1"
FT                   /translation="MFNPFKSQKQYQSVLQASEEDCGAACLASICKYYGRFLTINKSRE
FT                   AVGTGQLGTSLLGLKRGSDNLGFNARAVKASPELVDRITEIQLPAIIHWRGYHWVVLYG
FT                   QRGKKYVIADPAVGIRYIKREELVAAWNGVMLLLEPDPERSSQQPQEKPHGGLLRFFMR
FT                   ILPYRGLLTQVLMINIILGILALGTPVLIQLLTDDVLVRGDIQLLTVVVSAVVVMTIFS
FT                   SSLQVIQATMIAHFGQRLQLGLVLDFGRKILQLPLNYYESRRSGEITSRLSDINEINQL
FT                   LSQVVVLLPSQIFIAVISFCLMMFYSWQLTIAVIVCGVLMTLSSLPFLPILQQKNRSIL
FT                   VLGAENQGVLVETFKGAQVIKTTNAAPQFLDEFQTRFGRLANLTFSTIQIGIINGTIAK
FT                   LLSTLGGVILLGIGSMLVISNKLTIGQMLAFNALQVNVLALIGSLVGLVDEYFRSQTAI
FT                   SRLLEVIDATPEVVGGSEKPIAQIAVDADIHFSHLTFHHPGRVDLLEDFSLKLPGGKVI
FT                   ALIGKSGCGKSTLAKLIAGLYQPTSGNIRIGVFNIHDLSLDCLRQQVVYVPQEPHFWSR
FT                   SILENFRLGTPSIPFDQVVKACEIADADGFISQLPNKYQTVLGEFGANLSGGQRQRLAI
FT                   ARGILTNPPILILDEATAGLDPVSETHVLDRLFASRKGQTTILITHRPSVVNRADWIVL
FT                   MDKGQVELQGSLETFLSQKGEYMKFLTI"
FT   gene            complement(65947..67467)
FT                   /locus_tag="Aazo_0076"
FT   CDS_pept        complement(65947..67467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0076"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   npu:Npun_F6129 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62729"
FT                   /db_xref="GOA:D7DVC1"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVC1"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ADI62729.1"
FT                   /translation="MDYLRRYENNVWNGSHDPNSEHLHLVEVNEFLPQIHKWTSIGVGV
FT                   MLTIFVVGVGLTTVLNYKVTVKVPASIRPMGELRLVESAISGQVQKIVVKDNQIVTQGD
FT                   AITYVDDSRLQTQKSQLQSNIQQGQLQIVHIDAQLGEINTQISAQANLNNRTILAAQAE
FT                   LGGTQRNFDDQQIKANAEMSQAEVALRFTKSQLERLQQDRVLTTTIDEAQTALNLAKLQ
FT                   RDRLQVIANSGAISHSMLEEKQQAVKSAQAKLEQAKNNAETLLEEKQQALEIARTNLYK
FT                   ARTAINPSNSAVIIASERIKQEEARSEATLAALKKELQTLLQQRLEIQKQLIRGRQDLL
FT                   QTQTDLNQSVIRAPITGTLLQLRLRNPGQVVQPSEAIAQIAPLNAPLQIKAYVPAQEIN
FT                   KVEAGQKVQMQVSACPYPDYGTLKGIVKNVAPDIFPVAQTQSQNNTAANIQQVNGYEVT
FT                   IEPETLYVGRGDRQCHLQPGMQGRTDIISREETVVQFILRKARLITDL"
FT   gene            complement(68454..68777)
FT                   /locus_tag="Aazo_0077"
FT   CDS_pept        complement(68454..68777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0077"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GE14506 gene product from transcript
FT                   GE14506-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62730"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVC2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62730.1"
FT                   /translation="MSNSITIQKLLVELSDQQQELLSGGQAGSADPLLTPITALRGRPV
FT                   NPIGKAINDGSETKLGNNTLQGVTNSRLLGSIGNSTGQGEGTSTGAEDIMILPAFLGFS
FT                   QTL"
FT   gene            complement(68892..69191)
FT                   /locus_tag="Aazo_0078"
FT   CDS_pept        complement(68892..69191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GH11200 gene product from transcript
FT                   GH11200-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62731"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62731.1"
FT                   /translation="MSCQIIILKLFVELSEGEQELMSGGAEPQINNNNFAQRTGNTNST
FT                   NKTGILGNVSQINSQLADVNSGGQTILSSDALGVSPMGGVNNFAPSQPFSSKIV"
FT   gene            complement(69234..69605)
FT                   /locus_tag="Aazo_0079"
FT   CDS_pept        complement(69234..69605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_2386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62732"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62732.1"
FT                   /translation="MSVHIIISNLLADLCEQQQEILTGGTDFESSGSNFANRLVMLRGS
FT                   VFSGPNGSFANSSGQSLQVNTAAQDLLGLGAPSIPNFPALGSAPVLTGLPAEFTTGLGG
FT                   LGRLLGLGDFGQSFSGFGR"
FT   gene            complement(70087..70470)
FT                   /locus_tag="Aazo_0080"
FT   CDS_pept        complement(70087..70470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0080"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr5141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62733"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVC5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62733.1"
FT                   /translation="MSDQINASDLFVALSDDQQKFLTGGADFELAGSNYANRLANLQGT
FT                   TASGPAGSTGNSIGTTSAVNTAAQDLLGLGAPTVPAVGALGAAPSLDGLAAGNPALGAD
FT                   AFINPVLTSPLGGLGLGAPGTLL"
FT   gene            complement(70872..71261)
FT                   /locus_tag="Aazo_0081"
FT   CDS_pept        complement(70872..71261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr5141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62734"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62734.1"
FT                   /translation="MPNQINASDLFVVLSDHQQEFLTGGADFELAGSNYANRLANLQGT
FT                   TASGPAGSTGNSIGTTSAVNTAAQDLLGLGAPTVPTVGALGAAPILNGLAAAPLAAAPA
FT                   AGLGGLGGLGAPGFGGLGGFEPGII"
FT   gene            complement(71547..72257)
FT                   /locus_tag="Aazo_0082"
FT   CDS_pept        complement(71547..72257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0082"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   ava:Ava_4221 phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62735"
FT                   /db_xref="GOA:D7DVC7"
FT                   /db_xref="InterPro:IPR039606"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVC7"
FT                   /inference="protein motif:PFAM:PF01148"
FT                   /protein_id="ADI62735.1"
FT                   /translation="MLITLFPGLESISLLWLQITLAAAWVVLIILIAWGVSRFTNSEPE
FT                   IIRKIVHIGTGNVILIAWWLNIPATVGITASIFASIITLLSYIFPILPGINSVGRQSLG
FT                   TFFYALSIGILVAGFWYLQQPQYAAIGILTMAWGDGLAALIGQRFGKHKYKLLGSNKSW
FT                   EGSFTMTFLSFLINMFILLGTQGNIWQTWVISILVAIVATTLEAFSFLGIDNLTVPVGS
FT                   AALAYSLIQILVLN"
FT   gene            72301..72546
FT                   /locus_tag="Aazo_0083"
FT   CDS_pept        72301..72546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0083"
FT                   /product="protein of unknown function DUF37"
FT                   /note="PFAM: protein of unknown function DUF37; KEGG:
FT                   ana:asr1611 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62736"
FT                   /db_xref="GOA:D7DVC8"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVC8"
FT                   /inference="protein motif:PFAM:PF01809"
FT                   /protein_id="ADI62736.1"
FT                   /translation="MKILLIWIIKGYRLFVSPLFPPTCRFQPTCSMYAIQAIERFGLLR
FT                   GGWMATLRILRCHPFHPGGYDPVPGLAEKSCCDHHD"
FT   gene            complement(72866..73507)
FT                   /pseudo
FT                   /locus_tag="Aazo_0084"
FT                   /product="hypothetical protein"
FT   gene            complement(73685..74551)
FT                   /pseudo
FT                   /locus_tag="Aazo_0085"
FT                   /product="hypothetical protein"
FT   gene            74938..75465
FT                   /locus_tag="Aazo_0086"
FT   CDS_pept        74938..75465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R6559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62737"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVC9"
FT                   /inference="similar to AA sequence:KEGG:Npun_R6559"
FT                   /protein_id="ADI62737.1"
FT                   /translation="MQPIQSRWIRFLSGLMVLTVLSVAKANDPGLCFMTTSSGSINLGE
FT                   ICKVIQTTDTFFRVPMKGRQAKNPIIYVKFNGGQVFEMVFDTGASGILITQEIAKKSNI
FT                   KPAGKSRFTIADGSVVEFQTITILSVSGGSVVVNNAQISIAPKAEIGLLGHGFFQNYDV
FT                   RILKKQIEFHKR"
FT   gene            76042..76737
FT                   /locus_tag="Aazo_0087"
FT   CDS_pept        76042..76737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0087"
FT                   /product="peptidase M15D vanX D-ala-D-ala dipeptidase"
FT                   /note="PFAM: peptidase M15D vanX D-ala-D-ala dipeptidase;
FT                   KEGG: npu:Npun_R0488 peptidase M15D, VanX D-ala-D-ala
FT                   dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62738"
FT                   /db_xref="GOA:D7DVD0"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVD0"
FT                   /inference="protein motif:PFAM:PF01427"
FT                   /protein_id="ADI62738.1"
FT                   /translation="MQPYHQISIIECGEPLVKIPLELFAVESPHPYEKLGATYGEYSPY
FT                   YLRESVVKNLIEAQNYLQLLHPGWYIQIFDGYRPVGVQQFMVDYSFGEALRARGVSAEE
FT                   LSPQQREEVWQQVYEIWAVPSLDMNTPPPHSTGAVVDITLVDDNGEVVDMGSAIDEMSV
FT                   RSHPDYYAQSNPNYHANRQLLRDIMLKAGFKRNPREWWHFSSGDQMWAWLYNQSNPDYP
FT                   VTARYGRLI"
FT   gene            complement(76762..77571)
FT                   /pseudo
FT                   /locus_tag="Aazo_0088"
FT                   /product="hypothetical protein"
FT   gene            77663..78481
FT                   /locus_tag="Aazo_0089"
FT   CDS_pept        77663..78481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all3713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62739"
FT                   /db_xref="GOA:D7DVE3"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVE3"
FT                   /inference="similar to AA sequence:KEGG:all3713"
FT                   /protein_id="ADI62739.1"
FT                   /translation="MLNILFLAQSSTSRTQKTIKTVPASESPITYLLMFSSGGLLLALI
FT                   AGILYGKILVRNYDKKVKFEKFRTRELEKKLKLALETIRKMETNPDLVHSRDFNLDYLR
FT                   MRMSEEVFHFGVVNQIKLKIKDKISLALRPGQSQQGQVGIASNAGRQLDEIFDVEYETG
FT                   VSPNIVKRVLFRVQIRLMKLPTQATSATISQIIDCIETYLSPREDDDSWQPTIQGRIVY
FT                   MHWDQKAKPTPLLVLEQSNEGVNVTFRTTRQPNATIPPNPPIQKNKAQGS"
FT   gene            complement(78478..79206)
FT                   /locus_tag="Aazo_0090"
FT   CDS_pept        complement(78478..79206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0090"
FT                   /product="ABC exporter ATP-binding subunit, DevA family"
FT                   /note="TIGRFAM: ABC exporter ATP-binding subunit, DevA
FT                   family; PFAM: ABC transporter related; KEGG: npu:Npun_R5574
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62740"
FT                   /db_xref="GOA:D7DVE4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014324"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVE4"
FT                   /inference="protein motif:TFAM:TIGR02982"
FT                   /protein_id="ADI62740.1"
FT                   /translation="MINTQPVIAIQNINHYYGRGALRKQILFDINLEIYAGEIVIMTGP
FT                   SGSGKTTLLSLIGGLRSVQEGSLKFLGTELSGSSQSKLVQSRRNIGYIFQAHNLLGFLT
FT                   ARQNVQMAVELNNTISQSEAIKKSEAMLGSVGLAERINYYPDNLSGGQKQRIAIARALV
FT                   NHPPLVLADEPTAALDKQSGRDVVEIMQRLAKEQGTAILLVTHDNRILDIADRIVEMED
FT                   GLLTRDAQNVVSSPKVAEGV"
FT   gene            complement(79339..80493)
FT                   /locus_tag="Aazo_0091"
FT   CDS_pept        complement(79339..80493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0091"
FT                   /product="DevC protein"
FT                   /note="KEGG: npu:Npun_R5575 DevC protein; TIGRFAM: DevC
FT                   protein; PFAM: protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62741"
FT                   /db_xref="GOA:D7DVJ4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR005891"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVJ4"
FT                   /inference="protein motif:TFAM:TIGR01185"
FT                   /protein_id="ADI62741.1"
FT                   /translation="MTQKIPLSWLQLTREKTRLAVALSGIAFADILMFMQLGFRDALYY
FT                   SNVRMHGSLKGDIVLINTQSNAVLAMKPFSQRRLYKALDLPAVESVYPIYLDYTSWKNP
FT                   ITGRPRSILTFGINPELNVFDLPGVEENLDKLKLPDVVLFDRSSRLEYGPIAADFDQGK
FT                   NVTAEVRRRKIKVTGLFTLGASFGADGNLITSDVNFLRLFTTRQRGLIDIGLIKLKPGA
FT                   DPNQVAAYLRTYLPTDVNILTKREFIDYERNYWASSTAIGFIFTLGTIMGFIVGTVIVY
FT                   QILYTEVTEHLSEYATLKAIGYTQNYLLTVILQEAFMLAVLGYLPGFACALFMYHVARD
FT                   ATLLPVFMSHERAIMVLILTIFMCFISGIIAMRKLRSADPADIF"
FT   gene            complement(80531..81970)
FT                   /locus_tag="Aazo_0092"
FT   CDS_pept        complement(80531..81970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0092"
FT                   /product="ABC exporter membrane fusion protein, DevB
FT                   family"
FT                   /note="TIGRFAM: ABC exporter membrane fusion protein, DevB
FT                   family; KEGG: npu:Npun_R5576 secretion protein HlyD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62742"
FT                   /db_xref="GOA:D7DVJ5"
FT                   /db_xref="InterPro:IPR014315"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVJ5"
FT                   /inference="protein motif:TFAM:TIGR02971"
FT                   /protein_id="ADI62742.1"
FT                   /translation="MSRVSEKPKLTGQTLEKSKVWLKIAVAVPVVIAAGYLATAKIEQL
FT                   KKLTSSVSMTPTPRSISAIGRLEPRGEVIKIAAPNSGLSAGSRVQQLLVREGQRVQQGQ
FT                   VIAILDSRDSNMAAVEEAKAKLQESRANLGQIRAASPRDIQAQAAIIARLQAQLNGEKE
FT                   AQQASISRIAAELSGEKVAQQAGIKRLEAELRGQKDGLRATISKVQAEQRDAEVDAGRY
FT                   EFLYGEGAISQQERDKRRLRAATANQQLRETQASLREALGTLQQQIAQARATQVQTLAT
FT                   LEQQLIEATATREKTVATLQKQIDEERARLSRLLDVRPTDVQMAQAQVTNAMAVIRKAQ
FT                   AELQLSYVKAPTPGEILKVHTKSGEVMSTNGIAEIGQTDQMFVVAEIPEDSIGKIRVGQ
FT                   RATITSDNGAFNDQLKGTITEIGRKIGKKDVLNNDPAADIDARVVEVKIALPSNYSQRV
FT                   SGLTNAKVMVEINTDELPHKQ"
FT   gene            complement(82892..83629)
FT                   /locus_tag="Aazo_0093"
FT   CDS_pept        complement(82892..83629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0093"
FT                   /product="ferredoxin-dependent bilin reductase"
FT                   /note="PFAM: ferredoxin-dependent bilin reductase; KEGG:
FT                   ava:Ava_3585 phycocyanobilin:ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62743"
FT                   /db_xref="GOA:D7DVJ6"
FT                   /db_xref="InterPro:IPR009249"
FT                   /db_xref="InterPro:IPR022870"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVJ6"
FT                   /inference="protein motif:PFAM:PF05996"
FT                   /protein_id="ADI62743.1"
FT                   /translation="MSSTFTPSLREEQHPLIRQLADCIESVWHQHLDLSTYHLPAELGY
FT                   VEGRLEGEKLIIENRCYQTPQFRKIHLELARVGNILDILHCVMFPCPEYDIPMFGCDLV
FT                   GGRGQISAAIADLSPVNLERILPDGYNSDLSNLTKFEFSQPRELPEWGKIFSDFCIFVR
FT                   PVSVEEESMFLQRVKDFLDIHCTQALASSPVASEKVDQIIAGQKNYCTKQQQNDKTRRV
FT                   LERAFGTDWAENYMTTVLFDLPQ"
FT   gene            83814..84050
FT                   /locus_tag="Aazo_0094"
FT   CDS_pept        83814..84050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F6415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62744"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVJ7"
FT                   /inference="similar to AA sequence:KEGG:Npun_F6415"
FT                   /protein_id="ADI62744.1"
FT                   /translation="MSYDRTLKYLIEEYPQAIVQWLLNIMQESVVYQKIIREGLEQGRG
FT                   SEVKLIMRLLQRRLGKIGIEIQNQIQDLSLTQL"
FT   gene            complement(84160..84753)
FT                   /locus_tag="Aazo_0095"
FT   CDS_pept        complement(84160..84753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0095"
FT                   /product="maf protein"
FT                   /note="KEGG: ava:Ava_0836 Maf-like protein; TIGRFAM: maf
FT                   protein; PFAM: Maf family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62745"
FT                   /db_xref="GOA:D7DVJ8"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVJ8"
FT                   /inference="protein motif:TFAM:TIGR00172"
FT                   /protein_id="ADI62745.1"
FT                   /translation="MTIPQFILASASPARRRLLQTVGIEPIICPSDFDESQIQLTEPGE
FT                   LVKTLAQRKAETVVSQFPSALVMGCDSVLAIDGEIYGKPGDADEALARWKLMQGNFGDL
FT                   YTGHVLIDTSQSYAIVKCQVTRVYFGTMSERAIQAYVATDEPLKCAGAFALEGFGSLFV
FT                   EKIEGCHSNVIGLSLPLLRQMLAELGYEVVDFWQ"
FT   gene            complement(84947..85492)
FT                   /locus_tag="Aazo_0096"
FT   CDS_pept        complement(84947..85492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0096"
FT                   /product="photosystem II oxygen evolving complex protein
FT                   PsbP"
FT                   /note="PFAM: photosystem II oxygen evolving complex protein
FT                   PsbP; KEGG: npu:Npun_F5517 photosystem II oxygen evolving
FT                   complex protein PsbP"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62746"
FT                   /db_xref="GOA:D7DVJ9"
FT                   /db_xref="InterPro:IPR002683"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVJ9"
FT                   /inference="protein motif:PFAM:PF01789"
FT                   /protein_id="ADI62746.1"
FT                   /translation="MWKRIALILVLVFSISLSNPSVANAYGLKSFIDSADGYQFLYPNG
FT                   WLQVKVANGPDVVFHDLIEVSENVSVVISPVPDGRTLTELGTPTEVGYNLGKSALAPVD
FT                   SGRSAELINVGQKEVDGKTYYVLEYEITLANQQKRHNVSSVAVSRGKLFTFNASIPEKR
FT                   WNKLQRTIYELVNSFTVY"
FT   gene            complement(85625..85969)
FT                   /locus_tag="Aazo_0097"
FT   CDS_pept        complement(85625..85969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0097"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: cyt:cce_2836 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62747"
FT                   /db_xref="GOA:D7DVK0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVK0"
FT                   /inference="similar to AA sequence:KEGG:cce_2836"
FT                   /protein_id="ADI62747.1"
FT                   /translation="MATKLSDVMVQLPPACRAKIEPHAQELIVENMRPQDIRKAGKLTQ
FT                   ESMAELLGTPQDSVSRLEKRAHLLLSTLRSYLKAMGGELKLVAEFPDRPAVIISSLGEL
FT                   EEQPSELEVK"
FT   gene            complement(86171..87927)
FT                   /pseudo
FT                   /locus_tag="Aazo_0098"
FT                   /product="hypothetical protein"
FT   gene            88217..89647
FT                   /locus_tag="Aazo_0099"
FT   CDS_pept        88217..89647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0099"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="KEGG: ana:alr4745 dihydrolipoamide dehydrogenase;
FT                   TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62748"
FT                   /db_xref="GOA:D7DVK1"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVK1"
FT                   /inference="protein motif:TFAM:TIGR01350"
FT                   /protein_id="ADI62748.1"
FT                   /translation="MSSGFDYDLVIIGAGVGGHGAALHAVNYGLKTAIIEAAHMGGTCV
FT                   NRGCIPSKALLAASGRVRELRNAHHLKSLGIQIGNVEFDRQAIANHANNLVSKIQGDLT
FT                   NSLKRLGVDIIRGWGKLAETQKVSVTTDKGERSITAQNIILSPGSVPFVPPGIEIDGKT
FT                   VFTSDQGVKLESLPKWIAIIGSGYIGLEFSDIYTALGCEITMIEALDLLMPGFDRDIAK
FT                   LAERVLITPRDIETKVGIYAKRIIPGSPVVIELADFQTKDYLEVLEVDACLVATGRIPA
FT                   TQNLGLDSVGVELDGRKFIPVNDCMAVLSAGEVVPHLWAIGDANGKMMLAHAASAQGII
FT                   AVENILGKDKKADYRSIPAAAFTHPEVSYVGLTETAAQEMGLAEGFEIGISKSYFKGNS
FT                   KALAENEADGIAKVIYRKDTGEVLGVHIFGLHASDLIHEASAAVAQRQSVKDLAYLVHA
FT                   HPTLSEVLDEAYKRAIAS"
FT   gene            89809..90693
FT                   /locus_tag="Aazo_0100"
FT   CDS_pept        89809..90693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0100"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="KEGG: npu:Npun_R4178 indole-3-glycerol phosphate
FT                   synthase; PFAM: Indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62749"
FT                   /db_xref="GOA:D7DVK2"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVK2"
FT                   /inference="protein motif:PRIAM:4.1.1.48"
FT                   /protein_id="ADI62749.1"
FT                   /translation="MKIRRRSPSPTIDVSVIRYQAVLQDAAPNNILEEIVWQKEIEIEQ
FT                   MREKLPLRELQKKVLSAPPTRDFVAALRQGKTKPALIAEVKKASPSKGILRADFDPVAI
FT                   AQSYQEGGASCLSVLTDRKFFQGSFENLCLVHAAVDLPVLCKEFIIYPYQIYLARINGA
FT                   DAILLIAGILSAQDLQYFVKIANNLKMAALIEVHSLEQLDRVLSLDGVTLVGINNRNLE
FT                   DFSVDLQTTCQLLKDKGSQLQARNILVVSESGIHTPEDLSVVETAGASAVLIGESLVKQ
FT                   PDPKLAITNLFGK"
FT   gene            90703..90858
FT                   /locus_tag="Aazo_0101"
FT   CDS_pept        90703..90858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0101"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: npu:Npun_F5035 multi-sensor hybrid histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62750"
FT                   /db_xref="GOA:D7DVK3"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVK3"
FT                   /inference="similar to AA sequence:KEGG:Npun_F5035"
FT                   /protein_id="ADI62750.1"
FT                   /translation="MGTGEDGEDGEVIFLMPNAQCPMPNAQCPMPNYQSPIPKLCFLCI
FT                   NLIDKI"
FT   gene            90906..91142
FT                   /locus_tag="Aazo_0102"
FT   CDS_pept        90906..91142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R4177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62751"
FT                   /db_xref="InterPro:IPR035228"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVK4"
FT                   /inference="similar to AA sequence:KEGG:Npun_R4177"
FT                   /protein_id="ADI62751.1"
FT                   /translation="MEQIPLPAPIHYELILQLLEKQTMSAINNNQELRQQVSQLIITLR
FT                   KAAAQQKRLEESCQASSVEVDHRWSLNHLGGKS"
FT   gene            91467..92615
FT                   /locus_tag="Aazo_0103"
FT   CDS_pept        91467..92615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0103"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG: npu:Npun_F4157
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62752"
FT                   /db_xref="GOA:D7DVK5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVK5"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ADI62752.1"
FT                   /translation="MDNKLMLMIPGPTPVPEAALLALAKHPIGHRTAEFSNMMAEVTEN
FT                   LKWLHQTESDVLMLNVSGTGAVEAGIINFLSPDDHILVGSNGKFGERWVEVGQAFGLNV
FT                   ETVTAEWGQPLDPAKFAEKLQADTNKEIKAVIITHSETSTGVINDLVAINSHVKAHGEA
FT                   LIIVDAVTSLGAYNVAVDALGLDIVASGSQKGYMIPPGLGFVSVSPKGWEAYKTAKLPK
FT                   YYLDLGKYRKSTAKNTTPFTPPVNLIVALHTTLGMMKKEGLESIFARHERQKNATRAAM
FT                   KALNLLLFAADECASPAITAVSVPGMEADKIRSLMKKRFDIALAGGQDHLSNKIFRIGH
FT                   LGFVSDRDILSCIASLEVVLSELGYENFTPGTAIGAAAKVFG"
FT   gene            complement(92636..92950)
FT                   /locus_tag="Aazo_0104"
FT   CDS_pept        complement(92636..92950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62753"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62753.1"
FT                   /translation="MSNQLCPVQSLIERTINSDSFYSLISKLKERVEQTTRSFGFSGQL
FT                   SIVSCKSLYCHPSGDASGTLRKHQLHPGGRRSAYMGETTPLHLLYVGKPVHRSCSPRSR
FT                   "
FT   gene            complement(93057..93284)
FT                   /locus_tag="Aazo_0105"
FT   CDS_pept        complement(93057..93284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R4158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62754"
FT                   /db_xref="InterPro:IPR021336"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVK7"
FT                   /inference="similar to AA sequence:KEGG:Npun_R4158"
FT                   /protein_id="ADI62754.1"
FT                   /translation="MIIHSTQGREIQMAPSRYSRLINFLQEDLAISAASLAVALRHREQ
FT                   DPGSLTMILWQYGLITLEQLEKIYDWLETA"
FT   gene            complement(94006..94530)
FT                   /locus_tag="Aazo_0106"
FT   CDS_pept        complement(94006..94530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0106"
FT                   /product="protein of unknown function DUF192"
FT                   /note="PFAM: protein of unknown function DUF192; KEGG:
FT                   npu:Npun_R4159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62755"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVK8"
FT                   /inference="protein motif:PFAM:PF02643"
FT                   /protein_id="ADI62755.1"
FT                   /translation="MLRQLTLLCVLLSILLMGCSAPTTAQSATPTSVSQAQAPISKGQT
FT                   LPISAQATVPNGTKIKLEVAQTPEQQMMGLMYRSALPDDRGMVFVFPSAQPVQFWMKNV
FT                   PVPLDMVFLDNGVVKYMQTAAPPCNSDPCPTYGPNVLIDQVIELRAGRATELGLHAGDQ
FT                   VKMKFFKSSGS"
FT   gene            complement(95075..95530)
FT                   /locus_tag="Aazo_0107"
FT   CDS_pept        complement(95075..95530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0107"
FT                   /product="ferredoxin"
FT                   /note="KEGG: ava:Ava_2647 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62756"
FT                   /db_xref="GOA:D7DVK9"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVK9"
FT                   /inference="similar to AA sequence:KEGG:Ava_2647"
FT                   /protein_id="ADI62756.1"
FT                   /translation="MTQLQPLPEYLENNRSRLEPELGGFLRDEPERSGLEPELGGMVRQ
FT                   KGVYVDEITCIGCKSCAHVARNTFYIEPDYGRSRVIRQDGDAEEVVQEAIDTCPVDCIH
FT                   WVDYTELRNLEDDRKYQVIPVVGYPVDHAVATIEKRRKKQKLNKKQP"
FT   gene            complement(95530..95916)
FT                   /locus_tag="Aazo_0108"
FT   CDS_pept        complement(95530..95916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0108"
FT                   /product="protein of unknown function DUF1257"
FT                   /note="PFAM: protein of unknown function DUF1257; KEGG:
FT                   npu:Npun_R0112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62757"
FT                   /db_xref="InterPro:IPR009666"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVL0"
FT                   /inference="protein motif:PFAM:PF06868"
FT                   /protein_id="ADI62757.1"
FT                   /translation="MSHFSQIKTQIRNLESLKDALSDLGIDWKPGPREVSGYSGQTHAA
FT                   EVSIEQENGYDIGFRWNGKEYELVADLQYWQQDLSVDGFLRQVTQRYAYQTVMKETTKV
FT                   GFQVAEQQKNEDGSIRLVLQRWSA"
FT   gene            complement(95957..96169)
FT                   /locus_tag="Aazo_0109"
FT   CDS_pept        complement(95957..96169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asr0043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62758"
FT                   /db_xref="InterPro:IPR021375"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVL1"
FT                   /inference="similar to AA sequence:KEGG:asr0043"
FT                   /protein_id="ADI62758.1"
FT                   /translation="METLEFIIYPDGRVQEKVTGIVGASCAEVTAAIEAQLGQVLIQEP
FT                   TSEFFTTNNIQESGIANRQTSFSEW"
FT   gene            complement(96743..97403)
FT                   /pseudo
FT                   /locus_tag="Aazo_0110"
FT                   /product="hypothetical protein"
FT   gene            97854..99298
FT                   /pseudo
FT                   /locus_tag="Aazo_0111"
FT                   /product="hypothetical protein"
FT   gene            complement(99598..99789)
FT                   /locus_tag="Aazo_0112"
FT   CDS_pept        complement(99598..99789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0112"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62759"
FT                   /db_xref="GOA:D7DVL2"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVL2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62759.1"
FT                   /translation="MRKSGNKSRFKLQIINKSALILLAVLLGIVAVSSIWIWWMMLWIP
FT                   EKSYQGKLPPLKTAEITL"
FT   gene            complement(99858..100796)
FT                   /locus_tag="Aazo_0113"
FT   CDS_pept        complement(99858..100796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0113"
FT                   /product="phosphoribulokinase/uridine kinase"
FT                   /note="PFAM: phosphoribulokinase/uridine kinase; KEGG:
FT                   ava:Ava_0169 phosphoribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62760"
FT                   /db_xref="GOA:D7DVL3"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVL3"
FT                   /inference="protein motif:PFAM:PF00485"
FT                   /protein_id="ADI62760.1"
FT                   /translation="MSCPIILGIVGDSAAGKTTLTRGIAQILGPENVTLICTDDYHRYD
FT                   RTERAKLGITALHPDCNHLDIMQQHLSLLRTGQPILKPVYSHQTGSFEAPKYIKPSKFV
FT                   IIEGLLGYSTRAARDAYDVKVYLAPPEKLRATWKVKRDTQKRGYTPEQVLEELEKREPD
FT                   SQQFIRPQRQWSDIVVSFYPPNENEDESNGHLNVRLVLRPTIPHPDFTEIIEAGNGDLE
FT                   SAVRLGLVRDMGKPVDVLEVDGHATLEQVNKIEHIMCSDMPYLKSICDREINPELGKIA
FT                   GTTGETLQSYPLALTQLIITYHMLKATQIYQ"
FT   gene            101032..101694
FT                   /locus_tag="Aazo_0114"
FT   CDS_pept        101032..101694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0114"
FT                   /product="Caffeoyl-CoA O-methyltransferase"
FT                   /EC_number="2.1.1.104"
FT                   /note="KEGG: npu:Npun_R3589 O-methyltransferase family
FT                   protein; PFAM: O-methyltransferase family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62761"
FT                   /db_xref="GOA:D7DVL4"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVL4"
FT                   /inference="protein motif:PRIAM:2.1.1.104"
FT                   /protein_id="ADI62761.1"
FT                   /translation="MGKQTIGLEQHLYDYLLAVSLREPDILTQLRHETAQLPMDQMQIS
FT                   PEQGQFMALLVKLLGAKKTLEVGVFTGYSSLVTALALPADGKIIACDVSEEFTSIARRY
FT                   WEKAGIADKIDLRIAPALETLDNLLATGETESFDFAFIDADKGNYENYYERSLQLIRPG
FT                   GLIAVDNVLWSGKVADSEVQDNQTKKIRAFNQKLHQDSRVTLSVVPIADGLTLARKN"
FT   gene            complement(101713..102633)
FT                   /locus_tag="Aazo_0115"
FT   CDS_pept        complement(101713..102633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0115"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: npu:Npun_F6152 rhodanese domain-containing
FT                   protein; PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62762"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVL5"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADI62762.1"
FT                   /translation="MTPENILVVAALYKFVSLPDYIELQPPLLSFCQEQGIKGTILLAK
FT                   EGINGTIAGSRQAIDAVLAFLRGDTRLADLEHKESYTDTPPFERMKVRLKREIVTLGIL
FT                   EVDPNEKVGTYVNPQEWNDLISDPQVIVIDTRNDYEVSIGTFKRAENPQTQIFRKFPEY
FT                   VSKNLDPKKDKKVALFCTGGIRCEKASSYMMTQGFEEVYHLKGGILKYLEEVPSEESLW
FT                   EGECFVFDERVTVRHGFEEGSYELCFCCGHPIAEDDKTLPKYEEGISCPHCFDSLTKEK
FT                   RVRQQEKWKQYRLNKLTVNSKETDH"
FT   gene            102746..102818
FT                   /locus_tag="Aazo_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            102746..102818
FT                   /locus_tag="Aazo_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(102819..103446)
FT                   /pseudo
FT                   /locus_tag="Aazo_0116"
FT                   /product="hypothetical protein"
FT   gene            103663..105075
FT                   /locus_tag="Aazo_0117"
FT   CDS_pept        103663..105075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0117"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="KEGG: npu:Npun_R6150 phospholipid/glycerol
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62763"
FT                   /db_xref="GOA:D7DVL6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVL6"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADI62763.1"
FT                   /translation="MPKLIHSTQPPLKFISPRFNPLVLKTVSWFLPLILWVRTRPWLPA
FT                   GIVKIEAKNAEILAKLYQEFQAGKIRFLIAFRHPEVEDPLSMLYLLSRIVPKVARDKGI
FT                   PLEYPVHSHFMYERGMTLWAGNWLGWLFSYVGGVPVRRGRRVDRNAIQMARDLFANAKM
FT                   PIAIAPEGGINGHSGIVSPLEPGVAQLGFWCVEDLQKANREETVVIIPIGIKYSYVNPP
FT                   WSKIDWLLSKLEADSGLPVAEINPTGKKLEEVLCQRILNLAEYLITEMEEFYRCFYHRD
FT                   LPAILAKETAKPNDILITRLHRLMDTALQVCEQYFNVQPQGNFIYRCRRLEEAGWNYIY
FT                   RDKIADINSLPPFKRALADWVAEEADLRMQHMRIAEGFVAVTANYIQDKPTAERFAETA
FT                   LLMFDMLSRIKESTLPGRPRLGLKQAMITVGKPISVSERWQMCQGNKQASRRELSDLTN
FT                   DLQVELEALVKD"
FT   gene            complement(105164..105547)
FT                   /locus_tag="Aazo_0118"
FT   CDS_pept        complement(105164..105547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0118"
FT                   /product="PilT protein-like protein"
FT                   /note="KEGG: ava:Ava_4043 PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62764"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVL7"
FT                   /inference="similar to AA sequence:KEGG:Ava_4043"
FT                   /protein_id="ADI62764.1"
FT                   /translation="MKLLLDTHIFLCFISGEQGLPIHLQNSIRDLNNDVYLSYISVWQV
FT                   TVKYQSGKLSLPAYSEIYLPKQRQQHLIRSLNLEEESVGQLLNLPLLHRCPFDLILICQ
FT                   ALQHNLSIVNLYPAIRAYSINVL"
FT   gene            complement(105580..105783)
FT                   /locus_tag="Aazo_0119"
FT   CDS_pept        complement(105580..105783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0119"
FT                   /product="prevent-host-death protein"
FT                   /note="KEGG: npu:Npun_R1049 prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62765"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVF1"
FT                   /inference="similar to AA sequence:KEGG:Npun_R1049"
FT                   /protein_id="ADI62765.1"
FT                   /translation="MLTLTIDEIQKNLTSYLHQVGARENIILIQEGQPIAEIKPVSSTA
FT                   QQLRPYGLCPGEFTVADDFDTP"
FT   gene            107025..107249
FT                   /locus_tag="Aazo_0120"
FT   CDS_pept        107025..107249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0120"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100198305"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62766"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62766.1"
FT                   /translation="MVAEVAQLIDKTRTKANSQQLIFICLNNTLVLLPAPMRKIEYVIH
FT                   LHNSNKRYKLKNCSFPNTPPDKSPLVLNF"
FT   gene            107458..108942
FT                   /locus_tag="Aazo_0121"
FT   CDS_pept        107458..108942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0121"
FT                   /product="precorrin-3B synthase"
FT                   /note="KEGG: npu:Npun_F6481 precorrin-3B synthase; TIGRFAM:
FT                   precorrin-3B synthase; PFAM: nitrite and sulphite reductase
FT                   4Fe-4S region; nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62767"
FT                   /db_xref="GOA:D7DVF9"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR012798"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVF9"
FT                   /inference="protein motif:TFAM:TIGR02435"
FT                   /protein_id="ADI62767.1"
FT                   /translation="MLSAFYACPGLFYTTPAQDGMLSRIRIPGGILTSEQCGMIANIAD
FT                   NYGGGYIDVTNRANLQIREIKAAINIEVLQSLQELALGSVNTAVDHIRNIMTSPTAGID
FT                   TQELTDTRPLVKAWDNYITAHSHFSGLSAKFSVCFDGGGKVAVKNCLNDITLAAELLDG
FT                   DGKTHHVYFRLHLSCGEKGKPPQDTGILLKPKECIPVLAALADVYLQHTDAKLRRKPRL
FT                   REVINELGVEQYLQEVEQHFKVNNSVCDDKLFFSHSLFTAQEPKRENFLYHLGIYPQRQ
FT                   TGLFYIGVVLPLGRLESLQMRGLANLATKYGSCNLRLTPWQNVLITDIPQHKIAEVTQE
FT                   ITSLGLNISSTHINSALVACSGKRGCAASATETKDHALALAAYLENHLTLDSPINIHFS
FT                   GCVKSCAQHDQADITLIGVSSEAEDKSLEGYQVYVSDGTLRKFGYQLYEYVTFTELPKL
FT                   ISRMLQIYQYQRLSLDESFREFVYRYGTSQLLQIFS"
FT   gene            108978..109607
FT                   /locus_tag="Aazo_0122"
FT   CDS_pept        108978..109607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0122"
FT                   /product="Precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="KEGG: ana:all0456 precorrin-8X methylmutase; PFAM:
FT                   Precorrin-8X methylmutase CbiC/CobH"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62768"
FT                   /db_xref="GOA:D7DVG0"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVG0"
FT                   /inference="protein motif:PRIAM:5.4.1.2"
FT                   /protein_id="ADI62768.1"
FT                   /translation="MSNYIRDPNQIYRNSFAIIRAETNLDALSDDVAKVAVRLIHACGM
FT                   TDILSDLEYSQTAVQSGREALAAGAPILCDCHMVAEGVTRKRLPANNRVICTINDPEVP
FT                   TISKRLSNTRSAAALELWRFHLDGAIIAIGNAPTALFRLLEILDEGVPRPSLILGFPVG
FT                   FVGAAESKAALAANSRNVPFLTLHGRRGGSAIAAAAINALATEEEI"
FT   gene            109604..110308
FT                   /locus_tag="Aazo_0123"
FT   CDS_pept        109604..110308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0123"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /note="KEGG: npu:Npun_F6483 precorrin-2
FT                   C20-methyltransferase; TIGRFAM: precorrin-2
FT                   C20-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62769"
FT                   /db_xref="GOA:D7DVG1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVG1"
FT                   /inference="protein motif:TFAM:TIGR01467"
FT                   /protein_id="ADI62769.1"
FT                   /translation="MNSKGRLYGIGVGPGDPELLTLKALRLLRTAPVIAYQSAIDKDSI
FT                   ARKIASQYLPENQVEVLFHLPRALEPEKAKSIYDQEVQPIAEHLAAGRDVVVLCEGDPF
FT                   FYGSFMYIFTRLSDEYQTEVVPGVSSLMACPVSLGVPFTYYNDILTVLPATLPTEMLTS
FT                   HLLATDAAAIMKLGRNFAKVRDILHQLGLASRAKYIERATMTQQRIVPLDEVNPDDVPY
FT                   FSMIVIPTKQKL"
FT   gene            110458..111903
FT                   /locus_tag="Aazo_0124"
FT   CDS_pept        110458..111903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0124"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /EC_number="2.1.1.131"
FT                   /note="TIGRFAM: precorrin-3B C17-methyltransferase; KEGG:
FT                   mar:MAE_42070 precorrin methylase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase;
FT                   cobalamin (vitamin B12) biosynthesis CbiG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62770"
FT                   /db_xref="GOA:D7DVG2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVG2"
FT                   /inference="protein motif:TFAM:TIGR01466"
FT                   /protein_id="ADI62770.1"
FT                   /translation="MKTRVAPAILILSQNSLIVGRKITSIFPGAKLYGLASRTSDVDVS
FT                   FQNFGDTVRELFPAGTPLIGICAAGILIRTLAPLITDKGQEPPVLAVAEDGSAVVPLLG
FT                   GLSGVNDLARQIAEALNVKAAITTTGDLRFHTALLSPPAGYHLANPEDGKKFIADLLAG
FT                   AKVKLEGKAPWLIESKLPIDPNGELTIQITENLGTPQPNCLVYYPQKIPADISPQNILS
FT                   SETIDQPRGKLAIIGTGPGALKWMSPEVKEILHAASDLVGYKTYINLIGALADGKNRHE
FT                   SDNREEEARAKFALDLAAQGKYVVVVSSGDPGIYAMATAVFEVLDRYNKPEWQNIDIQV
FT                   APGISAMQATAAAIGAPLGHDFCAISLSDILKPWEIITQRIAAAAQGDFVIAFYNPVSK
FT                   ERTWQVSEAKSILLRYRKPDTPVILGRNIGRPRQVIKVITLEQLEPNDADMRTLIIVGS
FT                   SQTRQVQTSDSNLWVYTPRRYQM"
FT   gene            complement(112108..112242)
FT                   /locus_tag="Aazo_0125"
FT   CDS_pept        complement(112108..112242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62771"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVG3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62771.1"
FT                   /translation="MLMSSAPWWLLYLDHILNRSIPLQLTQYRVKSQNVVYLSENSCI"
FT   gene            112456..113740
FT                   /pseudo
FT                   /locus_tag="Aazo_0126"
FT                   /product="hypothetical protein"
FT   gene            114808..115164
FT                   /pseudo
FT                   /locus_tag="Aazo_0127"
FT                   /product="hypothetical protein"
FT   gene            complement(115266..116685)
FT                   /pseudo
FT                   /locus_tag="Aazo_0128"
FT                   /product="hypothetical protein"
FT   gene            complement(117027..117575)
FT                   /locus_tag="Aazo_0129"
FT   CDS_pept        complement(117027..117575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0129"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   ava:Ava_0290 pentapeptide repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62772"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVG4"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ADI62772.1"
FT                   /translation="MDTISFLNEYKSGQRNFQGVTLHQAKLTKAELTGVNLSEADLSGA
FT                   DLSEANLSKCNLARANLTNADLSQANLHSANLSEVNLIGADLMKANLLDANLSRADLRG
FT                   ANLMWANLLGANLSEAEMSGAVLSGANLRAANLIGSNINESEFNDTELAEAIITELEMT
FT                   GEILHMGLSHQWITWAGSY"
FT   gene            117822..118445
FT                   /locus_tag="Aazo_0130"
FT   CDS_pept        117822..118445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F1872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62773"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVG5"
FT                   /inference="similar to AA sequence:KEGG:Npun_F1872"
FT                   /protein_id="ADI62773.1"
FT                   /translation="MTTDLTSSITPDFHSILSQTAIAYREGSKPPKADVVVNALLQAEK
FT                   YAKQQRLNYPFDSLMGKWRLCFVTGTKKIRKRGGIVLGKGFYVPRFTSVHISFSIITEQ
FT                   VLDRGEIGNQVQLGSILLNLNGPAKYLGNKNLLAFDFTQMQISFSDRVVYNRQIRSGKT
FT                   QTLDFDNQPIAKLPFFAFFLLTEDFIAARGRGGGLAIWIKANPN"
FT   gene            complement(118511..119455)
FT                   /locus_tag="Aazo_0131"
FT   CDS_pept        complement(118511..119455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R5683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62774"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVG6"
FT                   /inference="similar to AA sequence:KEGG:Npun_R5683"
FT                   /protein_id="ADI62774.1"
FT                   /translation="MVILAVLVGLFVAIEIGLRSLFGFGNPLIYIGDEKIGYLLAPNQQ
FT                   TYRFGSRIEINEFSMRSGKISKIPAPGTFRVLLLGDSIANGGWWTDQKNTISHLLMNSL
FT                   TQSSNYQQIEVLNASANSWSPRNELAYLQKFGTFQSQNIVLLINTDDLFGTAPTSLPVG
FT                   RDKNYPDRKPPLAIVEVLQRYTFKQKAIPELEALYPEGGDHGSIILEAIGNIQTLTQAN
FT                   NSQLIVAMTPLLRELNAKEKRHYEIVARQRLWDFVTENKINYIDFLPIFQANTNPKSLY
FT                   HDHIHLNLQGNQFVVDVIEKSLLESLGENSTTH"
FT   gene            119748..119888
FT                   /locus_tag="Aazo_0132"
FT   CDS_pept        119748..119888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cyc:PCC7424_2499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62775"
FT                   /db_xref="GOA:D7DVG7"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVG7"
FT                   /inference="similar to AA sequence:KEGG:PCC7424_2499"
FT                   /protein_id="ADI62775.1"
FT                   /translation="MSDLNRGIMKFEGADSPKVVTVSTVLLLGSIAALILWALQSAYAL
FT                   S"
FT   gene            120053..122923
FT                   /locus_tag="Aazo_0133"
FT   CDS_pept        120053..122923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0133"
FT                   /product="pyruvate phosphate dikinase PEP/pyruvate-binding
FT                   protein"
FT                   /note="PFAM: pyruvate phosphate dikinase
FT                   PEP/pyruvate-binding; protein of unknown function DUF205;
FT                   PEP-utilising protein mobile region; KEGG: npu:Npun_F1309
FT                   pyruvate phosphate dikinase, PEP/pyruvate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62776"
FT                   /db_xref="GOA:D7DVE5"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVE5"
FT                   /inference="protein motif:PFAM:PF01326"
FT                   /protein_id="ADI62776.1"
FT                   /translation="MFHLWGLLVILITCPLLGAMPLIAWISYALKGKRLAQIGTRNISV
FT                   SAAFYHGGKLVGILAVLSEGFKGIAAVLISRLFFPTGSFWELIALIALVIGRYALGRGA
FT                   GTTNVVWGFLMHDPLIAGFVTLVAAIGLMFVRSRETIKFGVLILLPLLVAVLYSNDLPR
FT                   IVAVFTLAGLIGWIYKEIPDDMDLPVQEAEGETQQVMAYLNSGEQGIITLDEELEPEIF
FT                   GAKASTLSQIKRWGYPVPKGWILAPFDNPVVLIDFLQPSTLSPLVVRSSAIGEDSEQAS
FT                   GAGQYATILNVTSKQELEEAITQVQASYNNPAAVQYRRDRHAKDEAMAVLIQPQVQSVF
FT                   SGVAFSRDPIAQQGDAVVIEAVSGSASQVVSGKVTPEQYRVFVVGEDKLSTLKFEGEGK
FT                   IPQPLIKQVAYLARILEKRYYGIPQDVEWSYDGQNLWVLQARPITTLLPIWTRKIAAEV
FT                   IPGVIHPLTWSINLPLTCGMWGEIFTLVLGDRTRESDFSKMATLHYSRAYFNASFLGEI
FT                   FLEMGLPPESLEFLTRDTKMSKPPLASTWENLPGLTKLLQREICLENQFKQDYRHRFIP
FT                   GLTRLANELIEELSPNQLLTRVDLVLDLLNQATYYSILSPLSAAIRQAATGVKDEQIDH
FT                   SITPEVSSLRSLSLLAADAKEILPDIDPARVFEQLAETPEGEKILYEFQEIVEDYGYLS
FT                   EVGTDISVSRWKEQPHIVRQLFIQLVQGNEPPNQDGSKKRHQGFVQKRVDLKGRVTEIY
FT                   SRLLAELRWTFLALEKIWLQSSVLQQPGDIFFLKLGEVRRLAAEADPALRNQVSEKVAN
FT                   RRSQFNQDSQITQIPPLVYGYNPPHPIDSPIDSADNILLGIPASQGQATGLVKVLRNLQ
FT                   EVGEIDKGTILVVPYTDSGWALILVRAGGIIAEAGGKLSHGAIVAREYGIPAVMDVRGA
FT                   TYLLQDGQQVKIDGSKGIVELQEFFT"
FT   gene            complement(123694..124356)
FT                   /pseudo
FT                   /locus_tag="Aazo_0134"
FT                   /product="hypothetical protein"
FT   gene            124641..126218
FT                   /pseudo
FT                   /locus_tag="Aazo_0135"
FT                   /product="hypothetical protein"
FT   gene            complement(126438..129386)
FT                   /locus_tag="Aazo_0136"
FT   CDS_pept        complement(126438..129386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0136"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: 5'-3' exonuclease; Helix-hairpin-helix domain
FT                   protein class 2; 3'-5' exonuclease; DNA-directed DNA
FT                   polymerase; TIGRFAM: DNA polymerase I; KEGG: ana:alr1254
FT                   DNA polymerase I; PFAM: DNA-directed DNA polymerase; 5'-3'
FT                   exonuclease, N-terminal resolvase-like domain; 5'-3'
FT                   exonuclease, SAM-fold domain; 3'-5' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62777"
FT                   /db_xref="GOA:D7DVE6"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVE6"
FT                   /inference="protein motif:TFAM:TIGR00593"
FT                   /protein_id="ADI62777.1"
FT                   /translation="MPLSSFNNLTSDSTISNNPTFILVDGHSLAFRSYFAFAKGKNGGL
FT                   RTKAGIPTSVCFGFIKCLLEVITTQKPQAIAVAFDLGLPTFRHEADDTYKADRLETPED
FT                   FIPDLENLNELLRGLNLPIFTAPGYEADDVLGTLSQKASAAGYRVKILSGDRDLFQLID
FT                   GDKGITVLNFSPEALKRYANSITEFQAEQVKEKLGVLPTQIVDFKALCGDKSDNIPGVR
FT                   GIGEKTAVKLLNTYNSLDGIYAKLDEITGSTQEKLIAGKEDASHSRYLAQIVVDVPLEV
FT                   NLEDCQLTGFDTNQLIPILEKLEFNKFLDQINELQQKLGGQVLETKAEEINTTQEDDDL
FT                   WFFSGEDTANTEKRPDSSIQIRIINTEDKLQELVAILQKCTNLEKPVAWDTETTALEPR
FT                   DAALVGIGCCWGTGSDEAAYIPVGHKIGHNLQLDLVVSALRPILENANYPKTFQNAKFD
FT                   RLIFKCQGINLVGVVFDTMLASYLINPDTTHNLSDLSLRNLGLQLTEYNDIVTKTGKKE
FT                   LQKNIADIGIDIVAYYCGTQVYATFQLVDKLRCELNKTPDLAKLLVEVEQPLEAVLAEM
FT                   EYTGVRINSSYLQELSQQLESELAKLEIQATEIASEKFNLDSPKQLSYILFDKLGLSTK
FT                   YSRKIQTGYSTDAATLEKLQEVDNTGFVDAIIEYRTSSKLKSTYVDALPALVHPQSQRL
FT                   HTDFNQTATSTGRLSSSNPNLQNIPIRTAFSRQIRKAFLPESGWLMVAADYSQIELRIL
FT                   AHLSQEPVLVQAYKQNEDIHTVTAKLVFEKDEVTSEERRFAKTINFGVIYGMGSLKFAR
FT                   STGVDKANANEFIRRFNERYPQVFAYLEKVKKEAISQGYVETILGRRRYFDFTSKSLKE
FT                   LKGISLEDIDLSRLKNLGAYNAGLLRSAANAPIQGSSADIIKIAMVQLHEVLRNYQARL
FT                   LLQVHDELVFEVPPQEWGELQLQIKSVMENAMSLSVPLVVDVRAGDNWMETK"
FT   gene            130034..130729
FT                   /locus_tag="Aazo_0137"
FT   CDS_pept        130034..130729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R6196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62778"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVE7"
FT                   /inference="similar to AA sequence:KEGG:Npun_R6196"
FT                   /protein_id="ADI62778.1"
FT                   /translation="MNSKFFSTFAAVSTLAGIVVTAGTSSAASISYTASSGDYAITNFN
FT                   QTLSLQQFDTSLGILTSVTLDIVGFINGNAKFESLNAASSLIRANVSAILNLTQGGVTL
FT                   FSLNPSNSKSYQATAFDGVVDFAGTSAITLDIILDEDVATRTLTNNLESFIGSGNVNFL
FT                   VSAIADSSVTGSGNILSQIGTLAKGQLTVTYNYDASTLIKIPEASLHFTGICSNCWVSF
FT                   VVTSKKKPI"
FT   gene            130956..131795
FT                   /locus_tag="Aazo_0138"
FT   CDS_pept        130956..131795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0138"
FT                   /product="Cof-like hydrolase"
FT                   /note="KEGG: ana:alr3950 hypothetical protein; TIGRFAM:
FT                   Cof-like hydrolase; HAD-superfamily hydrolase, subfamily
FT                   IIB; PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62779"
FT                   /db_xref="GOA:D7DVE8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVE8"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADI62779.1"
FT                   /translation="MHKASGVANDIKLLVLDIDGTIAGHDNQVSETVRQAIQATQARCI
FT                   QVAIATGRMYCSALRFHQEINSTLPLVAYQGAWIQDPSNQRIHRHLAVSREIAQQLLDY
FT                   FEQPELLSLLSIHFYINDQLYVREITTETENYAQRCGVTPIPVSDLRQVLSNEPTKVLA
FT                   LCDDANLIQALLGNLRIQYTPAELYMTRSIATFLEATNPVVNKGSAVRYLAEEVLGLES
FT                   DQVMTIGDNINDVEMLEYAGIGVAMGSAPDSVKALANWVAPSVENDGVAIAIEKFLL"
FT   gene            complement(132027..132947)
FT                   /locus_tag="Aazo_0139"
FT   CDS_pept        complement(132027..132947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0139"
FT                   /product="DALR anticodon binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62780"
FT                   /db_xref="GOA:D7DVE9"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVE9"
FT                   /inference="protein motif:PFAM:PF05746"
FT                   /protein_id="ADI62780.1"
FT                   /translation="MHYWLLFKKYTSNKQLVYLHFLNFLSVYTKDEEILSIGRGKIPLY
FT                   QDTDAEKILYISSLGQQISASKNSHRMAILRELAAYLSANCGEIFSVQIVPPDWIHIEL
FT                   TDPTLAWWLNNLTVDSLRLESMKGEMRRWGDGENNILLSAPSPLPPDSSFLRNKKKSFF
FT                   TVQYAHARCCSLLRLAHQEGLIQLTDNDAGVQCFLSAQAIPWLNSDQTLRFHQLEEIRL
FT                   IHQLVKMVDDLVVSDFSSSVNWEKAALKLSQAFESFWCHCRIWGEVKIKSLELAQARLG
FT                   LLIATQLVLRAVLETKLGVFAPVEL"
FT   gene            133259..133978
FT                   /locus_tag="Aazo_0140"
FT   CDS_pept        133259..133978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0140"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="KEGG: ava:Ava_1750 Crp/FNR family transcriptional
FT                   regulator; PFAM: regulatory protein Crp; SMART: regulatory
FT                   protein Crp"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62781"
FT                   /db_xref="GOA:D7DVF0"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVF0"
FT                   /inference="protein motif:PFAM:PF00325"
FT                   /protein_id="ADI62781.1"
FT                   /translation="MQSQSSFSEASRPFLTWQRILDWAQEHYRCRTFSKDERIPARPGL
FT                   LYLVQRGAIRMVGTAQVSATASQLTSRRINRTPEEAFLGFVGAGQPFEIVAQSPFTLQS
FT                   YAHVDQTAVLWMYWHDLDNWPHFRREVMDAFRYQHQRKLLWLSALGQRRTIDRLLGFLT
FT                   LLIEEYGEPAMSETDPDVIRGYCLPFPLTHAQIGSAIGSTRVTVTRLMGKLRQRGLILT
FT                   QGDNLICLPAESINRTN"
FT   gene            complement(134052..135122)
FT                   /pseudo
FT                   /locus_tag="Aazo_0141"
FT                   /product="hypothetical protein"
FT   gene            135674..135799
FT                   /locus_tag="Aazo_0142"
FT   CDS_pept        135674..135799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62782"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62782.1"
FT                   /translation="MPVLGLVIAHLLFATPHKIALLPLLSRFQFRLIDLQSALLF"
FT   gene            complement(135863..136464)
FT                   /pseudo
FT                   /locus_tag="Aazo_0143"
FT                   /product="hypothetical protein"
FT   gene            complement(136486..137481)
FT                   /pseudo
FT                   /locus_tag="Aazo_0144"
FT                   /product="hypothetical protein"
FT   gene            complement(137703..138537)
FT                   /pseudo
FT                   /locus_tag="Aazo_0145"
FT                   /product="hypothetical protein"
FT   gene            complement(138651..139664)
FT                   /locus_tag="Aazo_0146"
FT   CDS_pept        complement(138651..139664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0146"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: npu:Npun_F6188 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62783"
FT                   /db_xref="GOA:D7DVF3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVF3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADI62783.1"
FT                   /translation="MSDLPFTLDQLRILKAIAQEGSFKRAADSLYVSQPAVSLQVQNLE
FT                   RQLDVPLFDRGGRRAQLTEAGHLLLSYGEKILSLCQETCRAIEDLQNLQGGTLIVGASQ
FT                   TTGTYLLPRMIGMFRQKYPDVAVQLHVHSTRRTAWSVANGQVDLAIIGGEIPGELTESL
FT                   EIVPYAEDELALILPTFHPFTKLDTIQKDDLYKLQFIALDSQSTIRKVIDQVLARCEID
FT                   TRRFKFEMELNSIEGIKNAVQSGLGAAFVSTSAIAKELQMGVLHRTPIEGVVVKRTLWL
FT                   IFNPNRYRSKAAEAFSQEILPQFATPGWDGDTLKLSRKNLVVTALDTLTPNLAEAE"
FT   gene            139905..140621
FT                   /locus_tag="Aazo_0147"
FT   CDS_pept        139905..140621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0147"
FT                   /product="NnrUfamily protein"
FT                   /note="PFAM: NnrUfamily protein; KEGG: ava:Ava_1748 NnrU"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62784"
FT                   /db_xref="GOA:D7DVF4"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVF4"
FT                   /inference="protein motif:PFAM:PF07298"
FT                   /protein_id="ADI62784.1"
FT                   /translation="MMPNPWFTTSHSVMLGLQLAFVIAHSGGAALRPWAETHIGPRLYR
FT                   ILFALVSLPLAVILIIYFFNHRYDGLQLWQVQGIPGVKAVVWVLSAISFLFLYPATFNL
FT                   LEIAAIQKPQVYLYEIGIIRITRHPQMVGQVIWCLAHTLWLGTTFTLVTSMGLVLHHLF
FT                   GVWHGDRRLSNSYGEAFAAVKQRTSIIPFLAILDGRQSLQGHEFLRPAYLGVAIFIFLL
FT                   WWSHPLLILGTSRIPW"
FT   gene            140615..140734
FT                   /locus_tag="Aazo_0148"
FT   CDS_pept        140615..140734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62785"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVF5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62785.1"
FT                   /translation="MVVLSDPQNTLNITNFIKSLLFNQPQIDVEYLRIDVSKS"
FT   gene            141439..141825
FT                   /locus_tag="Aazo_0149"
FT   CDS_pept        141439..141825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0149"
FT                   /product="Thioredoxin domain protein"
FT                   /note="PFAM: Thioredoxin domain; KEGG: ava:Ava_1747
FT                   thioredoxin-related"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62786"
FT                   /db_xref="GOA:D7DVF6"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVF6"
FT                   /inference="protein motif:PFAM:PF00085"
FT                   /protein_id="ADI62786.1"
FT                   /translation="MVLSVSERTFTQEVLESPIPVLVNFEAPWCGLCRIIHPLLLQFQT
FT                   QCSDEIKLVGVNADENFKLSTTYRLKSLPTLLLIEKGIVRQRLEAFRSRDDFRMALEEI
FT                   KLSYSSSYKIYNSSETADLECQSA"
FT   gene            142148..144235
FT                   /locus_tag="Aazo_0150"
FT   CDS_pept        142148..144235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0150"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /EC_number="1.6.99.5"
FT                   /note="TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain L; KEGG: ava:Ava_1746 NAD(P)H-quinone
FT                   oxidoreductase subunit F; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); NADH-Ubiquinone
FT                   oxidoreductase (complex I) chain 5/L domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62787"
FT                   /db_xref="GOA:D7DVF7"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR002128"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVF7"
FT                   /inference="protein motif:TFAM:TIGR01974"
FT                   /protein_id="ADI62787.1"
FT                   /translation="MEAIYQYAWLIPVLPLLGAMLVGLGLISKNQVTNRLRQLNAVVII
FT                   SLMGAAMGLSLALLWSQFQGHEPYLRTLEWAAAGNFHLTMGYTIDHLTALMLVIVTTVA
FT                   FLVMIYTDGYMSHDPGYVRFYAYLSLFGSSMLGLVVSPNLVQIYIFWELVGMCSYLLVG
FT                   FWYDRKAAADACQKAFVTNRVGDFGLLLGILGLFWATGSFDFMIMGDRLAKLVETGSVS
FT                   NFLAILFAILVFLGPVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGVFLIARMY
FT                   PVFEHVPAAMTVIAFTGAFTAFLGATIAITQNDIKKGLAYSTISQLGYMVMAMGVGAYS
FT                   AGLFHLMTHAYFKAMLFLGSGSVIHGMEGVVGHDAVLAQDMRLMGGLRKYMPATGITFL
FT                   IGCLAISGIPPFAGFWSKDEILGAAFAANPLLWFIGWVTAGITAFYMFRMYFSTFEGKF
FT                   RGNDEKIKTELKNAAAGAAEKLGAVELAPNFGPGAMKKGELDNHSHDSHGYHSTSPHES
FT                   PWTMTLPLLVLAVPSILIGLVGTPYANYFEQFIFSPNESLAEVMEKAAEFDPHEFYIMA
FT                   GSSVAISVVGITLAVLMYLAQKIDPAAIASKIKPLYELSLNKWYFDDIYHRVFVLGLRR
FT                   VARQVMEVDFRVVDGAVNLTGFFTLVSGEGLKYLENGRVQFYALIVFGAVLGLVIVFGV
FT                   T"
FT   gene            complement(144459..145401)
FT                   /pseudo
FT                   /locus_tag="Aazo_0151"
FT                   /product="hypothetical protein"
FT   gene            complement(145716..146435)
FT                   /locus_tag="Aazo_0152"
FT   CDS_pept        complement(145716..146435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R3735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62788"
FT                   /db_xref="GOA:D7DVG8"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVG8"
FT                   /inference="similar to AA sequence:KEGG:Npun_R3735"
FT                   /protein_id="ADI62788.1"
FT                   /translation="MRDDLEGLEISHQQLDKLTNLPVNNELILITKYLGKWGEYLIEKM
FT                   RVTEGATVVFIGCCTFVSLYLLFDIFLKMFVIKIPIPSGILLILLSIWIGGFIQTILYM
FT                   VWKIKSNFLKSNMTNSLGILLSDVKRYNDVINAININDQIEEAGNLEVGIKQRKKVIEA
FT                   LNLTKLDLVRALKTERILRENKNFILSNSELFTNNLATLTSMQVTEQATEHGRLLNEAL
FT                   QIALDVQYEMSRLHSQG"
FT   gene            complement(146651..147040)
FT                   /locus_tag="Aazo_0153"
FT   CDS_pept        complement(146651..147040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: npu:Npun_R3738 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62789"
FT                   /db_xref="GOA:D7DVG9"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62789.1"
FT                   /translation="MADKSLEALVVKVVKKAIKKEIKAINQYSLPIVSTQRNQELQSFA
FT                   ETLETEDHTQSTAEIFDNTYASNTVNFPAKEDVELERKLREIKFKQDLRKDWILFILRD
FT                   VIVYAATVLLIFTVTGFYLFAIINT"
FT   gene            147254..147547
FT                   /locus_tag="Aazo_0154"
FT   CDS_pept        147254..147547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R4923 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62790"
FT                   /db_xref="GOA:D7DVH0"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVH0"
FT                   /inference="similar to AA sequence:KEGG:Npun_R4923"
FT                   /protein_id="ADI62790.1"
FT                   /translation="MVTVVVLFNIILSLILFYVAWQVCQLTHKLGIIADRLNSYEHATY
FT                   VVLSTAPAKIYTGQQQIYNLRQKNQNLKLQIQQVRQILNLLLLGRKIWQRYL"
FT   gene            147586..147738
FT                   /locus_tag="Aazo_0155"
FT   CDS_pept        147586..147738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62791"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62791.1"
FT                   /translation="MVCPTPKKVQAEIFHFVQEALRFIDGEERVCSRSVPKVSSSWIYQ
FT                   WGLQF"
FT   gene            147928..148281
FT                   /locus_tag="Aazo_0156"
FT   CDS_pept        147928..148281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R4922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62792"
FT                   /db_xref="GOA:D7DYG9"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYG9"
FT                   /inference="similar to AA sequence:KEGG:Npun_R4922"
FT                   /protein_id="ADI62792.1"
FT                   /translation="MSNNRSGVFIGGLMLGATIGALTGLLAAPRAGRETRKLLKKSADA
FT                   LPELAEDISTTVHIQADRLSASALRNWDDTLERLRIAIAAGVDATQRESGALRRQNSAE
FT                   SESADPLVQHLER"
FT   gene            148476..149054
FT                   /locus_tag="Aazo_0157"
FT   CDS_pept        148476..149054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R4921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62793"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYH0"
FT                   /inference="similar to AA sequence:KEGG:Npun_R4921"
FT                   /protein_id="ADI62793.1"
FT                   /translation="MNPLFWLGLSILLVAASLTAVLVVAIPALQELARAARSAEKLFDT
FT                   LSRELPPTLNAIRNTSLEITDLTDDVSEGVKSASQVVKQADQSLDSARKQAQNIQSSTR
FT                   SVLVGIRTAWLTFTSQRTNKRSSIERLPINDQAQLTLREREMLRRENRRTEQETYRNNN
FT                   GYNKAVNWENDFNEGDLVSKSAPLEDWSD"
FT   gene            149248..150057
FT                   /locus_tag="Aazo_0158"
FT   CDS_pept        149248..150057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62794"
FT                   /db_xref="GOA:D7DYH1"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYH1"
FT                   /inference="similar to AA sequence:KEGG:Ava_0477"
FT                   /protein_id="ADI62794.1"
FT                   /translation="MQLCFWRRFLVSLAVFFFAGSIWAINSPSALAYENPDLLPERFTP
FT                   VVDLAKTLPDPQEEKLVQELEQFETNTGWKLRVLTQYDRTPGRAVIKYWGLDDKSILLV
FT                   ADARGGNILSFSVGEAVYELLPRTFWIELQTRFGNLYFVREQGEDQAILQALDSVKGCL
FT                   LKGGCNVVPGLPREQWILTVITSAVGGVICGFAAQPRNDKQIFAWQWALIFSPLWGILF
FT                   IAFGIAPVITRTSDWVPLVRNISAFLIGVLVAYLSPVFSRPSSSTES"
FT   gene            complement(150291..150785)
FT                   /locus_tag="Aazo_0159"
FT   CDS_pept        complement(150291..150785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0159"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.12"
FT                   /note="TIGRFAM: methionine-R-sulfoxide reductase; KEGG:
FT                   ava:Ava_1796 methionine sulfoxide reductase B; PFAM:
FT                   Methionine sulfoxide reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62795"
FT                   /db_xref="GOA:D7DYH2"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYH2"
FT                   /inference="protein motif:TFAM:TIGR00357"
FT                   /protein_id="ADI62795.1"
FT                   /translation="MEKRHFLQISAVLVGTAFFLRYINGSSENMADADTKFEVTKPEEE
FT                   WKTILTSEQFQVLRKHGTERAHTSPLDKTYEPGTYVCAGCGQALFTSDTKFDSGTGWPS
FT                   FFKPIEGAIATTVDRSFFMTRTEVHCSRCGGHLGHVFNDGPRPTGFRYCMNGVSLKFTP
FT                   A"
FT   gene            151038..151811
FT                   /locus_tag="Aazo_0160"
FT   CDS_pept        151038..151811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0160"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   ana:all0327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62796"
FT                   /db_xref="GOA:D7DYH3"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYH3"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ADI62796.1"
FT                   /translation="MCQLLGMNCNIPTDICFSFEGFSARGGKTDEHSDGWGIAFFEGKG
FT                   CRIFLDAKPSVASPLAELVRRYPIHSTHVIAHIRKATQGKIALENCHPFQRELWGRYWA
FT                   FAHNGNLPDFHPENYGIFQPVGDTDSEQAFCLILNTLRASFPDGKPPLKLLYPVLSKVT
FT                   EELASIGILNYLLSDGEHFFTHCSTKLCYIIRQAPFAAAHLIDEEMIVDFTELATPSDR
FT                   VAIIVTTPLTDNEVWTPIPPGEILVFQDGLPLRWI"
FT   gene            complement(152066..152979)
FT                   /pseudo
FT                   /locus_tag="Aazo_0161"
FT                   /product="hypothetical protein"
FT   gene            153803..153931
FT                   /locus_tag="Aazo_0162"
FT   CDS_pept        153803..153931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62797"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYH4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62797.1"
FT                   /translation="MAQSQNTWSETNILLVITRPEGKLKQMNLANVISFLQQNYHN"
FT   gene            153969..155762
FT                   /locus_tag="Aazo_0163"
FT   CDS_pept        153969..155762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0163"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; KEGG:
FT                   npu:Npun_F0436 prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); YbaK/prolyl-tRNA
FT                   synthetase associated region; Anticodon-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62798"
FT                   /db_xref="GOA:D7DYH5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYH5"
FT                   /inference="protein motif:TFAM:TIGR00409"
FT                   /protein_id="ADI62798.1"
FT                   /translation="MRLSNKLFVTLRDDPGDAEIPSHQLLLRAGYIRRIGSGVYAYLPL
FT                   MWRVLQKVSQIVREEMNATGAEECLLPQLQPAELWKDSGRWDTYTKAEGIMFSLIDRRE
FT                   QQLGLGPTHEEVITTVARDMIRSYRQLPLHLYQIQTKFRDEIRPRFGLMRSREFIMKDG
FT                   YSFHTDEESLKKTYQDMYQAYSNMLRRAGLAFRAVEADSGAIGGSGSTEFMVLADAGED
FT                   EVLYTEDGKYAANVEKAVSLPAEAETSPFTRFEKRETPGTESIEKVCKFLKCSPTHIIK
FT                   NILYQAVYDSGLTVLVLVNIRGDQEVNEVKFQNELTKLACQFGAKTVVSISVPTNEIIA
FT                   SWSTKSLPLGYIAPDLDDDYIAGSKQVHSQFVRLVDKTAVELKNFVTGANESGSHVVGA
FT                   NWCEQFKLPELVVDIRKARVGDRSLHDPSQTLKTARGIEVGHIFQLGTKYSEAMGATYI
FT                   NEQGEKKPLIMGCYGVGVSRLAQSAVEQSYDKDGIIWPVAIAPYHSIITIPNIKDAQQI
FT                   EVAEKLYTELNKAGVETLLDDRDERAGVKFKDADLIGIPFRIVTGRAIANGKVEVVKRA
FT                   NRESQQIAIEEVVNTLQQWLK"
FT   gene            complement(155835..156488)
FT                   /locus_tag="Aazo_0164"
FT   CDS_pept        complement(155835..156488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0164"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="KEGG: ava:Ava_1091 16S rRNA-processing protein RimM;
FT                   TIGRFAM: 16S rRNA processing protein RimM; PFAM: RimM
FT                   protein; PRC-barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62799"
FT                   /db_xref="GOA:D7DYH6"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYH6"
FT                   /inference="protein motif:TFAM:TIGR02273"
FT                   /protein_id="ADI62799.1"
FT                   /translation="MNHEGTKKTKKRKGKGEVSKKSSPVPSPQSPVPNLHDWLEIGKIV
FT                   APQGLAGELRVYPNTDFPERFEESGTRWLLRPGEMEPQPIELLDGRYVEGKNLYVIKLE
FT                   GVSDRTAAENIRDCRLFVPISDRPEVEEGEFHVIDLLALQVFMQETGQFVGTVVDILPS
FT                   GHDLLEVKFDPAFAEDKAGKTVLIPFVIEIVPIVDLETRRVEITPPPGLLSIND"
FT   gene            complement(156494..157777)
FT                   /locus_tag="Aazo_0165"
FT   CDS_pept        complement(156494..157777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0165"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ava:Ava_1090 valine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62800"
FT                   /db_xref="GOA:D7DYH7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYH7"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADI62800.1"
FT                   /translation="MKPALTKIGAQMSNLTGVRAIMKDINETLRANEGQELYNLSAGNP
FT                   LILPEVEQLWRDCTADLLASPEYGEVVCRYGSSQGYAPFISVMVKDFNQRYGLNLTERN
FT                   ILVTAGSQTIYFYAANAYGGYTNDGDLKQIVLPLSPDYTGYGGVGLCPEALIAYKPTLD
FT                   IDSANHRFKYRPDFSQLSITQETGCMIFSRPCNPTGNVLTNDEVEKIAALAAPYHVPVL
FT                   IDSAYAPPFPALNFTEMTPVFGENILHCMSLSKAGLPGERIGIAIGDENLLQALECFQT
FT                   NAGIHSSRYGQAIAARAIESGALANIAESVIRPFYRHKFNVLESTLEVAIPNNIPWFLH
FT                   RGEGAIFGWLWLEDLPMTDWEFYQELKKVGVIVVPGSSFFPGLKEEWEHKHQCLRISLT
FT                   GSDEEITIGMQHLAKVAEQVYQRAAVSV"
FT   gene            158367..159280
FT                   /pseudo
FT                   /locus_tag="Aazo_0166"
FT                   /product="hypothetical protein"
FT   gene            complement(159519..159974)
FT                   /locus_tag="Aazo_0167"
FT   CDS_pept        complement(159519..159974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0167"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ava:Ava_1441 transposase IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62801"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYH8"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADI62801.1"
FT                   /translation="MYGFDGCRKVKGRKGHTLVDSLGLVLKVVVSEANAPERILAAYAL
FT                   MELLEKPTELLEKVQVLWVDSGYDGDKFALAVWFLTQAHVEVIGPTEQEFKVLPQPWVV
FT                   ERTFGWFNQYHRLSKDYERLTQMREGAIYALMTRIMLLPLVSSTFTL"
FT   gene            complement(159944..160327)
FT                   /pseudo
FT                   /locus_tag="Aazo_0168"
FT                   /product="hypothetical protein"
FT   gene            complement(160505..162079)
FT                   /locus_tag="Aazo_0169"
FT   CDS_pept        complement(160505..162079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0169"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /note="KEGG: npu:Npun_R6182 proton-translocating
FT                   NADH-quinone oxidoreductase, chain M; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain M;
FT                   PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62802"
FT                   /db_xref="GOA:D7DYH9"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="InterPro:IPR022997"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYH9"
FT                   /inference="protein motif:TFAM:TIGR01972"
FT                   /protein_id="ADI62802.1"
FT                   /translation="MNIANFPWLTTIILFPIAASLLLPIIPDKDGKTVRWYSLIVGLID
FT                   FALIVYAFYTGYDFSNPDLQLVESYPWVPQLGLNWSVGADGLSMPLILLTGFITTLAVL
FT                   AAWPITLKPKLFYFLILAMYGGQIAVFAVQDMLLFFLVWELELVPIYFLLSIWGGKKRQ
FT                   YAATKFILYTAGGSLFILLSALTMGFYGDTVTFDMRAIALKDFGLNLQLLLYAGFLIAY
FT                   AVKLPIIPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALIRMNAEMLPDAHAYIAPAL
FT                   VVLGVVNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIASFTDLGLSGAMLQMVSHG
FT                   LIGASLFFLVGATYDRTHTLMLDEMGGVGKKMRKIFAMFTTCSMASLALPGMSGFVAEL
FT                   MVFVGFATSDAYNPTFKVIIIFLMAVGVILTPIYLLSMLREIFYGQENEELVSHQALID
FT                   AEPREVFIIACLLIPIIGIGFYPKLLTQIYDATTVQLTARLRDSVPTLTAAKAVETVSL
FT                   TAPIMGH"
FT   gene            162460..162693
FT                   /locus_tag="Aazo_0170"
FT   CDS_pept        162460..162693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0170"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amr:AM1_4779 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62803"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYI0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62803.1"
FT                   /translation="MSCINSDNVTVLAWIDEQEPKAQILADLQESVPQVTAGQTLSVSE
FT                   LWEDITTYLIGFQIPNPEHEKADGCSCCPIEE"
FT   gene            complement(162606..164171)
FT                   /pseudo
FT                   /locus_tag="Aazo_0171"
FT                   /product="hypothetical protein"
FT   gene            complement(164202..165109)
FT                   /pseudo
FT                   /locus_tag="Aazo_0172"
FT                   /product="hypothetical protein"
FT   gene            complement(165503..166507)
FT                   /pseudo
FT                   /locus_tag="Aazo_0173"
FT                   /product="hypothetical protein"
FT   gene            166947..167913
FT                   /pseudo
FT                   /locus_tag="Aazo_0174"
FT                   /product="hypothetical protein"
FT   gene            168329..169096
FT                   /locus_tag="Aazo_0175"
FT   CDS_pept        168329..169096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0175"
FT                   /product="protein of unknown function DUF1350"
FT                   /note="PFAM: protein of unknown function DUF1350; KEGG:
FT                   npu:Npun_R3734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62804"
FT                   /db_xref="InterPro:IPR010765"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYI1"
FT                   /inference="protein motif:PFAM:PF07082"
FT                   /protein_id="ADI62804.1"
FT                   /translation="MDWKDIRGNWVIIPPKPIGIIHFLGGAFVATAPHLTYRWLLEQLA
FT                   AKGYVVIATPFVNTLDHSTIAQSVLINFERTLERLQDTGELRKLYLPIYGVGHSMGCKL
FT                   HLLIGSLFKVERAGNILISFNNYTAKEAIPLVEQLNSTLAIEFTPTPLETNQLVEERYH
FT                   IRRNLLIKFSNDNLDQSAVLTKILQNRFPEMVTTQTLSGNHTTPLGQEIKWQPGNSFTP
FT                   LDALGQWFKQEVYRDLNQLRKIILLWLNPLALT"
FT   gene            169328..170464
FT                   /locus_tag="Aazo_0176"
FT   CDS_pept        169328..170464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0176"
FT                   /product="response regulator receiver modulated serine
FT                   phosphatase"
FT                   /note="KEGG: npu:Npun_R3733 response regulator receiver
FT                   modulated serine phosphatase; PFAM: Stage II sporulation E
FT                   family protein; response regulator receiver; SMART:
FT                   response regulator receiver; protein phosphatase 2C domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62805"
FT                   /db_xref="GOA:D7DYI2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYI2"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADI62805.1"
FT                   /translation="MFQILVIDDDYSIQIFLKRMLEKQGYEVITASNGQEGILQALACP
FT                   PALIICDWIMPGLTGIEVCDHIKKDPNLSTTFFILLTSLDSVADRVKGLDAGADDFISK
FT                   PIEQNELQARVRAGLRLHQLNRDLQSQKLLLETELAEAAEYVKSLLPLPMSAPIAINSR
FT                   FIPSRQLGGDCFDYYWLDSDYVAIYLLDTAGHGLRATLPSISVLNLLRSRALKGLNYYQ
FT                   PSQVLTALNDTFQMNYQNDKYFTIWYGVYDRINRQLTYASAGHPPAILVSGKSPATTEL
FT                   KLLKTPGMPVGMFPEAKYVDRACRIDNFSSLYIFSDGAYEITKSDGTLWNLDGFIQLLV
FT                   SLQHSVDYQLEHILNYLINLNSKEAFDDDLSILQIKFD"
FT   gene            complement(170461..170787)
FT                   /locus_tag="Aazo_0177"
FT   CDS_pept        complement(170461..170787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0177"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="KEGG: npu:Npun_F3732 anti-sigma-factor antagonist;
FT                   TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62806"
FT                   /db_xref="GOA:D7DYI3"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYI3"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADI62806.1"
FT                   /translation="MNQKVKVLTLKKNLNAQTSSEFQQAITVILESGAEIVLLDCQNIT
FT                   FLDSSGLGTLVLAFKTLRDAGKKMVLCSINDQVRMIFELTSMTEIFEIFPSKDEFNQIL
FT                   LAKN"
FT   gene            complement(171051..171743)
FT                   /locus_tag="Aazo_0178"
FT   CDS_pept        complement(171051..171743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0178"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   npu:Npun_F3731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62807"
FT                   /db_xref="GOA:D7DYI4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYI4"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ADI62807.1"
FT                   /translation="MPDDDLTQKLQNLMQCVGISSFKSLSAAAGVSERQILQLRRGKLK
FT                   QMRVEVLLKLAKVLQLSLSELAANFSDASSDYQVLNLTVDTRNLTQSINTGIDLVQENT
FT                   NLKGEYERIVLMLQQQQELLQQEFQESGLEILESLLLFWPTAAQKARENPQLEAVKILP
FT                   LVEKPLDQLLQAWGVEAIASVGSEIPYNPQLHELLAGVAQPGEIVKVCYIGYRKGEKLL
FT                   HRAKVNRL"
FT   gene            complement(172072..172215)
FT                   /pseudo
FT                   /locus_tag="Aazo_0179"
FT                   /product="hypothetical protein"
FT   gene            172397..173998
FT                   /locus_tag="Aazo_0180"
FT   CDS_pept        172397..173998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0180"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="KEGG: npu:Npun_R3728 SpoIID/LytB domain-containing
FT                   protein; TIGRFAM: SpoIID/LytB domain protein; PFAM: Stage
FT                   II sporulation D domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62808"
FT                   /db_xref="GOA:D7DYI5"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYI5"
FT                   /inference="protein motif:TFAM:TIGR02669"
FT                   /protein_id="ADI62808.1"
FT                   /translation="MNTFFWPSAYKILTTLCLLGLTAASSRVNNNQDVELKIGIVQRFG
FT                   ATPTAKVQLTPNQGDRLQLKWTVGNQPQTLVTANPVQLETVMETLPQPKIQEVVVLGDF
FT                   PTFETAEDSSRHWRSQGIEVEIAQPERWQVWAKRDVYSTPLVRRLFLQSIQVSGQKLPY
FT                   LYTQILKQVPRVSWEIKGKRYSQNYLEITTGKNLIRVNQGGKTGNTRLFAGRINLQPNA
FT                   YGTYSLVNKVPLETYLRGVLPYEIGTSAPKASLEAQAVIARTYALRNLRRFAIDDYQLC
FT                   ADTHCQVYDGLNGVAKTTDQAIAATRGMVLTYNQELVDALYSSTTGGVTASFSDVWNRE
FT                   DRPYLRPVIDAAVNIWNLSEKSLAHEKNFRQFINLEKGFNESTWDVFRWHKQTSLEDIT
FT                   KDLQKFLRLKKSPYAKLKTVEALAVTKRSDSGRILDMAVKTDIGVFTLHKDEVRSAFAA
FT                   PCSTLFYLQPINKGKPDVWGYAFIGGGLGHGVGLSQTGAQNLAKLGWSSVKILHFYYPG
FT                   TQLQLLSNEIKPFLNN"
FT   gene            complement(174445..174744)
FT                   /locus_tag="Aazo_0181"
FT   CDS_pept        complement(174445..174744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0181"
FT                   /product="ferredoxin (2Fe-2S)"
FT                   /note="KEGG: npu:Npun_F3727 ferredoxin (2Fe-2S); TIGRFAM:
FT                   ferredoxin [2Fe-2S]; PFAM: ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62809"
FT                   /db_xref="GOA:D7DYI6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR010241"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYI6"
FT                   /inference="protein motif:TFAM:TIGR02008"
FT                   /protein_id="ADI62809.1"
FT                   /translation="MATYKVTLINKAENFNETLEVADDVYILDAAEEAGFDLPYSCRAG
FT                   ACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPSSDLVIETHKEEELY"
FT   gene            175171..176178
FT                   /locus_tag="Aazo_0182"
FT   CDS_pept        175171..176178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0182"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   npu:Npun_R3726 oxidoreductase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62810"
FT                   /db_xref="GOA:D7DYI7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYI7"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADI62810.1"
FT                   /translation="MYNSNAPLANTTMRVGLVGTGSAAKLRAEALRQDTRAHLVAISGH
FT                   TSEKTAALAQEYQTEVMNSWQKLVARKDLDLVIISTVNRDHGQITRAALTSGKHVIVEY
FT                   PLSVDIKEAEELIALAKAKNKLLHVEHIELLGGWHQALKQYLLQLGQLFYIRYSTVKPE
FT                   HPAPRKWTYNHELFGFPFIGALSRLHRLTNLFGKVLTVNCHQRYWETQSDYYQSCLCVV
FT                   QLYFATGLLAQVIYGKGESLWQSERKMEINGEKGGLILDGDTGILVQPEETKLIEVSGR
FT                   RGLFVKDTTMVLDHLLYGTSLYVTPEQSLYALKVADAARRAAETGLTIFLTKES"
FT   gene            176179..176967
FT                   /locus_tag="Aazo_0183"
FT   CDS_pept        176179..176967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0183"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="KEGG: ava:Ava_0754 methionine aminopeptidase;
FT                   TIGRFAM: methionine aminopeptidase, type I; PFAM: peptidase
FT                   M24"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62811"
FT                   /db_xref="GOA:D7DYI8"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYI8"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ADI62811.1"
FT                   /translation="MKTEPIVILSQREIEKMRRAGRLAAKLLQHLEPLVKPGVSTLQLN
FT                   DEAERWTQAHGAISAPLGYRGFPKSICTSVNEVICHGIPNAKQILREGDIINIDVTLIV
FT                   DRYHGDTSKTFIVGVSSPKVQKLVKVTEECLCLGIVEVKPDAKIGDIGAAIQEYAEAQG
FT                   FSVVRDFVGHGISNIFHTAPDIPHYGIRGRGKRLRPGMVFTIEPMINEGTYEVEMLSDG
FT                   WTAVTRDRKLSAQFEHTIVVTEDGVEILTLPEGPSNHGKT"
FT   gene            176954..177169
FT                   /pseudo
FT                   /locus_tag="Aazo_0184"
FT                   /product="hypothetical protein"
FT   gene            177330..177584
FT                   /locus_tag="Aazo_0185"
FT   CDS_pept        177330..177584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lac:LBA0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62812"
FT                   /db_xref="GOA:D7DYI9"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62812.1"
FT                   /translation="MIHSPQHLTVIQAAGIWWNHRKFLGALLVSYPKKQYLLAPKYENT
FT                   REYIVKQSQINFANIAVLILVYLPYTFYLTTFSFQNQLI"
FT   gene            177854..178066
FT                   /pseudo
FT                   /locus_tag="Aazo_0186"
FT                   /product="hypothetical protein"
FT   gene            178286..178528
FT                   /locus_tag="Aazo_0187"
FT   CDS_pept        178286..178528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_2941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62813"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYJ0"
FT                   /inference="similar to AA sequence:KEGG:Mmc1_2941"
FT                   /protein_id="ADI62813.1"
FT                   /translation="MKNVLKSPEPEELKNYKLQYSSQFKRWKHLKSNRMTFNAVLQTLV
FT                   ADQKGLCAYCEMSIHENNRSVDHFIPRKQSINKRK"
FT   gene            178601..179302
FT                   /locus_tag="Aazo_0188"
FT   CDS_pept        178601..179302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0188"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="KEGG: ava:Ava_2606 alkylhydroperoxidase AhpD core;
FT                   TIGRFAM: alkylhydroperoxidase like protein, AhpD family;
FT                   PFAM: Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62814"
FT                   /db_xref="GOA:D7DYJ1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYJ1"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ADI62814.1"
FT                   /translation="MATSKLPHDSPCCGKKKDDFIPDSRLLNPLTLPTSSLFKFSSKDG
FT                   EIRANETACIAAGIPVKNVQFTIDKLGLNIPRLKDQRLVVIDKINKELDDETFDINDLE
FT                   EKVAGEYFDDGTGNWPRFFTTLRWVLGAGAEGHLTIKSFWKALANHPPTLRPTWENLKE
FT                   IMADPGEIDPLMRELIYIAVSVTNGCEYCIASHSAAALNKGITHQMFGELMAITGATNM
FT                   INRFANGYKIL"
FT   gene            complement(179738..181084)
FT                   /locus_tag="Aazo_0189"
FT   CDS_pept        complement(179738..181084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0189"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   ava:Ava_0753 pentapeptide repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62815"
FT                   /db_xref="GOA:D7DYJ2"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYJ2"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ADI62815.1"
FT                   /translation="MTIASNSSHPPKPETNIDKDLQPDDFDASENGLTSEGLAAQQALS
FT                   AISSLQSPQHTNALKQATSGFKDISHHQLAVKPRALLFTLLAIALTFIGIAINNSFLGI
FT                   LGTLTTLVLSVAILLPWLQDVVQEWFSAQERTVLVGLTGLLVAICGLFRFTGVENGLLR
FT                   WGSKINWDIAGTLADWFGALGQISIAIIAVYVAWRQYVISKDLTIQQNLLTVQQNIITQ
FT                   QQTIDSYFQGVSDLVLDEEGLLEDWPQERAIAEGRTAAIFSSVDGSGKAKILRFLSRSK
FT                   LLTPLKRDRRLGRAILDGIGGYAEDLLEGVRVIDLGVMLAGADLSNTDLRWTDLSEANL
FT                   VRANLSGCDLVKANLSRTILYDADLNNSDLNGVRFFYGSLEKASPRSRNNPPNYETGEH
FT                   TGAVVENADFRNAQRMSESTRQYCCAWCGEEARRTIPGGCEGIPNKLGR"
FT   gene            complement(181308..182273)
FT                   /locus_tag="Aazo_0190"
FT   CDS_pept        complement(181308..182273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0190"
FT                   /product="light-dependent protochlorophyllide reductase"
FT                   /EC_number="1.3.1.33"
FT                   /note="TIGRFAM: light-dependent protochlorophyllide
FT                   reductase; KEGG: cyc:PCC7424_4969 protochlorophyllide
FT                   oxidoreductase; PFAM: short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62816"
FT                   /db_xref="GOA:D7DYJ3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR005979"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYJ3"
FT                   /inference="protein motif:TFAM:TIGR01289"
FT                   /protein_id="ADI62816.1"
FT                   /translation="MEQNRQSTVVITGTSSGVGLQAAKALAQTGQWQVVMACRNLSKAE
FT                   EAAQSVGIRQGSYTIIHLDLASLDSVRQFVKDFRATGRSLDALVCNAAIYMPLIKEPLW
FT                   SPDGYELSVATNHLGHFLLCNLMLEDLKKSSASEPRLVILGTVTHNPNELGGKIPPRPD
FT                   LGDLKGFEAGFKAPYSMIDGKKFEPVKAYKDSKVCNVLTMRELHRRYHESTGITFSSLY
FT                   PGCVATTALFRDHYPLFQKLFPIFQKYITGGFVSEEEAGKRVAEVVADPAYNQSGMYWS
FT                   WGNRQKKNGKSFVQKVSNEASDEDKAERLWELSAKLVGLA"
FT   gene            183032..183784
FT                   /locus_tag="Aazo_0191"
FT   CDS_pept        183032..183784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0191"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: npu:Npun_F3746 TPR repeat-containing protein;
FT                   PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62817"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYJ4"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADI62817.1"
FT                   /translation="MVVRRCFIAWGFISFLIIGCGDLTISSTDITKQVVKESNVNQLLT
FT                   EVEDSQKAKTLLNQGNYLLDTNRYKEALTFYNQAIAIKTDNVETWVNRGNALIALHRYE
FT                   ESLESYEKAITIQPNKNEAWYNRGNALTALERYEEAVKAYNEAIAIQPNKDEAWINRGI
FT                   ALTKLRRYKEALASYNQAISIKPNLHQAYYNKACNYALQNNVELTIENLQKAIQLVPEK
FT                   YSNLAKTDSDFDQVRDEQQFQQILESKE"
FT   gene            complement(184054..184272)
FT                   /locus_tag="Aazo_0192"
FT   CDS_pept        complement(184054..184272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_01440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62818"
FT                   /db_xref="InterPro:IPR025349"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYJ5"
FT                   /inference="similar to AA sequence:KEGG:HCH_01440"
FT                   /protein_id="ADI62818.1"
FT                   /translation="MNNMVGMELICHDGTMLQITVKNKPKTFKEAFQLAIEQETIAPST
FT                   TIVPSISLSEYACALLKTDHWFLHERP"
FT   gene            complement(184523..184927)
FT                   /locus_tag="Aazo_0193"
FT   CDS_pept        complement(184523..184927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0193"
FT                   /product="photosystem II protein Psb27"
FT                   /note="TIGRFAM: photosystem II protein Psb27; KEGG:
FT                   ava:Ava_0578 photosystem II 11 kD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62819"
FT                   /db_xref="GOA:D7DYJ6"
FT                   /db_xref="InterPro:IPR017488"
FT                   /db_xref="InterPro:IPR025585"
FT                   /db_xref="InterPro:IPR038450"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYJ6"
FT                   /inference="protein motif:TFAM:TIGR03044"
FT                   /protein_id="ADI62819.1"
FT                   /translation="MDMKHYWSRLLALVLVVTLGLMGCSGTPDGLSGDYRQDTLAVVNT
FT                   LRQAIEVSPEDPNKAALQAEARQKINDFSARYQRVNSVSGLNSFTTMRTALNSLAGHYS
FT                   SYPNRPIPEKLKNRLELEFDRVELALKRGG"
FT   gene            complement(185021..186169)
FT                   /locus_tag="Aazo_0194"
FT   CDS_pept        complement(185021..186169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0194"
FT                   /product="7,8-didemethyl-8-hydroxy-5-deazariboflavin
FT                   synthase, CofH subunit"
FT                   /note="KEGG: npu:Npun_R6205 radical SAM domain-containing
FT                   protein; TIGRFAM:
FT                   7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH
FT                   subunit; PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62820"
FT                   /db_xref="GOA:D7DYJ7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019940"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYJ7"
FT                   /inference="protein motif:TFAM:TIGR03551"
FT                   /protein_id="ADI62820.1"
FT                   /translation="MTNITVDTILDRSLLGFNISPSEAVVLLKQTDPQAVNSIRVTADQ
FT                   LRQKQAGETVTYVINRNINFTNICEQHCSFCAFRRDDGDTDAYWLNWAQILEKSTDAVR
FT                   RGATEICMQGGLYPEAQINGKSLPYYLNLVETIKQKFPKLHIHAFSPQEVQFIARLDGI
FT                   SYTEVITALRDGGVGSMPGTAAEVLDDEVRRVLCREKIDTATWLEIVSTAHKLGVPTTS
FT                   TMLSGHIETPEQQIGHLEKLRSLQQTAIEQGYPAKITEFILLPFVGQEAPKSLRRRVGR
FT                   DQPVLADALLLTAVARIFLGNFIPNHQPSWVKLGLAGATEALTWGCNDIGGTLMEEHIT
FT                   TMAGAIGGTCMEVETLQSAIASLNRPYQQRNTLYEGVGGLGG"
FT   gene            186194..187765
FT                   /locus_tag="Aazo_0195"
FT   CDS_pept        186194..187765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all4128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62821"
FT                   /db_xref="GOA:D7DYJ8"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYJ8"
FT                   /inference="similar to AA sequence:KEGG:all4128"
FT                   /protein_id="ADI62821.1"
FT                   /translation="MNKLKATAPLFIILSGVIFSLYLRSQVPDDIYFSSDGGLKALLAK
FT                   QLSSGNLRFDLNLQVPPWVHNIWDSGLYPFEPPFSYKISNLYYITFPFTFPLVTAPFYA
FT                   IFGYRGFYIIPLISAWIIWVNYYRLCQSFKLDNFMISLGLITLIFASPLTMYSGMYWEH
FT                   TLAVALAFSGLVMIFSDRENQFTNKAAILSGMLIGLSVWFRPEFLALVAILIILITASF
FT                   IMKFDLITIIKNKRTIFLASLILTILCFFILNKIIYNNPLGAHAFQVVENFSLSDRLLK
FT                   SCRFFNELKNNLLKHFPIIYFGLAICFISIFKTNLRLKTASKQILLISFLFLLIVPILI
FT                   PSDGGKQWGSRFLLIIIPLVNVIAISGLEKTWRIQQFGIRYISTGILAVLFILGFNINI
FT                   IEGTETSYQKDKKENIELLDFLRKDSNKIVAVANQYVGQSFEATFKQKIFFLTKKPEDL
FT                   SKLALALNEQGYKTFLYVCPFYDKCFSSPTIPDQVKLVRKQKRLTIQLRKIKENKRYRI
FT                   EEATIF"
FT   gene            187787..189478
FT                   /locus_tag="Aazo_0196"
FT   CDS_pept        187787..189478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all4127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62822"
FT                   /db_xref="GOA:D7DYJ9"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYJ9"
FT                   /inference="similar to AA sequence:KEGG:all4127"
FT                   /protein_id="ADI62822.1"
FT                   /translation="MKTNLPSNYLKQILSVEKLSLIAIAIAVIIRIINLGTREFWYDEV
FT                   LSLLLSTSQNGVYKTPGDAPVILAEYTSLLSLPKEVSLGNVIQTITLLIKSLLGGEPHP
FT                   PIFFLSQHFWLRLLGNREAAMRSLNTLLSVVSIGGAYGLGKFFLGHRGGLFFAALVAIS
FT                   PFYLFHSLNLRMYAPLVLWVILSTWSLLYLIEQQNPDISQGCPSKLLWNGLLIISITAG
FT                   LMTFYLYAYWLIVLGVLVLYLDRRNSFQHALRLGTGVLLTIPWVLWGTIKQLHNADLDR
FT                   FGKAKSTLPPLLRHLQDFTNTLGTDILIGDWATSLDPIIISLSGCLVILVFVGFSIHLW
FT                   KQNEKQKLGTVLILGILPILLGLIVDIVTKKFTLGSGFGRTFIIMLPGCLLLIALWVEK
FT                   AVSKQWCLLVTGGILLMYLTISIGDLSLRHRSVFRSVAELIAKDVNKPTLIAMNSKAWG
FT                   HVNRLAYYIPTDYPVMLLSDYPGDLATHLEKVIKEEPGRYARIIWLNSGDPLWSPLKTE
FT                   MEIKRKEQKTEQILSSEFQLKETKNLSGTMKLDEFTAKLYTVSSKN"
FT   gene            189644..190885
FT                   /locus_tag="Aazo_0197"
FT   CDS_pept        189644..190885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0197"
FT                   /product="Dolichyl-phosphate beta-D-mannosyltransferase"
FT                   /EC_number="2.4.1.83"
FT                   /note="KEGG: ana:all4126 dolichol-phosphate
FT                   mannosyltransferase; PFAM: glycosyl transferase family 2;
FT                   GtrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62823"
FT                   /db_xref="GOA:D7DYK0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYK0"
FT                   /inference="protein motif:PRIAM:2.4.1.83"
FT                   /protein_id="ADI62823.1"
FT                   /translation="MNANSSNSLLVVPTGALKISEHPLTDFHRDNPILLSLVIPTYKER
FT                   NNIENIVNILSRLLDEAIPGNYELIIVDDDSPDLTWELAQSLLPDYPQLRVMRRQEEWG
FT                   LSSAVIRGWQVATGRILGVIDGDLQHPPEVLIQLLQKIEEGADLALASRHVDGGGVSSW
FT                   TIIRRFLSRGAQVLGLIILPGVLGRVTDPMSGYFMVRRSAIAGATMNPVGYKILLEVIG
FT                   RGQVREIAEAGYIFRERTEGESKVTWKQYVEYIQHLIRLRVSTGRLGKISQKVNFPVGR
FT                   FIRFGVVGFSGVFVDMAVLYLLSDPSTLALPLTRSKIISGEVAIFNNFLWNDAWTFADV
FT                   SMQQKGWNQTIKRFLKFNVICLAGLVLNVVVLNIVFNLLIPNRYIANLIAIAVATIWNF
FT                   WVNLKLSWRVTDVK"
FT   gene            complement(190891..191427)
FT                   /locus_tag="Aazo_0198"
FT   CDS_pept        complement(190891..191427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0198"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   KEGG: npu:Npun_F1603 exonuclease, RNase T and DNA
FT                   polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62824"
FT                   /db_xref="GOA:D7DYK1"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYK1"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /protein_id="ADI62824.1"
FT                   /translation="MVINLEATCSDKHTFYRHEMETIEIGAVILNRQTWEIDSEFQQFI
FT                   KPVRNPILTDFWRNLTTISQKQVDTAPQFPEVMPKLAEWMSSFPNDIFCPGGNYDKTQF
FT                   LQYCKFHNIPYPFGPEHRNIKKQFSEYLGVYNKFGMAQALQHLGMELKGTHYRGIDNAH
FT                   NIAVIYRYMQTNRKG"
FT   gene            complement(191449..191733)
FT                   /locus_tag="Aazo_0199"
FT   CDS_pept        complement(191449..191733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62825"
FT                   /db_xref="GOA:D7DYK2"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYK2"
FT                   /inference="similar to AA sequence:KEGG:Ava_1212"
FT                   /protein_id="ADI62825.1"
FT                   /translation="MLSAGIAGLSGFLFGVTYRYIIHVDKNPQLKSSAALAFGLVRGLN
FT                   QIEFGWNLNNTLLPFLILAGESIFWFVLAAFVLDTAILLNWLKPFSSRF"
FT   gene            complement(191727..191900)
FT                   /locus_tag="Aazo_0200"
FT   CDS_pept        complement(191727..191900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_1212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62826"
FT                   /db_xref="GOA:D7DYK3"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYK3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62826.1"
FT                   /translation="MEMIAEERLESLKAGLIGGLSAGLAFLITTVVNGLLLNQYFSILN
FT                   INQFQLINLQFC"
FT   gene            192002..192088
FT                   /locus_tag="Aazo_0201"
FT   CDS_pept        192002..192088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0201"
FT                   /product="PetN family protein"
FT                   /note="PFAM: PetN family protein; KEGG: ava:Ava_1211a
FT                   cytochrome b6f complex subunit PetN"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62827"
FT                   /db_xref="GOA:D7DYK4"
FT                   /db_xref="InterPro:IPR005497"
FT                   /db_xref="InterPro:IPR036143"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYK4"
FT                   /inference="protein motif:PFAM:PF03742"
FT                   /protein_id="ADI62827.1"
FT                   /translation="MILTLGWVSLLVVFTWSISMVVWGRNGL"
FT   gene            192096..192257
FT                   /locus_tag="Aazo_0202"
FT   CDS_pept        192096..192257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asl4262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62828"
FT                   /db_xref="GOA:D7DYK5"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYK5"
FT                   /inference="similar to AA sequence:KEGG:asl4262"
FT                   /protein_id="ADI62828.1"
FT                   /translation="MESPYLIILALMAIVLLVGVTGGVVYLTLADWRDRRRREDETREL
FT                   KRSTAKRR"
FT   gene            192279..195065
FT                   /locus_tag="Aazo_0203"
FT   CDS_pept        192279..195065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0203"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="KEGG: npu:Npun_R1597 GAF sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; GAF domain protein; SMART: GAF domain protein;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62829"
FT                   /db_xref="GOA:D7DYK6"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYK6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADI62829.1"
FT                   /translation="MFYGLKNLFVGMGLRAYPHIFILYKHNTQTNIEYLLLPYRRIILT
FT                   TLWGMIQPTSQKEYQPGMIFSLDQSEKQKALSRVIARIRESLDIETIFKITVTEVRQLL
FT                   NTDRVGVFRFYPDLEWEGEFLYEDVGTEWISILATKLHDHCFAEEFTELYQEGRIKAIS
FT                   DIYEDVVTDCHVTMLEKFQVRANIAVPLMKCKDLWGLLCIHQCNNPRQWEASEIEFVQL
FT                   IAQHLGVALQQADYIEQMKLQSAQLAQAKAREKAAEWQKTIARTIEKIRQSLDLESIFR
FT                   TTTEELRQLLNSDRVSIYRFNPDWSGDFVFESITSGWVTLMQEQLQRPELRDNISNCNL
FT                   KELVEPPTDTYLQDTGGGQFAKGEIYRICNDIYSAGFNECYIKILESYQARAYVIVAIL
FT                   YNHKIWGLLAVYQNTGTRDWQEDEIYLLTQVSSQLGVALQQAESLKQMQVQAQKLAKAA
FT                   ERERKAAEREKALAATVEKIRQSLDLNTIFATSTQEVLRLLEVDRVTIYRFRPDGSGEF
FT                   VAESLAYGWKSVQELVPVIADDYLRLIPREDSTNGKIIVVNDTSATNIPIPHIALITPT
FT                   ETRAYMIVPIFQGEKLWGLLAAYQHSQTRDWQKDEVDLLVQIGSQLGVGLQQAELLGKT
FT                   QRQKEEITQTLKELQATQSQLIQSEKMAGLGQLVAGLAHEINNPISFIYGNIPYVTNHM
FT                   EDLLNLVCLYHKNHPQSTQEIAQQTADIDLDFIADDLPKMLNSMMIGANRIRELVLSLR
FT                   TFARLDEAEKKPLDLHEGIDSTLLILQNRLQPQGDFPAIEIVKEYGNLPQVFCYGAQMN
FT                   QVFMNIINNAIWALEQSLADSRLTDKPKIWIRTQVTDRNYILIWIADNGCGIKKGMESR
FT                   IFEPFFTTKEPGQGTGLGLSISYQIIVEKHGGQINCVSEPGKGCELWIEIPMTENRA"
FT   gene            195135..195344
FT                   /locus_tag="Aazo_0204"
FT   CDS_pept        195135..195344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cyn:Cyan7425_1366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62830"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYK7"
FT                   /inference="similar to AA sequence:KEGG:Cyan7425_1366"
FT                   /protein_id="ADI62830.1"
FT                   /translation="MKRYMPLILIGVILFVAGGDKVFPGAVGKVSTQTRTSVNNFLIGR
FT                   FPSWKPKTNPYKRTERELQETEQK"
FT   gene            complement(195357..195461)
FT                   /locus_tag="Aazo_0205"
FT   CDS_pept        complement(195357..195461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62831"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYK8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62831.1"
FT                   /translation="MFDTLVNYQTGMFAVSLKKLTADSCLLSVPLGIS"
FT   gene            195666..196151
FT                   /pseudo
FT                   /locus_tag="Aazo_0206"
FT                   /product="hypothetical protein"
FT   gene            196442..197065
FT                   /locus_tag="Aazo_0207"
FT   CDS_pept        196442..197065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0207"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="KEGG: ava:Ava_4633 anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62832"
FT                   /db_xref="GOA:D7DYK9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYK9"
FT                   /inference="similar to AA sequence:KEGG:Ava_4633"
FT                   /protein_id="ADI62832.1"
FT                   /translation="MGTKLTEALLAQQEIPAGYLNIMGYVDKSEVNGPGCRAVVWVQGC
FT                   PRECAGCFNPDSWTFEINQLVAIDSLGADILKNPHNTGVTFSGGEPFWQASALANLARK
FT                   VKVAGLNVMAFTGFTLKQLQSESAPPGSEELLEQLDILIDGPFVESQAINSPLSPVSSR
FT                   NQQVHVFNPEFKDQITWASDQIEVHVLKDGDRIVTGYQGWLELT"
FT   gene            197160..197564
FT                   /locus_tag="Aazo_0208"
FT   CDS_pept        197160..197564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0208"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ava:Ava_0064 signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62833"
FT                   /db_xref="GOA:D7DYL0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYL0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADI62833.1"
FT                   /translation="MSSLFATEAITWCQQEIPDIILLDFLLPDGDGLELVVGFRHKFSN
FT                   SQSSIIMLKGEGDEMIAVSAMKSCVQDYLIKGQLTAQILQRGIHQIVERMYLSRQIEQS
FT                   REQQQIIAAAALRIRQSLQVEEIHSTCNSH"
FT   gene            complement(198391..198921)
FT                   /locus_tag="Aazo_0209"
FT   CDS_pept        complement(198391..198921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: TPR Domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62834"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYL1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62834.1"
FT                   /translation="MSQAFEICYWWENLSKPGYCVEMVDATRVFISLNYFFSIYEEEFV
FT                   IHIQEYDACFDLRPDLSTIFEDIPVVLKQLTTDTKSPVEFDFFEQGTAVGMLMERQGDK
FT                   ITIRFEITPGSGEKFQFLPDTGIPVTSDEFIGQWLQFVRFVLDALVDLQPDIVNDESYQ
FT                   EYRTRLDIIKSSK"
FT   gene            complement(199276..199698)
FT                   /locus_tag="Aazo_0210"
FT   CDS_pept        complement(199276..199698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62835"
FT                   /db_xref="GOA:D7DYL2"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYL2"
FT                   /inference="similar to AA sequence:KEGG:Ava_4627"
FT                   /protein_id="ADI62835.1"
FT                   /translation="MMINYREKIIALWTVFLLGILFHTQLGLMPLFHGLSVVESQKAAS
FT                   INELSGIFWLMLGFFMLPMLAIVGTAFTENKLYRVTHFGLTIFYGIMNLMHLVLDLLLP
FT                   HILWYQIGLMAFLFLIGLLLIFVAYQWMKSPLSRAC"
FT   gene            complement(199711..200193)
FT                   /pseudo
FT                   /locus_tag="Aazo_0211"
FT                   /product="hypothetical protein"
FT   gene            200818..200943
FT                   /locus_tag="Aazo_0212"
FT   CDS_pept        200818..200943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0212"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: npu:Npun_R5277 DNA methylase-type I
FT                   restriction-modification system"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62836"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYL3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62836.1"
FT                   /translation="MGVEKAIQADETTATAWINQQLVALGMSKLPSEEIIMNIAQ"
FT   gene            200950..201435
FT                   /pseudo
FT                   /locus_tag="Aazo_0213"
FT                   /product="hypothetical protein"
FT   gene            complement(201577..204474)
FT                   /locus_tag="Aazo_0214"
FT   CDS_pept        complement(201577..204474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0214"
FT                   /product="beta-phosphoglucomutase"
FT                   /note="KEGG: ava:Ava_3752 HAD family hydrolase; TIGRFAM:
FT                   beta-phosphoglucomutase; beta-phosphoglucomutase family
FT                   hydrolase; HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; PFAM: glycoside hydrolase family 65 central catalytic;
FT                   glycoside hydrolase family 65 domain protein; Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62837"
FT                   /db_xref="GOA:D7DYL4"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010972"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYL4"
FT                   /inference="protein motif:TFAM:TIGR01990"
FT                   /protein_id="ADI62837.1"
FT                   /translation="MENKRDFIYTDWVLIENQFNPDELHTRETIFTIGNGYLGTRGSFE
FT                   ESYPRTLSATFIHGVYDDVPVVYTELANCPDWLPLVVMIDSERFRLDQGKILEYNRKLD
FT                   LHQGILSRYLRWRSPTGKTIDISFERFASLAENHVLGQRCQLTTIDFHGFIEIQASING
FT                   YPENKGFNHWEKLDQGKIDKGFWLHSRTRYSRIDLGMAAKMTISGIETAMQVNTAPGYP
FT                   SISTTFFSEPQQTVTIEKIATVFTSRDVEQPVSAAQEKLDQLPDYITLSNANEQAWAEV
FT                   WDKSDITIEGDNTATFAVRYNLFQLIIAAPRDDDRVSIPAKTLSGFGYHGHIFWDTEIF
FT                   ILPFFTFTQPALARNLLSYRYHSLNGARRKATHYEYQGAMYAWESAVTGDEVTPRWSLP
FT                   SDYYAEDVRIWCRDREIHISAVITYAVWYYWQVTGDDEWLRDYGAEIILDTAIFWNSRV
FT                   EFNPQAERYEIRNVIGADEYHELVHNNAFTNRLVQWHLEKACIVDDWLRRHVPEKATEL
FT                   EKKLQLTDEIRNHWLEIINKIWIPYNPETGLIEQCEGFFQLDDINLADYEPRQKSIQSI
FT                   LGIEGTNKRQVLKQPDVLMLLYLMRKNAVFPYNLKTLQVNWDYYAPRTDITYGSSLGSA
FT                   IHAILAADLGQTQEAYERFMQAAMVDLADRRGNTSDGIHGASAGGIWQAVVFGFGGIQF
FT                   TDSQPVANPHLPPHWTRLKFKLYWHGKWQDFDLHQELGTGNGRRNPATAIRGMIFDLDG
FT                   VLTDTAQYHYLAWQRLANEEGIPFNRQANEALRGISRRASLMLIIGDRRYSEVQIQEMM
FT                   ERKNDYYVELIQRITPKDLLPGAVSLLDDLRQARLKIAIGSASKNARVVIEKLGIGNKI
FT                   DAIADGYSVQKPKPAPDLFLFAAQQLGLSPQQCVVFEDAAAGIDAALAASMWAVGIGPP
FT                   VRVGTAHIVVPSLAGVTWENLQGKFRDIALQKLRN"
FT   gene            complement(204556..206985)
FT                   /locus_tag="Aazo_0215"
FT   CDS_pept        complement(204556..206985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0215"
FT                   /product="sucrose synthase"
FT                   /EC_number="2.4.1.13"
FT                   /note="TIGRFAM: sucrose synthase; KEGG: npu:Npun_F4951
FT                   sucrose synthase; PFAM: sucrose synthase; glycosyl
FT                   transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62838"
FT                   /db_xref="GOA:D7DYL5"
FT                   /db_xref="InterPro:IPR000368"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR012820"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYL5"
FT                   /inference="protein motif:TFAM:TIGR02470"
FT                   /protein_id="ADI62838.1"
FT                   /translation="MYELFQAVLTSDEKTALRQFLLILHDFDKCYFLRNEILQAFTNYC
FT                   HQSEKPTYFYHSSSLGTLIHYTHEIIIEDENTWFVVRPRIASQEVWRLTADFTHFDLMT
FT                   PKAFLDVSDRLVNRYQPHILEIDLHPFYQTSPRISDPREIGQGLTFLNHYLCNQFVSDP
FT                   QYWLETFFQALQGIQFNGMKVLISDRIHSGIQFAKLIKPAITLLSELPPDEPYAQFRSH
FT                   LQELGLEAGWGNNAGRVRETLELLQRLIDTPQTYILEAFVARIPAVFRVVLISIHGWVA
FT                   QEDVLGRDETLGQVIYVLEQARSLENKLQQEIKLAGLDFLGIKPHVIILTRLIPNCEST
FT                   FCDLRLEKVHNTENAWILRVPFRDFNPEIINNWISKFEIWPYLEKFAQDAERELLTEFS
FT                   GKPDLIVGNYSDGNLVASLLSSSLKIPQCNIAHSLEKPKHLFSNLYWQDLDEKYHFSAQ
FT                   FTADLISMNAADFIVASSYQEIVGTPDTMGQYESYKCFTMPQLYHVVDGIDLFNPKFNM
FT                   IPPGVSETLFFPYSQTEDRNPQESQKIKDLLFQQQDDHILGNIDDIHKRPIFAVAPVTS
FT                   IKNLTGLVECFGKSQELQTRCNLILLTSNLSVNEATYPEEAGEIDKLHNLIKEHHLQGK
FT                   IRWLGMRLPSQKIGEAYRIIADYQGIYIHFALYEAFGRSILEAMISGLPTFATKFGGSS
FT                   EILEDLQTGFHLNPTNLERTAKTILNFLDKCDANPEYWQETSQWMIQRIRHKYNWESYT
FT                   EQLLLIAKIFSFWNFIVPEANDARDRYMEILFHLIYKPRAEQIIGQHQQRYAHIYK"
FT   gene            complement(207977..208081)
FT                   /locus_tag="Aazo_0216"
FT   CDS_pept        complement(207977..208081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62839"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYL6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62839.1"
FT                   /translation="MFEKLVNYQTGVSGVSLTKLTADACSRSVPLGIS"
FT   gene            208461..208754
FT                   /locus_tag="Aazo_0217"
FT   CDS_pept        208461..208754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0217"
FT                   /product="heterocyst formation protein HetP-like protein"
FT                   /note="KEGG: npu:Npun_R4950 heterocyst formation protein
FT                   HetP-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62840"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYL7"
FT                   /inference="similar to AA sequence:KEGG:Npun_R4950"
FT                   /protein_id="ADI62840.1"
FT                   /translation="MNYRISPSQTNVQNLITPEELNQVLEAVADGRYSWACVLILRFIG
FT                   YNPLHYIPQRTYSRLMKENSQIEIASASTNKPKLHPVNSSHCVPSSQIYSTN"
FT   gene            complement(209237..209620)
FT                   /pseudo
FT                   /locus_tag="Aazo_0218"
FT                   /product="hypothetical protein"
FT   gene            209675..209893
FT                   /locus_tag="Aazo_0219"
FT   CDS_pept        209675..209893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0219"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62841"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62841.1"
FT                   /translation="MMTFFSRLVLQLNVLNVDFLYTLDRMLPKNSGVRIQESECLRNLL
FT                   IIKQPSAVSLKKLTADGCLRSVRLGIS"
FT   gene            210381..217494
FT                   /pseudo
FT                   /locus_tag="Aazo_0220"
FT                   /product="hypothetical protein"
FT   gene            214000..215076
FT                   /pseudo
FT                   /locus_tag="Aazo_0221"
FT                   /product="hypothetical protein"
FT   gene            215207..216869
FT                   /pseudo
FT                   /locus_tag="Aazo_0222"
FT                   /product="hypothetical protein"
FT   gene            217846..218884
FT                   /pseudo
FT                   /locus_tag="Aazo_0223"
FT                   /product="hypothetical protein"
FT   gene            218991..220067
FT                   /pseudo
FT                   /locus_tag="Aazo_0224"
FT                   /product="hypothetical protein"
FT   gene            complement(220142..224398)
FT                   /locus_tag="Aazo_0225"
FT   CDS_pept        complement(220142..224398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0225"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold-3 domain protein;
FT                   CBS domain containing protein; PAS fold domain protein;
FT                   histidine kinase A domain protein; response regulator
FT                   receiver; KEGG: npu:Npun_F4948 multi-sensor hybrid
FT                   histidine kinase; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS domain
FT                   containing protein; CBS domain containing protein; PAC
FT                   repeat-containing protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62842"
FT                   /db_xref="GOA:D7DYL9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYL9"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADI62842.1"
FT                   /translation="MQFNDHLIDLPSLHKVIDRYPLTISPDSHVIEAINLMNQEENHSC
FT                   NLYNVARSLLRSKQQKKVNSYILIVQQGQLLGIFTLADVLKLIALNMDLAKTTMVEVMT
FT                   QPVITLKLSDLDHISTVLYFLQQYSVQDLPIVDDEGNLVGIINESSLLHELDLVKVVGV
FT                   VEAVNQTLTNITNQSPENYQQREKVSGKTDNLLKTWIEEKIAKEIQINEELQQTLEELQ
FT                   IIKEELRQQNKQLATAREITESERRRYQDLFEFTPNGFLVTDKLGVIQEANHAASSLLC
FT                   VHQKYLVGKPITIFLGQSDRHNVLSHLSLSQHFQEWEIYIQPREGVPFPASIRLRAVYD
FT                   RQGQWLGWCWLICNISVQKQAEKTLRRSSDELEQRVAERRRELIVANQALEQEIKERKE
FT                   TQAALRKSEETFRQFAENLEAYIWICSQDCSTLFYINPAYEKIWGRSCQSLWENPLSWI
FT                   EAVHPEDLEPMMAEVEKQHQKGENISVQYRIIRLDGSIRWLWSRRFPIKNEQGQIQYYG
FT                   GIGEDITERKQTEAAVRESEYKFHQFADNIQAVVWIASVDCTENVYVNPAYEKFWGRSR
FT                   ASMGNNPKSWIEGVHPQDRDRVIAQIQSQKDNESGVLEYRVLRPDGSISWLWARRFTIK
FT                   NEQGQIQYFGGIAEDITEHKQTEAALKKTEEKFRYFTENSDTLIWMASKDSKETLYINP
FT                   AYEKIWGRSCQSLRENPQSWREAIHPEDRDRILAEIEEHHQKGEGANLEYRIVQPNGSI
FT                   RWIWGRCFPVKNEQGELDYYGSLTEDITDRKLAEESLRDSETRLTLALENANMGIWECN
FT                   LITDQCICSDNVGPLYGLPKGSVCPSSHEEFFNFFYPEDREFCIQAVKRAIEQEGEFAV
FT                   EYRVVWPDGSLHWLRGTGKVYHNQQGQPIRMIGTTRDISERKETEHQLYEQAALLDIAT
FT                   DAIFVRDFQTKILFWNQGAERIYGWQKHEAVGKNLKDLFCSKTTQQQESSALRTVVKLG
FT                   TWQGELRKKTKLGQEIIVESRWTLMFDADGQPKSILIVDSDITEKKQLEEQFFRTQRLE
FT                   SIGTLAGGIAHDLNNILTPILGAAQLLKGRFAKDEERHPQLLAIIENNAQRGAALVKQV
FT                   LSFARGLKGERGIVQVKHLIAEIIQIGKQTFPKSIEFTTQIPENLWTVSGDTTQLHQVL
FT                   MNLVVNARDAMPEGGTLTITTENIYIDEAYTRMLIESKIGNYIVITVTDTGVGMTKEIL
FT                   DRIFEPFFTTKEFKGGTGLGLSTALGILKSHNGFVTVSSQVGKGSTFKVFLPSVESPQV
FT                   PDIDQSKIPSGQGELILVVDDEPQIRDVATIILENHNYQTLTASNGVEAIVLYAQHKKN
FT                   ISAVLMDMMMPEMDGITAIRTLKKMNPKVQVIACSGLNTKDVFPESDEMEVQSVLFKPY
FT                   TANELLRNLNQIIRNS"
FT   gene            226086..227014
FT                   /pseudo
FT                   /locus_tag="Aazo_0226"
FT                   /product="hypothetical protein"
FT   gene            227112..229007
FT                   /locus_tag="Aazo_0227"
FT   CDS_pept        227112..229007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0227"
FT                   /product="MCP methyltransferase, CheR-type with PAS/PAC
FT                   sensor"
FT                   /EC_number="2.1.1.80"
FT                   /note="SMART: MCP methyltransferase CheR-type; PAS domain
FT                   containing protein; TIGRFAM: PAS sensor protein; KEGG:
FT                   npu:Npun_F0263 MCP methyltransferase, CheR-type with
FT                   PAS/PAC sensor; PFAM: MCP methyltransferase CheR-type; PAS
FT                   fold domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62843"
FT                   /db_xref="GOA:D7DYM0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYM0"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADI62843.1"
FT                   /translation="MTSPEKNLDFENLLMYIRQSRGFDFTGYKRSTLMRRIYKRMQSVN
FT                   LGSFTDYIDYLQVHPAEFNYLFNTILINVTAFFRDDSAWEYLGKQIIPNIMRCKKNGAQ
FT                   IRIWSAGCASGEEAYTLAMLIAEILGVEDFRQWVKIYATDVDEETLQQARQAVYSAKDI
FT                   QSIPLELRDKYFELVGESYVFRQDLRRSVIFGRHNLIHDAPISRIDLLVCRNTLMYFNS
FT                   EVQGQILARFHFALNDTGYLVLGKAEMLLMHANLFIPIELKNRIFTKVLSTNIRDRLLV
FT                   MANSTDDEPSNRFTQYLKLRELVFDTAQIAEIVININGLLVMLNEQARSLFSLSERDLD
FT                   RPFQDLEISYRPIELRSLIERSYNERRPITLTNIERYLSNTEKQYLDVRITPLQDTDLS
FT                   FLGVTITFHDVSRYLKLQEALQRYQQDLETTNEELQSTNEELETTNEELQSTNEELETI
FT                   NEELQSTNQELETMNEELQSANEELQTINYEFSQRTLELNRTNIFIISILKSLQTGMVV
FT                   IDKSFSILIWNHLLEDLWGLRTEEVIHKSLFSLDIGLPVEKLRSPIRDFLFGKQQFQEM
FT                   ILDAINRRGKPIRCYIAITPLMDREIEGVVLIMVDIEKMKSMISAQEIEARRQQH"
FT   gene            229388..229609
FT                   /locus_tag="Aazo_0228"
FT   CDS_pept        229388..229609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4571 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62844"
FT                   /db_xref="InterPro:IPR025477"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYM1"
FT                   /inference="similar to AA sequence:KEGG:Ava_4571"
FT                   /protein_id="ADI62844.1"
FT                   /translation="MDTTIKYDIEVIQEEARQLARKGLVNRQQPIFTLFKYIPDREWAY
FT                   FEHELENNEYLLRDRIIDLLASEKWEED"
FT   gene            complement(229811..230005)
FT                   /locus_tag="Aazo_0229"
FT   CDS_pept        complement(229811..230005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R4947 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62845"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYM2"
FT                   /inference="similar to AA sequence:KEGG:Npun_R4947"
FT                   /protein_id="ADI62845.1"
FT                   /translation="MNYCPCCSDLLLQHIRRSETYWFCRTYWQEMPVVKRHLSSSLSET
FT                   ILGKVPRKPHKHSFLGGFK"
FT   gene            230332..232773
FT                   /pseudo
FT                   /locus_tag="Aazo_0230"
FT                   /product="hypothetical protein"
FT   gene            complement(232889..233447)
FT                   /pseudo
FT                   /locus_tag="Aazo_0231"
FT                   /product="hypothetical protein"
FT   gene            complement(233860..234108)
FT                   /locus_tag="Aazo_0232"
FT   CDS_pept        complement(233860..234108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F2424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62846"
FT                   /db_xref="InterPro:IPR021495"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYM3"
FT                   /inference="similar to AA sequence:KEGG:Npun_F2424"
FT                   /protein_id="ADI62846.1"
FT                   /translation="MSQEFPIGSKVRVIALPPYIKTADPMPMLRPPDIISIGEEGIVLD
FT                   RRPGGYWGVRFTRGAFLIDSQYIESTEHPPESQPDSE"
FT   gene            234247..235605
FT                   /locus_tag="Aazo_0233"
FT   CDS_pept        234247..235605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0233"
FT                   /product="MATE efflux family protein"
FT                   /note="KEGG: amr:AM1_0362 DNA-damage-inducible protein,
FT                   putative; TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62847"
FT                   /db_xref="GOA:D7DYM4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYM4"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ADI62847.1"
FT                   /translation="MPDVLLSRYDFLPRFYRLASVSVFSNMMVPLAGLVDIAFLGHLQD
FT                   IRHLAGVILGTILFDYLYRVLKFMRSSTNTLTAYAVGLDEPKAVLLAGLRSGLIALIVS
FT                   LLILLLQYPIQKFGFFLLSGSPDIEASGVDYFYGRIWGAPAVLLNFVLFGWFLGREKNG
FT                   VVLLMSIVGNGSNVLLDYLMIVKWGWESAGAGLATALSQYLALIIGLIGVALSIEWQAL
FT                   PAAVSEIFDWVSLKETFALKSNILIRYVSLISAYSIFTNLSAVMGTNILAENGLLLQIA
FT                   FLSQFAVQGVGMTIQTLTGNFKSKGNGQQMMPLLTVSMLAALAIALVFAFVSIIFPEQV
FT                   FGLLTNHQEVNDSITIYTIWLLPVLAITAIAFILEGYFIGLKEGTSLRNAVLMAFFVGF
FT                   IPLAIAAWYFQNNHLLWATIVSYMTTIMIALALKLPQTLNHQNLEKQKSLANS"
FT   gene            complement(235714..236193)
FT                   /locus_tag="Aazo_0234"
FT   CDS_pept        complement(235714..236193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0234"
FT                   /product="protein of unknown function Spy-related protein"
FT                   /note="PFAM: protein of unknown function Spy-related; KEGG:
FT                   npu:Npun_F2422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62848"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYM5"
FT                   /inference="protein motif:PFAM:PF07813"
FT                   /protein_id="ADI62848.1"
FT                   /translation="MKGKTLLFIAAAFALTLTATPLVAQVQKTVPSGQAGQGFAEKGPW
FT                   KKLGLTYTQKTEIQRIHHNTRAEMDKVLTTEQKEQLKAAMQERQTQRSQGEGRGKWKKD
FT                   IFTSLNLTDAQKSQIQEIRELSRKQMEAVLTPAQRQQLQQMEQNWKSRRQQGNSN"
FT   gene            236420..237628
FT                   /locus_tag="Aazo_0235"
FT   CDS_pept        236420..237628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0235"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: ava:Ava_2027 periplasmic sensor signal
FT                   transduction histidine kinase; SMART: ATP-binding region
FT                   ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62849"
FT                   /db_xref="GOA:D7DYM6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYM6"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ADI62849.1"
FT                   /translation="MSRPIQINNHPFRFLLYLEWILLVFSVLMVILPSPSPKFAAKFPE
FT                   LTICSLAFFGLMGLRLPTSNQFGKIIYTATEVFLILITGFLGGRTARLFPFLYLMLVTR
FT                   SCLIFQLPGRLTVTFSSFVLFLMTLKTRWMPNRLTPIVQERFRFFSFSLSVLFGLSLVF
FT                   VLLLMNAVLSERQSREKLGIANDKLRQYALKIETQATLEERNRIAREIHDSLGHSLTAL
FT                   NLQLETALKLSKSDIPRAMTFLTRAKELGSKALQDVRNSVSTMRSHPLQSQSLEQAIGI
FT                   LIEDFQRANGILPSCLVSLEYAIPTEMSIPIYRIIQESFTNISKYAQASLVQLELSTTD
FT                   KAVKLIVQDNGRGFDVTQNTTGFGLQSMRDRTLALGGAFTIKSAQNSGCQIIVDIPLAR
FT                   WKT"
FT   gene            237625..238281
FT                   /locus_tag="Aazo_0236"
FT   CDS_pept        237625..238281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0236"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: npu:Npun_R2420 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: response
FT                   regulator receiver; regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62850"
FT                   /db_xref="GOA:D7DYM7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYM7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADI62850.1"
FT                   /translation="MIKVLLTDDQSLIRQGLRALLELETDLEIVGEAENGEIAIHLVKQ
FT                   LQPDVVLMDIRMPIIDGVAATKTIQTHFPATKVLVLTTFDDDLYIKAALQNGAMGYLLK
FT                   DTPSEELAVAIRAVDKGFSQLSPEIVKKLLTQFPTTAPDPVKSIPPSLVELTPREKQVL
FT                   RLIANGASNREIAHTLYISEGTVKNHVTNILSRLNLRDRTQAAILANTFLSYLEQ"
FT   gene            238564..238719
FT                   /locus_tag="Aazo_0237"
FT   CDS_pept        238564..238719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62851"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62851.1"
FT                   /translation="MVINETLTTHSGVRFKILIMSGSSQYIAKNIFFYFISMKCYLALA
FT                   KNIDIY"
FT   gene            239180..239552
FT                   /pseudo
FT                   /locus_tag="Aazo_0238"
FT                   /product="hypothetical protein"
FT   gene            239829..240035
FT                   /locus_tag="Aazo_0239"
FT   CDS_pept        239829..240035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tel:tlr1991 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62852"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62852.1"
FT                   /translation="METMRLIVTVSVGAGKSTFIRSVSEIEVVDTDTRATDETALLKQR
FT                   SNTHRLSRCMVRGRCIPCHWIRE"
FT   gene            240280..240732
FT                   /pseudo
FT                   /locus_tag="Aazo_0240"
FT                   /product="hypothetical protein"
FT   gene            240733..240906
FT                   /locus_tag="Aazo_0241"
FT   CDS_pept        240733..240906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: maq:Maqu_4248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62853"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYN0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62853.1"
FT                   /translation="MYATEESLSTSTATLTFPEAVQETLPAIKATEKPAEKPTVSQSFL
FT                   KDLVGFLRSKAA"
FT   gene            240991..241540
FT                   /pseudo
FT                   /locus_tag="Aazo_0242"
FT                   /product="hypothetical protein"
FT   gene            complement(241649..241936)
FT                   /pseudo
FT                   /locus_tag="Aazo_0243"
FT                   /product="hypothetical protein"
FT   gene            242181..242972
FT                   /pseudo
FT                   /locus_tag="Aazo_0244"
FT                   /product="hypothetical protein"
FT   gene            242973..243296
FT                   /locus_tag="Aazo_0245"
FT   CDS_pept        242973..243296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btl:BALH_p0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62854"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYN1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62854.1"
FT                   /translation="MLEVIFKVSNVSNIFRSRLSYKGIAYRRQLEQTFSQLKQKIKQTS
FT                   FDTPSTFDYSLVVALFGIPALAGTSYDSLDKAFFPRTYSQVSSSSCSRSSSCSSGSSCG
FT                   GGD"
FT   gene            complement(243503..243829)
FT                   /pseudo
FT                   /locus_tag="Aazo_0246"
FT                   /product="hypothetical protein"
FT   gene            244016..244501
FT                   /pseudo
FT                   /locus_tag="Aazo_0247"
FT                   /product="hypothetical protein"
FT   gene            complement(244494..244946)
FT                   /locus_tag="Aazo_0248"
FT   CDS_pept        complement(244494..244946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0248"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: lbl:LBL_0855 response regulator of a two
FT                   component regulator; PFAM: response regulator receiver;
FT                   SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62855"
FT                   /db_xref="GOA:D7DYN2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYN2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADI62855.1"
FT                   /translation="MEDVDSKTVLYVEDDPPYVLLLKRALQRSKLEKLPKLWVVTTMED
FT                   AVRYLLGQIPYEDRFTNPLPSLLLRDLRLPRKSGIQLVQSVQAQLQFQHLPIVILTGTA
FT                   LDEDIVLAYQQGVNFCLVKPADVDSLISIILVLSVYSIPSPTKATI"
FT   gene            245453..245957
FT                   /pseudo
FT                   /locus_tag="Aazo_0249"
FT                   /product="hypothetical protein"
FT   gene            246282..253044
FT                   /pseudo
FT                   /locus_tag="Aazo_0250"
FT                   /product="hypothetical protein"
FT   gene            248748..250235
FT                   /pseudo
FT                   /locus_tag="Aazo_0251"
FT                   /product="hypothetical protein"
FT   gene            253181..253462
FT                   /locus_tag="Aazo_0252"
FT   CDS_pept        253181..253462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0252"
FT                   /product="protein of unknown function DUF427"
FT                   /note="PFAM: protein of unknown function DUF427; KEGG:
FT                   npu:Npun_R5645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62856"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYN3"
FT                   /inference="protein motif:PFAM:PF04248"
FT                   /protein_id="ADI62856.1"
FT                   /translation="MKATWNGAILAESNKTVVVEGNHYFPADTINKQYFRDSDTHTTCF
FT                   WKGVASYYNIEVDGQVNKDAAWYYPSTKEKAKNIEGYIGFWKGVKVEA"
FT   gene            253640..253837
FT                   /locus_tag="Aazo_0253"
FT   CDS_pept        253640..253837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62857"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62857.1"
FT                   /translation="MFRMTLLNKPFLVSIPSPEEQTQKEEVKQHKSAFHRCFEIYTTCH
FT                   SSSDTRSSDEAEPDLMGGYV"
FT   gene            complement(254459..254714)
FT                   /pseudo
FT                   /locus_tag="Aazo_0254"
FT                   /product="hypothetical protein"
FT   gene            complement(254781..256277)
FT                   /pseudo
FT                   /locus_tag="Aazo_0255"
FT                   /product="hypothetical protein"
FT   gene            complement(256445..258673)
FT                   /locus_tag="Aazo_0256"
FT   CDS_pept        complement(256445..258673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0256"
FT                   /product="photosystem I core protein PsaB"
FT                   /note="KEGG: ana:alr5314 photosystem I P700 chlorophyll a
FT                   apoprotein A2; TIGRFAM: photosystem I core protein PsaB;
FT                   PFAM: photosystem I psaA and psaB"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62858"
FT                   /db_xref="GOA:D7DYN5"
FT                   /db_xref="InterPro:IPR001280"
FT                   /db_xref="InterPro:IPR006244"
FT                   /db_xref="InterPro:IPR036408"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYN5"
FT                   /inference="protein motif:TFAM:TIGR01336"
FT                   /protein_id="ADI62858.1"
FT                   /translation="MAKRYPKFSQDLAQDPTTRRIWYASAQANDFEVHDDITEENLYQK
FT                   IFATHFGHVAIIFLWASSLLFHVAWQGNFEQWIRDPLHIRPIAHAIWDPHFGKPAIEAF
FT                   SQGGANYPVNIAYSGVYHWWYTIGMRTNQELYIGSLGFLLLAALFLFAGWLHLQPKFRP
FT                   SLTWFKSAEPRLNHHLAGLFGVSALAWTGHLIHVAIPASRGIHVGWDNFLTTLPHPAGL
FT                   TPFWTGNWGVYAQNPDTAGHIFGTSQGSGTAILTFLGGFHPETDSLWLTDIAHHHLAIA
FT                   VVFIIAGHMYRTNFGIGHSIKEMLNARSFFGIHTEGQFNLPHQGLYDTYNNSLHFQLSI
FT                   HLAALGTVTSLVAQHMYSLPPYAFMAKDYTTQAALYTHHQYIAGFLMIGAFAHAGIFWV
FT                   RDYDPEQNKDNVLDRVLQHKEAIISHLSWVSLFLGFHTLGLYVHNDVLVAFGTPEKQIL
FT                   IEPVFAQFIQAAHGKLLYGMDALLSNPNSIAFTAWPNHANVWLPGWLDAINSGTNSLFL
FT                   TIGPGDFLVHHAIALGLHTTTLICVKGALDARGTKLFPDKKDFGFNFPCDGPGRGGSCQ
FT                   TSSWQQTFFLAFFWMLNLLGWVTFYWHWKHLGIWQGNVAQFNENSTYLMGWFRDYLWAN
FT                   SAQLINGYNPFGTSNLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLVWAHERTP
FT                   LANLVYWKDKPVAMSIVQGWLVGLVHFTVGYVLTYAAFLIASTAGKLA"
FT   gene            259240..259863
FT                   /locus_tag="Aazo_0257"
FT   CDS_pept        259240..259863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0257"
FT                   /product="NADH-plastoquinone oxidoreductase, I subunit"
FT                   /note="KEGG: ava:Ava_2715 NADH dehydrogenase subunit I;
FT                   TIGRFAM: NADH-plastoquinone oxidoreductase, I subunit;
FT                   NADH-quinone oxidoreductase, chain I; PFAM: 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62859"
FT                   /db_xref="GOA:D7DYN6"
FT                   /db_xref="InterPro:IPR004497"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYN6"
FT                   /inference="protein motif:TFAM:TIGR00403"
FT                   /protein_id="ADI62859.1"
FT                   /translation="MFKFLQHIGDYVQNSVQAIQYIGQGLSVTFDHMNRRPITVQYPYE
FT                   KLIPSERFRGRIHFEFDKCISCEVCVRVCPINLPVVDWEFDQETKKKKLNHYSIDFGVC
FT                   IFCGNCVEFCPTNCISFTEEYDLCTYDRHELNLDNVAMGRLPYKVTDDPMVTPLRELVY
FT                   LPKGSLDPHGIPVDAHRAGLFPVEILEQAGEDSKDVNHESISNV"
FT   gene            complement(259872..260914)
FT                   /pseudo
FT                   /locus_tag="Aazo_0258"
FT                   /product="hypothetical protein"
FT   gene            261047..264306
FT                   /pseudo
FT                   /locus_tag="Aazo_0259"
FT                   /product="hypothetical protein"
FT   gene            complement(261587..263074)
FT                   /pseudo
FT                   /locus_tag="Aazo_0260"
FT                   /product="hypothetical protein"
FT   gene            264397..264495
FT                   /locus_tag="Aazo_0261"
FT   CDS_pept        264397..264495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62860"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYN7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62860.1"
FT                   /translation="MIFMLNLYYKKGDVITISFQRKVTLVRGDIQS"
FT   gene            264583..265146
FT                   /locus_tag="Aazo_0262"
FT   CDS_pept        264583..265146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr1001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62861"
FT                   /db_xref="InterPro:IPR025889"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYN8"
FT                   /inference="similar to AA sequence:KEGG:alr1001"
FT                   /protein_id="ADI62861.1"
FT                   /translation="MITQEAKRGLGVFAKTQELEQAIKQLKASGYPMEKVSIIGKDIKH
FT                   NSSLGEAQTSHQIGNQDVNTTVGVGDTLTSTTWANLLIGLSGLAIPSLGAILAAGSVGV
FT                   ALVASIAGVTVGVTANENLVRSLKDLGIPEDRARMYSDHLQQSYYLIILDGTDTEIDCA
FT                   EAILGQEGIQNWGVFNSLATPRVR"
FT   gene            265235..265372
FT                   /locus_tag="Aazo_0263"
FT   CDS_pept        265235..265372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62862"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62862.1"
FT                   /translation="MIMREFTLMPIQNYLDEYEKFLNYFFKLYQASFNYQLLLNDIYIN
FT                   "
FT   gene            265638..266654
FT                   /pseudo
FT                   /locus_tag="Aazo_0264"
FT                   /product="hypothetical protein"
FT   gene            complement(267153..267539)
FT                   /locus_tag="Aazo_0265"
FT   CDS_pept        complement(267153..267539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0265"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ava:Ava_1441 transposase IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62863"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYP0"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADI62863.1"
FT                   /translation="MYGFDGCKKVKGRKGQTLVDSLGLVLKVVISEANAPERIITAYAL
FT                   MELLEEPTELLEKVQVLWVDSGYDGDKFALAVWFMIQAHVEVIGPTEQEFKVLPQPWVV
FT                   ERTFGWFNQYHRLSKDYERLTQMR"
FT   gene            complement(267509..267892)
FT                   /pseudo
FT                   /locus_tag="Aazo_0266"
FT                   /product="hypothetical protein"
FT   gene            complement(268407..269672)
FT                   /pseudo
FT                   /locus_tag="Aazo_0267"
FT                   /product="hypothetical protein"
FT   gene            269767..270963
FT                   /pseudo
FT                   /locus_tag="Aazo_0268"
FT                   /product="hypothetical protein"
FT   gene            271043..271773
FT                   /pseudo
FT                   /locus_tag="Aazo_0269"
FT                   /product="hypothetical protein"
FT   gene            271978..272440
FT                   /pseudo
FT                   /locus_tag="Aazo_0270"
FT                   /product="hypothetical protein"
FT   gene            272455..273342
FT                   /locus_tag="Aazo_0271"
FT   CDS_pept        272455..273342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0271"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   npu:Npun_F0232 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62864"
FT                   /db_xref="GOA:D7DYP1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYP1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADI62864.1"
FT                   /translation="MQLKPINQQVVSVVGASSGIGRETALQFPRRGAKVVVSARRESGL
FT                   KSLVEEIGSFGSEATSIVADVQEFEQVNAIADKTVETFGRLDTWVHAPAVGLFATFDKT
FT                   TPAESKHVINVNLVGQAYGAMAALPHLKREGRGASIHISSMEGRRSLPYQSAYSTAKHG
FT                   IEGFVEAMRVELQHDKWPISLTSIKPAVINTPFWNNSLTKLGVKAAGITPYYDPKLVAD
FT                   AVPYAAEHSTRDLLVGDAAKTLDLLQRISPGLPDSLLLLIGFDLQHSSEPKSETHQITF
FT                   ISLFLLWLITMVVY"
FT   gene            273573..274628
FT                   /locus_tag="Aazo_0272"
FT   CDS_pept        273573..274628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0272"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="TIGRFAM: D-alanine/D-alanine ligase; KEGG:
FT                   ava:Ava_0360 D-alanyl-alanine synthetase A; PFAM:
FT                   D-alanine--D-alanine ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62865"
FT                   /db_xref="GOA:D7DYP2"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYP2"
FT                   /inference="protein motif:TFAM:TIGR01205"
FT                   /protein_id="ADI62865.1"
FT                   /translation="MSKLRVGLLFGGRSGEHEVSIISARGIANALSAEENSHKYEIMPF
FT                   YIQKDGFWQAGEVAQQVLTSGVAKEHPGNRANLWQFPPQTAEIDLWFPILHGPNGEDGT
FT                   IQALLTLMQVPFVGSGVLGSATGMDKIAMKTAFAQAGLPQVKYKALTRAQIWSNPCVFP
FT                   KLCDEIEATLGYPYFVKPANLGSSVGIAKVQSRQELEAALDNAATYDRRIIVEAGVVAR
FT                   EVECAVLGNDNPKASVIGEITFDSDFYDYETKYTQGKADLFIPAHLPESAVQQIQEKAL
FT                   QAFTAVDAAGLARVDFFYVEATGEILINEINTLPGFTSTSMYPQLWANTGISFPKLVDQ
FT                   LIQLAMERHSN"
FT   gene            complement(274845..275015)
FT                   /locus_tag="Aazo_0273"
FT   CDS_pept        complement(274845..275015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0273"
FT                   /product="transposase IS4"
FT                   /note="KEGG: ava:Ava_2576 transposase IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62866"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYP3"
FT                   /inference="similar to AA sequence:KEGG:Ava_2576"
FT                   /protein_id="ADI62866.1"
FT                   /translation="MNFADCRLFYAVLVDLGDAVADELSLACDEISLEMIYRRLDHFTM
FT                   AHQKGKATEES"
FT   gene            complement(275062..275259)
FT                   /locus_tag="Aazo_0274"
FT   CDS_pept        complement(275062..275259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0274"
FT                   /product="lrrA; putative protein"
FT                   /note="KEGG: lrrA; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62867"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYP4"
FT                   /inference="similar to AA sequence:KEGG:DDB_0215361"
FT                   /protein_id="ADI62867.1"
FT                   /translation="MAVPEPIFELTNLKKLKFSVKSGIHCVFSPKNGHLHQLQELEIVG
FT                   TFDHYQPDEIGEISGLEKVN"
FT   gene            complement(275635..275874)
FT                   /locus_tag="Aazo_0275"
FT   CDS_pept        complement(275635..275874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asl3966 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62868"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYP5"
FT                   /inference="similar to AA sequence:KEGG:asl3966"
FT                   /protein_id="ADI62868.1"
FT                   /translation="MTTGNGQSQQPITNLEYDFITILHNKAAAVQAYDRYIQDAQEANS
FT                   QPCVELFQKLRQSEIQEAQEIRHHLQQVMAQGRM"
FT   gene            complement(276042..276548)
FT                   /pseudo
FT                   /locus_tag="Aazo_0276"
FT                   /product="hypothetical protein"
FT   gene            complement(276755..277585)
FT                   /pseudo
FT                   /locus_tag="Aazo_0277"
FT                   /product="hypothetical protein"
FT   gene            277699..278655
FT                   /locus_tag="Aazo_0278"
FT   CDS_pept        277699..278655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0278"
FT                   /product="transposase"
FT                   /note="KEGG: ana:alr4628 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62869"
FT                   /db_xref="GOA:D7DYP6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYP6"
FT                   /inference="similar to AA sequence:KEGG:alr4628"
FT                   /protein_id="ADI62869.1"
FT                   /translation="MALKLVYQSYKYEEIQTILDISVGSITTWKQAYEKDGILGLRLKH
FT                   KGRKSHLNTRQREEVLAWLQTKECWELGELEYKLAFEYDVLYESKRSYYDLFDAAGISW
FT                   KKTSSANPKANEEAVAAKKEISSLLASRREDIEAGLLRVLLLDEYHLLWGDSIGYVWGR
FT                   TDQEISIPISKERDKQTYYGAVDYLGKNLLLKTYDTANSKNTIDYLSYLLEESPNQQLL
FT                   IFWDGASYHRSKEIQNFLASINQGLPLEQWKIYCVRFAPNCPSQNPIEDVWLQPKAWLR
FT                   RFCALIPTFSHLKWIFEWLIQNTTFDFPSLQMYGAFS"
FT   gene            279010..281040
FT                   /locus_tag="Aazo_0279"
FT   CDS_pept        279010..281040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0279"
FT                   /product="small GTP-binding protein"
FT                   /note="KEGG: npu:Npun_R5063 small GTP-binding protein;
FT                   TIGRFAM: small GTP-binding protein; PFAM: elongation factor
FT                   G domain IV; protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; elongation factor G
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62870"
FT                   /db_xref="GOA:D7DYP7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYP7"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ADI62870.1"
FT                   /translation="MNENVKSGSRNVAIVGPYLSGKTTLLESLLFVTGGISRKGNVKDG
FT                   NTVGDSANEARDRRMSVEVSAACTEYENTRFTFIDCPGSLEFAQETYNALIGVDAAIVV
FT                   CEPIRDRVLTLAPLFKFLDDWEIPHIVFVNKMDRANIHVLETLEALKAVSSRPLVAHQY
FT                   PIMQGEQLTGFIDMVSEQAYQYHAGAPADSIPFPEELKAEEHIARAEMLEALANFDDHL
FT                   LEELLEDIEPPQEEILKDLKLELGADLVVPVFFGVAEQDFGVRPLLEALLREAPEPETT
FT                   MERRLKTISDTPLAQVLKTFYTPQGGKLSLVRVWQGTLTDGIVLNGVRAGGLYRLMGQQ
FT                   QQQINQPVAGEIVAISRLEGIKTGETISTNSHLKELPKAEKLEPVFALAITPEKRNDEV
FT                   KLSAALSKLLEEDCSLAWEQHGDTHEVILWGQGEIHLQVALDRLRRKYNLPMSTHLPQV
FT                   PYKETIRKPVNSVHGRYKHQSGGHGQFGDVFLDIQPLPRGEGFNFKEKIVGGVVPRQYI
FT                   PCVEMGVREFLTHGPLGYPMVDVAVTLTNGSYHTVDSSEQAFKQAARLAMQTGIPQAQP
FT                   TLLEPILKVDVNTPSEFTSKVLQLLSGKRGQVLGYEGRQDWPAWDNVSAYLPQGEMQNF
FT                   IVELRSLTLGVGSFHWEEDHLQEVPEKLAERILTTNGGNGK"
FT   gene            282061..282490
FT                   /pseudo
FT                   /locus_tag="Aazo_0280"
FT                   /product="hypothetical protein"
FT   gene            complement(282757..284244)
FT                   /pseudo
FT                   /locus_tag="Aazo_0281"
FT                   /product="hypothetical protein"
FT   gene            284262..284612
FT                   /locus_tag="Aazo_0282"
FT   CDS_pept        284262..284612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_2576 transposase IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62871"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYP8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62871.1"
FT                   /translation="MPAIYTFSQSLTPFFYLFVRNPGLADELSLPFDEISLEMIYRGLY
FT                   HFTMAHQKGKATDPVKYFADPQNRDLGIIKQKQKPNVKLIVAPFPDLQRGTDQFFFHIY
FT                   FSKSLLTKDFQP"
FT   gene            complement(284609..285055)
FT                   /locus_tag="Aazo_0283"
FT   CDS_pept        complement(284609..285055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0283"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   npu:Npun_R3666 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62872"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYP9"
FT                   /inference="protein motif:PFAM:PF01878"
FT                   /protein_id="ADI62872.1"
FT                   /translation="MKSEPEVYSITDLQHQRETIWDGVRNYQARNFLLQMELGDLTFFY
FT                   HFNTSYPGIVGLMPIVKTAIADPTQFEPTSKYYDPKSSPESPRCQTVGVEFVETFSNPI
FT                   LLSTLKEKFSSDELLLVRPGNRLWVMPVLSAVAKKILPISFVTS"
FT   gene            complement(286050..286274)
FT                   /locus_tag="Aazo_0284"
FT   CDS_pept        complement(286050..286274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:asr3134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62873"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYQ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62873.1"
FT                   /translation="MSASMELQPTLGKSICEDCAFYVKLECTHPDELGVNCATVIFCNS
FT                   FTPPVEIRPLAELILCYNAVCLCFSQKLE"
FT   gene            complement(286458..287244)
FT                   /pseudo
FT                   /locus_tag="Aazo_0285"
FT                   /product="hypothetical protein"
FT   gene            287367..287558
FT                   /locus_tag="Aazo_0286"
FT   CDS_pept        287367..287558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62874"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYQ1"
FT                   /inference="similar to AA sequence:KEGG:Ava_0431"
FT                   /protein_id="ADI62874.1"
FT                   /translation="MIMTNTQTWYIINYKSEICEIEPSQQVKENNPDIIKKRGTFNSQP
FT                   EAIARRVGLIRARKYQPQ"
FT   gene            complement(287602..288885)
FT                   /locus_tag="Aazo_0287"
FT   CDS_pept        complement(287602..288885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0287"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="SMART: peptidase S41; PDZ/DHR/GLGF domain protein;
FT                   TIGRFAM: carboxyl-terminal protease; KEGG: ava:Ava_0432
FT                   C-terminal processing peptidase-2; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62875"
FT                   /db_xref="GOA:D7DYQ2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYQ2"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ADI62875.1"
FT                   /translation="MVITKSRLVLGATAVTLSTIAVTSLGIHSRGQALFKASPKELIDE
FT                   VWQIVYRQYVDGTFNQVDWQAVRKEYLSKSYTNQEEAYKSIREMLKKLEDPYTRFMNPE
FT                   EFKNMQVDTSGELTGIGITISQDEKTKQLVVIAPIEDTPAFKMGVIAKDVILEIDGKST
FT                   EGMDTNQAVSLIRGEAGTKVRLKILRNGQKKQFDITRARIEIHPVKCSEKQTPAGNLGY
FT                   IRLNQFSANAAKEMKDAISKLETKNVSGYILDLRGNPGGLLFSSVDIARMWLDKGTIVS
FT                   TIDRQGEQEREIAKGRALTTKPLVVLVDKGSASASEILSGALQDNKRATIVGTQTFGKG
FT                   LVQSVRPLEDGSGLAVTIAKYHTPSGKDINKHGIDPDVKVDLTDAQRQDLWLKERDKLA
FT                   TLEDPQFAKAVEILGKQAAKNSKTTNKN"
FT   gene            complement(289007..291661)
FT                   /locus_tag="Aazo_0288"
FT   CDS_pept        complement(289007..291661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0288"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold domain protein; PAS
FT                   fold-3 domain protein; histidine kinase A domain protein;
FT                   GAF domain protein; KEGG: npu:Npun_F3797 multi-sensor
FT                   signal transduction histidine kinase; SMART: GAF domain
FT                   protein; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS domain containing
FT                   protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62876"
FT                   /db_xref="GOA:D7DYQ3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYQ3"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADI62876.1"
FT                   /translation="MLNPLGIAIGFLIIILFTTYYLLQRQITQRQQTGNILRQQTERER
FT                   LVSQIAHHIRTSLNLEEVLVTTVAEVKHFLQADRVLIYRLWEDGTGSAITETVSPDYPC
FT                   ILGRIFPAEVFPREYHHAYTQGRTTAITNVESDVNSCLAEFLNQFGVKAKLVVPILQEV
FT                   RKVRETDNSESLHPSPHLWGLLIAHQCSNVRQWQTWEVELMKQLATQVAIAIQQSELYE
FT                   QLQQLNAQLEHRVQQRTEELARTNTSLRAEIVERQRTEAALRHTNQTLQSLIAASPRAI
FT                   FTLDLHNNVKMWNPAAERMFGWSETEVLDQPNPIMSAELEEYEKIKETVIQGITPPSVE
FT                   VRQRKKDNSLIDIVFSAAPLHNSEGVISGMVAVVADITEQKRQAEQVRFLESVVVNTND
FT                   AVLITEAEPIDEPVPRILYINEAFTRMTGYSPEEVLGKTPGILQGPKTTGAVLDQVRTA
FT                   LFSRESVTVEAINYRKDGSEFWVESSIVPVADKTGYYTHWISIQRDVSERKRIEQALRC
FT                   SEERFRSLIENALDVITILDTDGTIHYMSPSVEKVLGYRSVELINQNFFAWIHPDDFVA
FT                   TCYNITNAIKNPDVPLPVEFRYRHQDDSWRTLEAISQKFVDNSELTSIVVNSRDITERK
FT                   RLEEVRLALEREKELSAMKIRFFSMASHEFRTPLSTALAAAQLLENSPHAWENGGKRSR
FT                   NLRRIQDSVKNMVQLLDDILTINRAETGNLEFNPQWLDLERFCRQFVEEIRLSNTSEYI
FT                   LTFTCDSVPWRNTVEQWQQAYLDEKLLRSILGNLLSNAIKYSPEKTQVDFCLNFDHNQV
FT                   IIQISDHGIGISTTDQDQLFEPFHRGHNVRNIAGTGLGLVVVKKCVDLHGGHLNIVSEL
FT                   GHGTTVTVTLPLA"
FT   gene            292063..292395
FT                   /pseudo
FT                   /locus_tag="Aazo_0289"
FT                   /product="hypothetical protein"
FT   gene            292767..293111
FT                   /locus_tag="Aazo_0290"
FT   CDS_pept        292767..293111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0290"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   npu:Npun_F2721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62877"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYQ4"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADI62877.1"
FT                   /translation="MDLEEFLKLLETKHTSEYINGKIIPKPMAKGKYSRLQLKLCNSVN
FT                   DVTESEKIAYAFPELRCSFGIRSIVPDIAVFNWSRIPFATDGEVPNDFPLFPDWTIEIF
FT                   SPEQKRGPKI"
FT   gene            complement(293312..294078)
FT                   /pseudo
FT                   /locus_tag="Aazo_0291"
FT                   /product="hypothetical protein"
FT   gene            294170..294385
FT                   /pseudo
FT                   /locus_tag="Aazo_0292"
FT                   /product="hypothetical protein"
FT   gene            complement(294391..294846)
FT                   /locus_tag="Aazo_0293"
FT   CDS_pept        complement(294391..294846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0293"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: PBS lyase HEAT domain protein
FT                   repeat-containing protein; KEGG: ava:Ava_2929 heat
FT                   repeat-containing PBS lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62878"
FT                   /db_xref="GOA:D7DYQ5"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYQ5"
FT                   /inference="protein motif:PFAM:PF03130"
FT                   /protein_id="ADI62878.1"
FT                   /translation="MISLQPDITLDQLAFLSVESLIEAYPACPNQNIQARIISILAELG
FT                   DERALDLLVEVVGVEVANHCQGNIRRVAARGLEQMVIATTDPEKSQRAIYKLSWALLNA
FT                   EDWALRYAAAVSLGGIATVEINTILDQAMTQESDRVVKERIRMILNV"
FT   gene            complement(295058..295843)
FT                   /locus_tag="Aazo_0294"
FT   CDS_pept        complement(295058..295843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0294"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: PBS lyase HEAT domain protein
FT                   repeat-containing protein; KEGG: ava:Ava_2928 heat
FT                   repeat-containing PBS lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62879"
FT                   /db_xref="GOA:D7DYQ6"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYQ6"
FT                   /inference="protein motif:PFAM:PF03130"
FT                   /protein_id="ADI62879.1"
FT                   /translation="MVVTNSSTEPILSPETAIAALDAEDNQIRYYAAWWLGKHQIQSAC
FT                   TALCQQLHDVRYRTVQGGYPLRRQVARALGQLKNIQALPALLEALRCEEDGQFREAVIE
FT                   ALGKIGDLTASYPLLQLLQLGTSQPYEALIEALGELRVSEARPLVEPFLQHSSERVQCA
FT                   AARYLYLITQQPEYLQRIIKNLNHENPYLRWAAAFDLGAIGHIQAAEAIVQAKVGNSLK
FT                   LLNLKQILETVLEGDVSELEKQKAIQNIFKAIDQLLMRL"
FT   gene            complement(295959..296792)
FT                   /locus_tag="Aazo_0295"
FT   CDS_pept        complement(295959..296792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0295"
FT                   /product="Phycobilisome linker polypeptide"
FT                   /note="PFAM: Phycobilisome linker polypeptide; CpcD
FT                   phycobilisome linker domain protein; KEGG: ava:Ava_2927
FT                   CpcD phycobilisome linker-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62880"
FT                   /db_xref="GOA:D7DYQ7"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR008213"
FT                   /db_xref="InterPro:IPR016470"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYQ7"
FT                   /inference="protein motif:PFAM:PF00427"
FT                   /protein_id="ADI62880.1"
FT                   /translation="MSLSMEQRLGISAVTNAKIELRPNYREDELQQIFKAAYEHVFGRE
FT                   RVYVSGIFSSAEAMLRNGKISVRQFVQTLVKSEFYKERFFYNNSQIRFIELNYKHLLGR
FT                   APYDQSEIAYHVDLYASQGYDADIDSYIDSQEYNNAFGDNTVPYYRGFKSIPGMKQIGF
FT                   NRLFTLYRGNGNSDNAGTKSPRLRQQLAMNLPNMIIPPSSAIRFASVLSVGQLNTSPVR
FT                   GDQRLYVIEIIAGGVGTKVAVRRSRQVYTVPFDQLSKRYQEIHKQGGKIISITPV"
FT   gene            complement(296902..297390)
FT                   /locus_tag="Aazo_0296"
FT   CDS_pept        complement(296902..297390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0296"
FT                   /product="Phycocyanin"
FT                   /note="PFAM: Phycocyanin; KEGG: ava:Ava_2926 phycobilisome
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62881"
FT                   /db_xref="GOA:D7DYQ8"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYQ8"
FT                   /inference="protein motif:PFAM:PF00502"
FT                   /protein_id="ADI62881.1"
FT                   /translation="MKTPLTEAIAAADTRGAYLSNTEMQAVFGRFSRAKAGLEAARAFN
FT                   QNGQKWAEAAANHVYQKFPYTTQMQGSQYASTPEGKSKCVRDISHYLRTISYCCVVGGT
FT                   GPLDEYVIAGVKELNAALGLSPSWYVAALEFVRDNNGLSGDVAGEANIYLNYAINALS"
FT   gene            complement(297452..297970)
FT                   /locus_tag="Aazo_0297"
FT   CDS_pept        complement(297452..297970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0297"
FT                   /product="Phycocyanin"
FT                   /note="PFAM: Phycocyanin; KEGG: ana:alr0523
FT                   phycoerythrocyanin beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62882"
FT                   /db_xref="GOA:D7DYQ9"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYQ9"
FT                   /inference="protein motif:PFAM:PF00502"
FT                   /protein_id="ADI62882.1"
FT                   /translation="MLDAFSRVVEQSDRQGSYLNDDQINALCALVGDSNKRLDIVNRLT
FT                   SNASTITANAYRALVAEQPKVFGPGGACFHHRNQAACIRDLGFILRYVTYSILSGDTSV
FT                   MDDRCLNGLRETYQALGTPGATVASGIGKMKDAAITIANDNSGISRGDCSSLISELATY
FT                   FDRAAAAVA"
FT   gene            298315..299007
FT                   /locus_tag="Aazo_0298"
FT   CDS_pept        298315..299007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0298"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: npu:Npun_R3793 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62883"
FT                   /db_xref="GOA:D7DYR0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYR0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADI62883.1"
FT                   /translation="MRILLIEDDIRLAETLAEALTDQLYVVDIATDGESAWNCTKALDY
FT                   DLLLLDLMLPEIDGITLCHRLRSHGYQKPVLMLTACDTISDKISGLDAGADDYIIKPVD
FT                   LGELFARIRALLRRGNTISPPVLEWGNLQLNPSTYEVTYNHTPLHITPKEYSLLELLLR
FT                   NGRRLLSRSVIIDHIWRTDTCPDEHTVKVHLRSVRQKLKAAGAPEDFIETIHGMGYRLK
FT                   SLDLLQKS"
FT   gene            complement(299059..300282)
FT                   /locus_tag="Aazo_0299"
FT   CDS_pept        complement(299059..300282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0299"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="TIGRFAM: 1-hydroxy-2-methyl-2-(E)-butenyl
FT                   4-diphosphate synthase; KEGG: ana:all2501
FT                   4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; PFAM:
FT                   IspG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62884"
FT                   /db_xref="GOA:D7DZD2"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZD2"
FT                   /inference="protein motif:TFAM:TIGR00612"
FT                   /protein_id="ADI62884.1"
FT                   /translation="MQTIQPLETTNTTSQPVFDTTIKRRKTRAVKVGDVTIGGGYPVVV
FT                   QSMINEDTLDIDGSVAGIRRLHEIGCEIVRVTVPSLGHAKALAEIKPKLIKTYRDVPIV
FT                   ADVHHNGMKIAMEVAKHIEKVRINPGLYVFEKPNTSRTEYTKVEFDEIGEKIRETLAPL
FT                   VISLRDQGKAMRIGVNHGSLAERMLFTYGDTPEGMVESALEFIRICESFDFRNIVISMK
FT                   ASRVPVMVAAYRLMAKRMDDLGMDYPLHLGVTEAGDGEYGRIKSTAGIATLLADGLGDT
FT                   IRVSLTEAPEKEIPVCYSILQALGLRKTMVEYVACPSCGRTLFNLEEVLHTVREATKHL
FT                   TGLDIAVMGCIVNGPGEMADADYGYVGKTPSYISLYRGREEIKKVPENLGVEELINLIK
FT                   ADGRWVEP"
FT   gene            complement(300464..300925)
FT                   /locus_tag="Aazo_0300"
FT   CDS_pept        complement(300464..300925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syp:SYNPCC7002_A2485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62885"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZD3"
FT                   /inference="similar to AA sequence:KEGG:SYNPCC7002_A2485"
FT                   /protein_id="ADI62885.1"
FT                   /translation="MKVLIDNNIIVMLDFLLHREPFRQDAEELFQAIDSGRIIGYVTAT
FT                   TLTDIFYIARRHTRSIEQARQAVLETLTVMMVCPVNRTILEWAFASGIGDFEDVIQIAC
FT                   AVTQGLEAILTRDRQGFLSSTNSACIVGSSAIGTIRHLRRLKSNVFLSH"
FT   gene            complement(300922..301152)
FT                   /locus_tag="Aazo_0301"
FT   CDS_pept        complement(300922..301152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syp:SYNPCC7002_A2484 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62886"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZD4"
FT                   /inference="similar to AA sequence:KEGG:SYNPCC7002_A2484"
FT                   /protein_id="ADI62886.1"
FT                   /translation="MLLQELKEQVYKLSVSDRLSLVSLIIESLQAISSLQPDKSNAIGR
FT                   MRGLLKTDQPAPTDEEVEAMLEERLVERYLH"
FT   gene            301330..301422
FT                   /locus_tag="Aazo_0302"
FT   CDS_pept        301330..301422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0302"
FT                   /product="patatin"
FT                   /note="KEGG: cyc:PCC7424_2676 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62887"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZD5"
FT                   /inference="similar to AA sequence:KEGG:PCC7424_2676"
FT                   /protein_id="ADI62887.1"
FT                   /translation="MTEVKRLLSIEGGVIRGVMAADILVQIEDA"
FT   gene            301581..303024
FT                   /pseudo
FT                   /locus_tag="Aazo_0303"
FT                   /product="hypothetical protein"
FT   gene            303073..304110
FT                   /locus_tag="Aazo_0304"
FT   CDS_pept        303073..304110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R5025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62888"
FT                   /db_xref="GOA:D7DZD6"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZD6"
FT                   /inference="similar to AA sequence:KEGG:Npun_R5025"
FT                   /protein_id="ADI62888.1"
FT                   /translation="MSIPITTQLPIPPHFNPAKVGEVYRLPYQERATEAEVWTKQHNIP
FT                   PASTDKARVCLLLIDVQNTFCIPNFELYVGGQTGTGAVDNNKKLCEFIYCNLGVITKII
FT                   PTLDTHTAMQIFHPIFWINTDGEHPTPAATNITPADIEAGIWQLNPAVANSVTNGDYES
FT                   LKEQAFHYVKQLSQDGKYPLTVWPYHSMLGGIGHALVSSVEEAIFFHSIARQSQTQFEL
FT                   KGENPLTENYSVLRPEVLLGFDQKPIAKKNTNLIKQLLEFDIVIIGGQAKSHCVSWTID
FT                   HLLTEIQQVDSTLTNKIYLLQDCTSAVVVPGVVDYTEQANATFARFAAAGMHIINSTEL
FT                   VMGNW"
FT   gene            complement(304142..305026)
FT                   /locus_tag="Aazo_0305"
FT   CDS_pept        complement(304142..305026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0305"
FT                   /product="Peptidase M23"
FT                   /note="KEGG: npu:Npun_F5024 peptidase M23B; PFAM: Peptidase
FT                   M23; Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62889"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZD7"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADI62889.1"
FT                   /translation="MTFSYRPLFLYSLMSVLGLLATLSPTQNANAAVPSCPTPTLSRIQ
FT                   RYQVVRGETLESIAQRYNLQPTTIAGMNPSVNNRMLAAGTQLQIPPFDGIVVAVTGDQI
FT                   WRQIATKYKVRPDTLFEINGCQQNARVVFVPVVPELTKTPNRIITASLGQTARSATIFG
FT                   YPLPRSTTVALPYGWQIEPTSSKVFFHSGVDLVAPVGTPVQAITPGIVVFAKYQASYGK
FT                   LVIINHAGGLQTRYAQLETIQVTLGQAVKQGDILGTVGATGQPTSREPHLHFEIRANES
FT                   LGWTAKDPKEYLK"
FT   gene            305321..306526
FT                   /locus_tag="Aazo_0306"
FT   CDS_pept        305321..306526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0306"
FT                   /product="HtrA2 peptidase"
FT                   /EC_number="3.4.21.108"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: npu:Npun_R5023 peptidase
FT                   S1 and S6, chymotrypsin/Hap; SMART: PDZ/DHR/GLGF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62890"
FT                   /db_xref="GOA:D7DZD8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZD8"
FT                   /inference="protein motif:PRIAM:3.4.21.108"
FT                   /protein_id="ADI62890.1"
FT                   /translation="MKLSVKQLVVYLFLVAVGGGGGVFGSRYFLPQHHSFQELENVTVA
FT                   LPPEAVVPYPIDGATNSTKSDNVNFIATAVQKVGSAVVRINATRKVANPIFGAFDNSML
FT                   KRFFGEDEEPIPSERIERGTGSGFILSANGQLLTNAHVVDNTDTVQVTLKDGRTFDGKV
FT                   VGIDTITDVAVVKIAADNLPTVKLGNSQNLIPGQWAIAIGNPLGLDNTVTIGIISATDR
FT                   TSAQVGVPDKRVSFIQTDAAINPGNSGGPLLNTQGEVIGINTAIRTDAQGLGFAIPIET
FT                   AARIAHELFTKGKAEHPFSGIEMAELSPAKKQELNQKKQLNIQLDVSFAIKGIVANSPA
FT                   QKAGLLIGDVIQKINGKPIKSLAQAQKIIEFSTVGDILTIEVHRNGKTQIFKIRSGTYP
FT                   HK"
FT   gene            complement(306567..306911)
FT                   /locus_tag="Aazo_0307"
FT   CDS_pept        complement(306567..306911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_2412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62891"
FT                   /db_xref="InterPro:IPR008479"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZD9"
FT                   /inference="similar to AA sequence:KEGG:Ava_2412"
FT                   /protein_id="ADI62891.1"
FT                   /translation="MVFDPDFLNNNSEEHTNQLLNEHFGEHPNQLLKYLQHQSPEVLAR
FT                   VAQSVTPEIKQIISQNVQGLVGMLPAESFNVQITTDRDNLAGLLASAMMTGYFLRQMEQ
FT                   RMQLDHLSNQ"
FT   gene            complement(307065..307640)
FT                   /locus_tag="Aazo_0308"
FT   CDS_pept        complement(307065..307640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0308"
FT                   /product="chromosome segregation and condensation protein,
FT                   ScpB"
FT                   /note="KEGG: ana:all5166 hypothetical protein; TIGRFAM:
FT                   segregation and condensation protein B; PFAM: chromosome
FT                   segregation and condensation protein ScpB"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62892"
FT                   /db_xref="GOA:D7DZE0"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZE0"
FT                   /inference="protein motif:TFAM:TIGR00281"
FT                   /protein_id="ADI62892.1"
FT                   /translation="MSKKNIAIGIKIEAILYLKGKPLSLSEIAEYAGCDRPTVEESIIE
FT                   LMDNYARRDSALEVVETENGYSLQLRSDFHDLVQTLIPVELAVGPLRTLAAIALHNPIL
FT                   QSDLINLRGSGVYQHVPKLVELGFVRKRRDSDSRSYSLQVTPKFHQYFQIDQLPQVFPR
FT                   DEKEQQLELKLNIQRESVHSVEVTEKME"
FT   gene            complement(307665..308345)
FT                   /locus_tag="Aazo_0309"
FT   CDS_pept        complement(307665..308345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0309"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="KEGG: npu:Npun_F5020 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase; TIGRFAM:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62893"
FT                   /db_xref="GOA:D7DZE1"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZE1"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ADI62893.1"
FT                   /translation="MYLLIPAAGSGKRMGADRNKLLLQVHSKSLIAWTLLAAEAASSIS
FT                   WIGIISQPHDWEDFKGIIADLKLTKPVELITGGATRQESVYNGLLALPDAAKQVLIHDG
FT                   ARCIATPNLLNACAEAILHCPGLIAAIPVKDTIKVVDESGIIQSTPDREQLWAAQTPQG
FT                   FDVKLLKQCHAEGVRQGWEVTDDAALFEKCGIKVRIVPGEETNLKVTTPQDLVIGQFIL
FT                   SHRE"
FT   gene            308762..310957
FT                   /locus_tag="Aazo_0310"
FT   CDS_pept        308762..310957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0310"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /note="KEGG: ava:Ava_3468 anthranilate synthase, component
FT                   II; TIGRFAM: para-aminobenzoate synthase, subunit I;
FT                   glutamine amidotransferase of anthranilate synthase; PFAM:
FT                   Chorismate binding-like; glutamine amidotransferase
FT                   class-I; Anthranilate synthase component I domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62894"
FT                   /db_xref="GOA:D7DZE2"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZE2"
FT                   /inference="protein motif:TFAM:TIGR00553"
FT                   /protein_id="ADI62894.1"
FT                   /translation="MQTLIVDNYDSYTFNLYQMIAEVNGNYPLVIRNNEVTWDELKKIA
FT                   FDNIVISPGPGRPEKSEDFGVCRQIIENNVDVPLLGVCLGHQGIGYLHGAKVIHAPEVR
FT                   HGRISKIHHNESELFQGIPSPFSVVRYHSLLVADELPECLEKIAWTEDGLVMGLRHRYL
FT                   PFWGVQFHPESICTEYGTTLLNNFRDITLLFTKKLSISSESKYYFPGYQSLYSSVEDMY
FT                   QQEERFELYTRKLDICPNTEQIFVHLFQEEPNSFWLDSSRVEPGLSRFSFMGDGKGKNS
FT                   LLVRYHTQTQELIITQSDKVTRRTESIFEFLKREIGLRSCQSDELPFDFNCGFVGYFGY
FT                   ELNAECGAKLVHSSPLPDAIFLLADRMIAIDHEEQCLYLLELVKTGQTQQAGTWFDTIQ
FT                   QQLKILNPLPPLVAQGNGEPVRLYLSRSYQNYINDIHHCLEEIHEGETYQVCLTNQLHA
FT                   DISPDPLTFYRRLRQINPAPYSAFLRFGEIAIACSSPERFMQIDRQGWVETKPIKGTLR
FT                   RGDNPEEDFILQERLRNSEKDQAENLMIVDLLRNDLGRVCEVGSVHVPKLMDVETYATV
FT                   HQLVTTIRGHLPSNLQAVDCIHAAFPGGSMTGAPKIRTMQIIDRLEQEARGVYSGAIGF
FT                   LGLNGASDLNIVIRTAIFTPDGTSIGVGGGIVALSDPEMEFQEILLKAKALIQTMVMTI
FT                   HGKFEEDLYSILGVESKTSQCFMMFSNLILKPYNGFF"
FT   gene            complement(311374..311888)
FT                   /pseudo
FT                   /locus_tag="Aazo_0311"
FT                   /product="hypothetical protein"
FT   gene            312321..313280
FT                   /locus_tag="Aazo_0312"
FT   CDS_pept        312321..313280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0312"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   ava:Ava_2415 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62895"
FT                   /db_xref="GOA:D7DZE3"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZE3"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ADI62895.1"
FT                   /translation="MRVVAFVPGSISDQILFFPTLDDLKRYYPDAQIDVIVESQSKAAY
FT                   RLSKSVHEVLTFDYSDHNSLADWGNLVGTIRDREYDVAMTTGESWFIGLFLWLTGIPTR
FT                   IGYKGKGAGFLTNTIRRNTSQYVAAMYHDLLKPVGIKTPCPELTANVPKPDIQWAQQEQ
FT                   KRLGIHETGYILIYGGSSHSSQIDGADTSYPIASWQQIIQDCQHKQPELPIVLIKEADD
FT                   ENFVRVLLESCSNLKITSPDDIGKLTAIISGASLMLSIENGPLQLAVAVQTYTIALLSS
FT                   TDADKLLPKSDKFLAIKSHSGKTVDIPPPTVLEKIWGG"
FT   gene            complement(313390..313884)
FT                   /locus_tag="Aazo_0313"
FT   CDS_pept        complement(313390..313884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0313"
FT                   /product="Domain of unknown function DUF1817"
FT                   /note="PFAM: Domain of unknown function DUF1817; KEGG:
FT                   ana:all5169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62896"
FT                   /db_xref="InterPro:IPR014946"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZE4"
FT                   /inference="protein motif:PFAM:PF08847"
FT                   /protein_id="ADI62896.1"
FT                   /translation="MTTTITINLKNDSINNLDLSPALTVIEPLLHEESITSYEQQLCFE
FT                   ISYAREANDPRELSEIPEVRLWFVRLDAKYPWLPFLLDWKAGELARYSAMLVPHQFSSK
FT                   EGIQYNPEALEIFLMQKIFILSDWLKQQSIPTQFRLKSLAQILGYELEDAFFEMIEKSN
FT                   S"
FT   gene            314322..314759
FT                   /locus_tag="Aazo_0314"
FT   CDS_pept        314322..314759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0314"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: npu:Npun_R5017
FT                   ferric uptake regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62897"
FT                   /db_xref="GOA:D7DZE5"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZE5"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADI62897.1"
FT                   /translation="MQKPAISTKAISSLEDALHRCQMLGMRVSRQRRFILELLWQANEH
FT                   LSAREIYDRLNQQGKEIGHTSVYQNLEALSSQGIIECIEHCDGRLYGNINDAHSHVNCV
FT                   DTNQILDVHIELPAELIQQVEAQTGVKIIAYTINFFGHRNS"
FT   gene            314883..316631
FT                   /locus_tag="Aazo_0315"
FT   CDS_pept        314883..316631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0315"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: npu:Npun_R5015 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62898"
FT                   /db_xref="GOA:D7DZE6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016837"
FT                   /db_xref="InterPro:IPR022552"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZE6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADI62898.1"
FT                   /translation="MSDHPLALKLLLIDPDPIFRLGLRVALETIPHLQILADVPTHTAA
FT                   LQVLAEIAASDLNQVNLIVLELGNGISIDSQQLGLQFCRQLKALYSHIPILLLSSVSTQ
FT                   EMLLAAQNTGVNGYCPKGISISELVPIMEELVNGGYYWLGTTGIVNSSSSHLPFAKLRN
FT                   HIRFSGINHINHTLTAVTTQLKIPGLPLLDKAILAGHRRELLAAQWLVNHLLAAPEERQ
FT                   PTQTSPPLPLSIPYPNLIAKPESQQIQTFVPPLLSPKALQSTLFASCINKLQFPLPNVT
FT                   DIPLEIDILREDKKRQLLYIILQQVSKQLNKLRKSEVKIQQLSDLKNQILNNLWQSAIK
FT                   DFYIQLSQINVGDIDIEIVNFLLNNAVGVETEILNKIPLVEELFSYLLCQTDLYIDNIS
FT                   YSAGSEPANSQGSMILENLLIQIANGVLQPLLNSLADVETIKQNLYDRHFISTREIERF
FT                   RNNLSWKYRLNNYVNEPQAIFESRYELFVFAPRGIAKISIYSPRNQELAKLSGVPLMVT
FT                   LLLELRDAITPRLQSLLSFVGNGIVFILTQIIGRGLGLIGRGVLQGIGSVALTEKTQKR
FT                   QKERTK"
FT   gene            complement(316673..318178)
FT                   /locus_tag="Aazo_0316"
FT   CDS_pept        complement(316673..318178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0316"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: npu:Npun_F5012
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62899"
FT                   /db_xref="GOA:D7DZE7"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZE7"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADI62899.1"
FT                   /translation="MKIDYDVVIVGGSIIGYYAALTATQLQAKVALVQPQVNYEFNYHY
FT                   ALSEIAKMMQHCLDVADLGIITQPDTELNGTNSDTILADKSEISIHQARYINPWKQAIM
FT                   YADAITTNLNQVNSLANLATQGVDVIIGNGEFSSSPQLSFAVNNRILNARTYLLACGSL
FT                   SKIPDIAGLKTTGYVTLTNIWQSLEKPNPPKNWVILGGLPQSMEIAQTLARLGCNITLI
FT                   FNHPSVFSHLDPELAQLLIAQLEADGVCVLNQIIVTQVRQVEDKKWVQAGDKAIETDEI
FT                   LVATGQQPNIGNLNLTAVGVKCRPRGLVVNDKLQTTNQRIYACGDVIGGYDIANIANYE
FT                   AKIAVNNALFFPRLAVNYNYIPWMISSQPMVAQVGLTELQAKRQYGKQEVLVLRQYFKT
FT                   LAAAQVQDNITGICKLTSLENGKILGCSILGTAAGELINLIALAMSQNLKIQHLAKIAA
FT                   VYPSFSETLEQTVREWSNIKLSKNHRLQEFLQSFFHFRRDWNL"
FT   gene            complement(318246..319340)
FT                   /locus_tag="Aazo_0317"
FT   CDS_pept        complement(318246..319340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0317"
FT                   /product="L-threonine-O-3-phosphate decarboxylase"
FT                   /EC_number="4.1.1.81"
FT                   /note="TIGRFAM: L-threonine-O-3-phosphate decarboxylase;
FT                   KEGG: npu:Npun_F5011 putative L-threonine-O-3-phosphate
FT                   decarboxylase; PFAM: aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62900"
FT                   /db_xref="GOA:D7DZE8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005860"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZE8"
FT                   /inference="protein motif:TFAM:TIGR01140"
FT                   /protein_id="ADI62900.1"
FT                   /translation="MREKAHGGNLVWAAALAGCPPDAIVDFSASISPLGPPNSVIAAIT
FT                   SQFANLKHYPDPDYRELKLSLGRFHKIPLEWILPGNGSAELLTLVGRELAHLAATMLIT
FT                   PAFGDYYRTLAAYNAKVLEFPVNLGIRDWGLGKISSSFPLSRNCGLLLNNPHNPTGKLF
FT                   LRDEILPYLEDFALVVVDEAFMDFLPPDEEQSLIGLVQEYENLVILRSLTKFYSLPGLR
FT                   LGYVIAHPDRLAKWQSWRDPWPVNILAAAAAIAALQDTEFQQLSWKWLPDARNQLFQGL
FT                   VQLPGLNPLEGAVNYLLVESQQSTSELQTKLLQQHQVFIRDCLSFKELGDHFFRIAVRS
FT                   ESDNQRLLTALKSVISYQYGDWGR"
FT   gene            complement(319367..319651)
FT                   /locus_tag="Aazo_0318"
FT   CDS_pept        complement(319367..319651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0318"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="KEGG: ava:Ava_1767 nucleoid protein Hbs; PFAM:
FT                   histone family protein DNA-binding protein; SMART: histone
FT                   family protein DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62901"
FT                   /db_xref="GOA:D7DZE9"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZE9"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ADI62901.1"
FT                   /translation="MNKGELVDAVAEKASVTKKQADAVLSAAIETIIEAVASGDKVTLV
FT                   GFGSFESRERKAREGRNPKTNEKMEIPATKVPAFSAGKLFRERVAPPKE"
FT   gene            complement(320147..322603)
FT                   /locus_tag="Aazo_0319"
FT   CDS_pept        complement(320147..322603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0319"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein; NolW
FT                   domain protein; Secretin/TonB short domain; KEGG:
FT                   ava:Ava_3689 type II and III secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62902"
FT                   /db_xref="GOA:D7DZF0"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZF0"
FT                   /inference="protein motif:PFAM:PF00263"
FT                   /protein_id="ADI62902.1"
FT                   /translation="MKQVHSNVLISSATACVLLAAQPASAQTTQITQVQLSPAEGGISV
FT                   ILKTSAGEKPQVFTTQRGNALVADIINTKLLLLQGNNFRQENPAPGIASVEVNQLNANS
FT                   VRVTVTGNDTAPNSKPVMRQDNSLTLSFTSSRDATTSITPNTDTTAAVPITPAATPVEP
FT                   GKKIEVLVPNPEVTIDGKPAQPAGPNQPYNQAPPFLPRAVAPPVGDITVSNIDTSPTSI
FT                   DLGTQERVPRLVLRDAPVREVLSLLARAAGMNVAYIGSEGAAATPPAGGQLAATTSQTI
FT                   SLDIENEAVQDVFNYVLRLSALEANRSGRTIFVGAKLPNSTRDNVMRSLRLNQVTVGVA
FT                   LNFLVALGAESAVSRERLVTSVNAVPVGSAANAAITQTQTTTETKIETQRIDYKDSVPL
FT                   LRGLQASGDERTNSVTLVGNPKIVEMAISQLTQLDVRRRQVVVNVKIIDVNLLGIQDYT
FT                   SSFSFGIGDNYFSNDGGAATFNFGGSRPATSSEVANSITDTPVITNPITGEPFLSTTES
FT                   TTLTGAGPGTTIINQSASVVPLGDGTTLAPGGIKVIPNTDATTFTPISSASSNPLQPGF
FT                   TSITQSTNNIITINADGTTSVTQGTAGTATASLPSLYKFPKRFLASLQAQVQTGNAKIL
FT                   TDPTLIVQEGQDAVVKLTSEVYGGIRITDTLREPIIKEAGLTLAVKVERIDDNGFVSLS
FT                   VAPTVSAFANSASTPDGNIALLAARSLQSGILRLRDGQTLILSGIIQDQDRTTISKLPI
FT                   LGDIPLLGSLFRKTNRQNERREVIVLLTPQVMDDSERSAYGYNYNPSSQVRQILERRGL
FT                   KVPNNR"
FT   gene            complement(322743..323522)
FT                   /locus_tag="Aazo_0320"
FT   CDS_pept        complement(322743..323522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0320"
FT                   /product="type IV pilus assembly protein PilO"
FT                   /note="KEGG: npu:Npun_F5007 type IV pilus assembly protein
FT                   PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62903"
FT                   /db_xref="GOA:D7DZF1"
FT                   /db_xref="InterPro:IPR034756"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZF1"
FT                   /inference="similar to AA sequence:KEGG:Npun_F5007"
FT                   /protein_id="ADI62903.1"
FT                   /translation="MTLSDDLSFSQQNTNFDDAASSYRSVFGITLTPQIIGGSVGGIGF
FT                   LAAVYMILNMVMPAWDNFQQLQTKSTELQGQVDQKRLQAKQADKVKTELADVKKQQIQV
FT                   LGLFANERSLDTLLMDTSRLVDSSNAQITANDAIRAKLKRFVPAADKAEIIADNSLGEK
FT                   VNNKLKRRVVKVEIEGNFEQTQSIMRNIERLQPLLLVQNYDSKLVPPEVDKANDEKKKA
FT                   VRTGIGKLSTSFDLVALMPLTAEEAAELAAKAAPPAK"
FT   gene            complement(323519..324328)
FT                   /locus_tag="Aazo_0321"
FT   CDS_pept        complement(323519..324328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0321"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   ana:alr1029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62904"
FT                   /db_xref="GOA:D7DZF2"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZF2"
FT                   /inference="protein motif:PFAM:PF05137"
FT                   /protein_id="ADI62904.1"
FT                   /translation="MYSLDINFLRDRASIEFNENQPVRQPINLEDLIPVFLGVGVGLCF
FT                   PALVFGGFWILQAQSSGLEQKIAKLDQEGKELDGKIADIKKIKDEMAGVQDQTQALVTV
FT                   FDQIRPWSAMLQDLRARIPPSVQVENIRQIPPVIQALAATATVTSPKPSNPAGILEING
FT                   YARSFSDVNDFLLTMGQSNLLNAAESGISTAELIDAPAITGAVPPENKSQDTSGVKFKP
FT                   PQVVKYTIKASLSNVPASELIRELEQKGTVGLVKRIRSLQETGAIAK"
FT   gene            complement(324333..325457)
FT                   /locus_tag="Aazo_0322"
FT   CDS_pept        complement(324333..325457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0322"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="TIGRFAM: type IV pilus assembly protein PilM; KEGG:
FT                   ana:alr1028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62905"
FT                   /db_xref="GOA:D7DZF3"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZF3"
FT                   /inference="protein motif:TFAM:TIGR01175"
FT                   /protein_id="ADI62905.1"
FT                   /translation="MVNVLSNLSNLSNILGKSNKGVGIELAPERMNIVHLCKQRQGLKI
FT                   ESLTTIPVPEGIVVDGQINDPPRMAEIIQQGMAESKIKASRVATCIPGRDAIVRVIPVP
FT                   AELDNKELREMVLNHEAALYLPYPREEADVDYQKLGYFVDEDGIEKVQVLLVATRKEIT
FT                   DTYINTFAEAGLKVDVLEINSFALIRTIRDQLRLFGPQEAAVLVDIEFDSTEIAIIING
FT                   VPQFSRTVPIGTYQLQAALSRAMNLPTSRDMDMLMGMTIPTNSMDVGRTGTTGVNPGMG
FT                   PMLKILGELSDELRRSIDFYINQSEGLEVAQILLAGTGGGLQQLDEFFTQRLGFPTTQI
FT                   DPIRDLSLQVEAEKYPPVQRPGLGIILGLAMREG"
FT   gene            325672..326970
FT                   /locus_tag="Aazo_0323"
FT   CDS_pept        325672..326970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0323"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ana:all1027 periplasmic sugar-binding protein of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62906"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZF4"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADI62906.1"
FT                   /translation="MIRLQKFKQLTVWVMLGLLTSWIVSCSTDNVGTISKPVTSEVTKI
FT                   EFWTMQLQPQFTNYFQSLITSFESQNPSIKVKWVDVPWSAMENKILTAVSAKTPPDVVN
FT                   LNPDFASQLAGRNAWLDLDEKVPSEVSSSYLPNIWQASTLNGKTFGIPWYLTTRLTIYN
FT                   TDLLKQAGITKPPATYTELAQEAQQIKDKTGKYAFFATFVPQDSGEVLESFVQMGVTLV
FT                   NAEGKAAFNSPQGKAAFQYWVYLYKKGLLPKESLTQGHRHAIDLYQSGETAFLASGPEF
FT                   LETISNNAPKISQASAIAPQITGDTGKKNVAVMNIVIPRASKQPDAAVKFALFVTNDEN
FT                   QLAFAKAANVLPSTVTALADSYFKEVPATATIAEKGRIISAQQMQTAEVLTPKMKDFKF
FT                   LQKAIYENLQAAMLGQKTVDKALEDAAQQWNNR"
FT   gene            326942..327070
FT                   /locus_tag="Aazo_0324"
FT   CDS_pept        326942..327070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0324"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Gooseberry protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62907"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZF5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62907.1"
FT                   /translation="MQRNSGIIGDCRLGIGDWEDEDDGGDGEVIFLMPHAPCPIPN"
FT   gene            complement(327356..328672)
FT                   /locus_tag="Aazo_0325"
FT   CDS_pept        complement(327356..328672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0325"
FT                   /product="FolC bifunctional protein"
FT                   /EC_number="6.3.2.17"
FT                   /note="TIGRFAM: FolC bifunctional protein; KEGG:
FT                   ana:alr1026 folylpolyglutamate synthase; PFAM: cytoplasmic
FT                   peptidoglycan synthetase domain protein; Mur ligase middle
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62908"
FT                   /db_xref="GOA:D7DZF6"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZF6"
FT                   /inference="protein motif:TFAM:TIGR01499"
FT                   /protein_id="ADI62908.1"
FT                   /translation="MNIDSLLQPLQHFGVNLGLTRIVKLLANLDNPHHQVPLIHVGGTN
FT                   GKGSVCAYLSSVLTEAGYRTGRYTSPHLVDWTERICINERPINPETLSQLILRIQSAID
FT                   LREESPTQFEVITAAAWLYFAQQKVDVAIVEVGLGGRLDATNVCPKPLVTVITSISREH
FT                   WQQLGPTVADIAGEKAGIIKPGCPVVIGQLPADAEKVVRARSLELQCPIIAPQPAQEIN
FT                   PGWAEYYKIQNSKYPPGNHPPGLYQIENSESIRYHLPLQGQIQLHNSTLALAALEILQK
FT                   QGWQISEQTIINGIGKTKWPGRMQWFTWKHNNYNYQLLIDGAHNPASAQVLRNYVDSFS
FT                   TQNITWVIGMLATKDHSDIFHALLKTGDKLYLVPVPDNNSANLDHLSKLANETYPDLGF
FT                   CSTYPDVFSALDAAFTSTDNLVVLCGSLYLIGHFLGNSN"
FT   gene            complement(328800..328925)
FT                   /locus_tag="Aazo_0326"
FT   CDS_pept        complement(328800..328925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0326"
FT                   /product="photosystem II protein PsbY"
FT                   /note="PFAM: photosystem II protein PsbY; KEGG:
FT                   ava:Ava_3682 photosystem II protein Y"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62909"
FT                   /db_xref="GOA:D7DZF7"
FT                   /db_xref="InterPro:IPR009388"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZF7"
FT                   /inference="protein motif:PFAM:PF06298"
FT                   /protein_id="ADI62909.1"
FT                   /translation="MDIDTRVIIVLAPLAIAAGWAAFNIGAAAIRQVQNFLNKEA"
FT   gene            329028..329165
FT                   /locus_tag="Aazo_0327"
FT   CDS_pept        329028..329165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0327"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_2392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62910"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62910.1"
FT                   /translation="MINLVSGQWQKAEIFPHLPHHPHIPHLPSPQSLPKTNICPFAGVN
FT                   "
FT   gene            complement(329124..329645)
FT                   /locus_tag="Aazo_0328"
FT   CDS_pept        complement(329124..329645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0328"
FT                   /product="hexapaptide repeat-containing transferase"
FT                   /note="KEGG: npu:Npun_F5001 hexapaptide repeat-containing
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62911"
FT                   /db_xref="GOA:D7DZF9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZF9"
FT                   /inference="similar to AA sequence:KEGG:Npun_F5001"
FT                   /protein_id="ADI62911.1"
FT                   /translation="MSTVSYWTSPDFSQAAFVAPNAVVVGSINIAAGASIWYGAVLRGD
FT                   VVRIDIGECTNIQDGAILHGDPGLPTILEDHVTIGHRAVVHSAHIERGSLIGIGAIILN
FT                   GVRVGHSSIIGAGAVVTKDIPPCSVVVGIPAKIVRQLTDTETAELIEHAEKYQELALVH
FT                   ASKGTDIGFR"
FT   gene            329885..330397
FT                   /locus_tag="Aazo_0329"
FT   CDS_pept        329885..330397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ava:Ava_3680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62912"
FT                   /db_xref="InterPro:IPR013472"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZG0"
FT                   /inference="protein motif:PFAM:PF09654"
FT                   /protein_id="ADI62912.1"
FT                   /translation="MMNPGLQYPIFGPEIQCPHCRQTIPALTLTDTYLCTRHGAFEANP
FT                   KTGELVHLQSGRHWRRWNNEWYRQHTHPDGIRFEIHEALDKLYTQGYRATRVIIARRYQ
FT                   DLMSGYLERSSPWRSGQPEATSARLYGLPVEFSPNPAEDSCWDVINFDLDKEPGVPVRY
FT                   PYFRLFE"
FT   gene            330486..330920
FT                   /locus_tag="Aazo_0330"
FT   CDS_pept        330486..330920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0330"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ana:all1022 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62913"
FT                   /db_xref="GOA:D7DZG1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZG1"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADI62913.1"
FT                   /translation="MHHASIRTANIHRAIAFYEQLGFTVGDRFTTGYTLACWMEGLDSR
FT                   IELIQIPQPKPAPDAFADEHYVGYYHLSFDLTEITPDLHNWLSDLKAQIAAITELQPLT
FT                   VLLQPTQQQIGDHILEVAFIADADGLALEFIRFLGKLGDR"
FT   gene            331078..333891
FT                   /locus_tag="Aazo_0331"
FT   CDS_pept        331078..333891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0331"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   npu:Npun_R4998 peptidase M16 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62914"
FT                   /db_xref="GOA:D7DZG2"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZG2"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ADI62914.1"
FT                   /translation="MFVISVFHRYRIPLLLFIFSLIAAVLLKHPVSERQNLAIPQWEHS
FT                   QQIFVNKKTNILTLTTRNVQKTMLENGLTVLTKEVHNAPVVTVQVWYKVGSGNEQPGMN
FT                   GIAHQLEHIMFKGTKNRPVQFGQLFSALGSDSNAFTSYEQTAYYNTAESDKLKALLELE
FT                   ADRMQNSLIDHQQLASEKQVVISELEGYENSPKYRLKRAVLKSIFPDHAYGLPTGGTKA
FT                   DVEQLTVEQVREYYQKYYTPDNAVLVIVGDFQTPQTLETVEEIFGKIPQGQTLLPKPTP
FT                   PIPQFPSSPIVLREPGAGKLLQVIYPLPDVNHPDVPILGVMDYILTGGKNSYLYQVLVK
FT                   SGLANDVSAHVASLGAIGWYDLYVNTSPNQDLRKVEDSIKTAITKLLKRGVTSEQVKRA
FT                   ITQLTASVILNRRDITGQGMQFANDQLIAGDDRYTERYLENVRQVKSEDVIAVIKKYLK
FT                   PEAQVVGFFEPQDNANYDHRPSTSVGTEENLTSGVTATPSDVIKYLPNLDDTNNKLNHP
FT                   ILQKLTLANGLRVLLLPGNSSPTVTLSGYIKAGKEFEENEQAGLASLVADNLMSGTKTK
FT                   DALTIAKILEDRGASLNFTAQREGVRIQGKSLREDFSVLLATMVDVVRNSTFPVQELKL
FT                   TRQQALNALNVELDDPYQVANRQFIQSLYPQNHPSHTFATKETIQRITQRDAIAFKQKH
FT                   YRPDSMVLVLVGDFDVEKVRSLIENQFGDWRVSGKAPMVEYPIVVMTDKGVRVNSVLPG
FT                   KSQAVTYMGYTGIKRQDPRFYQALVLNQILGGDSLSSRLGAEVRDRLGLTYEIYSNFQG
FT                   GKNIGTFLIEMQTSPEDTNKAIATTRKLLKQLHQQGVTELEVETAKRTLISNYHISLSK
FT                   PEQLTARILMNEVYELDEMELRGFVEKIQKVTKNEVNQVARQLLYPDKFVVVTAGPAIM
FT                   AEVIGDW"
FT   gene            334008..334444
FT                   /pseudo
FT                   /locus_tag="Aazo_0332"
FT                   /product="hypothetical protein"
FT   gene            335091..335921
FT                   /locus_tag="Aazo_0333"
FT   CDS_pept        335091..335921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0333"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="KEGG: npu:Npun_R4996 methionine aminopeptidase, type
FT                   I; TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62915"
FT                   /db_xref="GOA:D7DZG3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZG3"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ADI62915.1"
FT                   /translation="MMNIFSSLLSQPVQPKPAPKQRRGIEIKSPREIEIMRQSAKIVAT
FT                   VLKEISELVKPGMTTADLDTHAEKRIRQMGATPSFKGYHGFPASICSSINNEVVHGIPS
FT                   PKKVIRAGDVLKVDTGAYYQGFHGDSCITIAVENVTPEAAKLIRVAEEALFKGIEQVKA
FT                   GIHLVEIAAAIEDHIKANDFNVVEQFTGHGVGRNLHEEPAVFNYRTRDIPNVKLRAGMT
FT                   LAIEPILNAGSKNTRILADRWTAVTVDNALSAQFEHTVLVTDSGYEILTDRSLV"
FT   gene            336084..337481
FT                   /locus_tag="Aazo_0334"
FT   CDS_pept        336084..337481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0334"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: npu:Npun_R4994 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62916"
FT                   /db_xref="GOA:D7DZG4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZG4"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ADI62916.1"
FT                   /translation="MNEIDLAFTPALKLAQLIRLRVVSPLDVVEIYLERIYRLNPQLGS
FT                   YFTVTADLAVADAKAKTELLTTTSELPPFFGVPISIKDLNAVAGITCTYGNAALLNHIP
FT                   NYDDGVVIRIKQAGFTIIGKTATSELGSYPYSEPVGFPPARNPWNLEYTPGGSSGGAAA
FT                   SVAAGLSAIAQGSDGGGSIRGPAACCGVVGIKPARGRVTKAPVGDRLGGIAVNGPIART
FT                   VADAAAMLDVISGYFTGDPYWLSDPQPSFFAATQVKNLRLKIAFSTSVPPLGAADKNCQ
FT                   QGVLQTVELLEEFGHEVEERCPDFSGLVEPFQIVWQSGVAAAGIPPEALQPLNRWLLAR
FT                   TGSLAEYLQALAQMQIFSRSIVAFFDTVDVLVLPVYLHSPIRVGEWENLSPEETFQNII
FT                   NWVAPCPVANATGLPAIAIPVGFDSNGLPMSVQLVGKPAAESTLISLAAQLETANPWIQ
FT                   HRPVFAL"
FT   gene            337481..338008
FT                   /locus_tag="Aazo_0335"
FT   CDS_pept        337481..338008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0335"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="KEGG: npu:Npun_R4993 cyclic nucleotide-binding
FT                   protein; PFAM: cyclic nucleotide-binding; SMART: cyclic
FT                   nucleotide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62917"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZG5"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADI62917.1"
FT                   /translation="MQASLAQITQIKVFADLETTDQLNLQPYTVVKPYGKGEIIFHESD
FT                   SLPAKLYAVASGVIKVSKTATTGKETILRNLGTREIFAAPALLGNGISPATVTAESDCE
FT                   ILTVEQDALLTAIQQKPDIPLRMLVVFNNRIQQLHETVHGLVSERAIIRFSTSEISSIF
FT                   RYYIGNRNNSKR"
FT   gene            338089..338181
FT                   /locus_tag="Aazo_0336"
FT   CDS_pept        338089..338181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0336"
FT                   /product="cyclic nucleotide-binding domain-containing
FT                   protein"
FT                   /note="KEGG: ava:Ava_4550 cyclic nucleotide-binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62918"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZG6"
FT                   /inference="similar to AA sequence:KEGG:Ava_4550"
FT                   /protein_id="ADI62918.1"
FT                   /translation="MKPLISYHRGGEITIIDIDKLNYIPDGKID"
FT   gene            complement(338292..338585)
FT                   /locus_tag="Aazo_0337"
FT   CDS_pept        complement(338292..338585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0337"
FT                   /product="nitrogen regulatory protein P-II (GlnB, GlnK)"
FT                   /note="KEGG: ava:Ava_2164 nitrogen regulatory protein P-II
FT                   (GlnB, GlnK)"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62919"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZG7"
FT                   /inference="similar to AA sequence:KEGG:Ava_2164"
FT                   /protein_id="ADI62919.1"
FT                   /translation="MKIVKRIEILSNSLELQNILKKLDNAGVSGYKIIQHVIGKGNRGR
FT                   VIDDLEGHGLTNGSIMNTCSEEREYQVVEAIRPVLKKFGGVCVVSDPKSIIH"
FT   gene            complement(338590..340925)
FT                   /pseudo
FT                   /locus_tag="Aazo_0338"
FT                   /product="hypothetical protein"
FT   gene            complement(339131..340392)
FT                   /pseudo
FT                   /locus_tag="Aazo_0339"
FT                   /product="hypothetical protein"
FT   gene            complement(341195..341686)
FT                   /locus_tag="Aazo_0340"
FT   CDS_pept        complement(341195..341686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all0619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62920"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZG8"
FT                   /inference="similar to AA sequence:KEGG:all0619"
FT                   /protein_id="ADI62920.1"
FT                   /translation="MSSLISTFSHHLDFSQPEIEAILSTPLNEVLNSPALKQELDSLDI
FT                   NLLRETLPTAGAVLATHLPPFYNWLKNELGVKRVPDSPDHTTKWVIGFLNNQESINHLV
FT                   ELHRPVPHAALEMAVPRLVGLFDGVEDIKVCQEWKKAVAALCLVLVVDAREQEKLAKIG
FT                   "
FT   gene            complement(341709..342041)
FT                   /pseudo
FT                   /locus_tag="Aazo_0341"
FT                   /product="hypothetical protein"
FT   gene            complement(342073..342849)
FT                   /pseudo
FT                   /locus_tag="Aazo_0342"
FT                   /product="hypothetical protein"
FT   gene            complement(343356..344351)
FT                   /locus_tag="Aazo_0343"
FT   CDS_pept        complement(343356..344351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0343"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="TIGRFAM: ketol-acid reductoisomerase; KEGG:
FT                   npu:Npun_F3618 ketol-acid reductoisomerase; PFAM:
FT                   Acetohydroxy acid isomeroreductase catalytic domain
FT                   protein; acetohydroxy acid isomeroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62921"
FT                   /db_xref="GOA:D7DZG9"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZG9"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ADI62921.1"
FT                   /translation="MARMYYDEDANLDLLTGKTVAIIGYGSQGHAHALNLKDSGVNVIV
FT                   GLYSGSKSTAKAEAAGLRVRSVSDAAKAADLIMILLPDEVQRTIYKNEIEPNLEAGNIL
FT                   AFAHGFNIHFGQVVPPADVDVIMVAPKGPGHLVRRTYEQGQGVPALFAIYQDATGKARE
FT                   RAMAYAKGIGGTRAGVLETTFREETETDLFGEQAVLCGGLSALIKAGFETLIEAGYQPE
FT                   LAYFECLHEVKLIVDLVVEGGLATMRDSISNTAEYGDYTRGPRVVTGQTKVEMKKILSE
FT                   IQSGQFAREFVLENQAGKPGFTAMRRQEAEHPIEEVGKDLRAMFSWLKKA"
FT   gene            complement(344472..344711)
FT                   /pseudo
FT                   /locus_tag="Aazo_0344"
FT                   /product="hypothetical protein"
FT   gene            344889..345188
FT                   /pseudo
FT                   /locus_tag="Aazo_0345"
FT                   /product="hypothetical protein"
FT   gene            complement(345647..346756)
FT                   /pseudo
FT                   /locus_tag="Aazo_0346"
FT                   /product="hypothetical protein"
FT   gene            346945..348388
FT                   /pseudo
FT                   /locus_tag="Aazo_0347"
FT                   /product="hypothetical protein"
FT   gene            348478..348699
FT                   /locus_tag="Aazo_0348"
FT   CDS_pept        348478..348699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cyh:Cyan8802_3436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62922"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZH0"
FT                   /inference="similar to AA sequence:KEGG:Cyan8802_3436"
FT                   /protein_id="ADI62922.1"
FT                   /translation="MNETTVGEQNSSESDDLLPEYNFDYSKACPNRFASTSEKRITVIL
FT                   DPDVAKIFQISEGLNRALGCLLSAIPEK"
FT   gene            complement(348817..349020)
FT                   /locus_tag="Aazo_0349"
FT   CDS_pept        complement(348817..349020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0349"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tuberin"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62923"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZH1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62923.1"
FT                   /translation="MYIKPFLRVDPIVNDTLDKNSKSCAFTQGHRYTTLALVQKANKTS
FT                   ELVASPDEDVNVSPEENVHTEK"
FT   gene            complement(349317..349427)
FT                   /locus_tag="Aazo_0350"
FT   CDS_pept        complement(349317..349427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62924"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZH2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62924.1"
FT                   /translation="MQVSRLGGKIYNYVMANVARRNQAIPRVSSNLHFVK"
FT   gene            349557..350308
FT                   /pseudo
FT                   /locus_tag="Aazo_0351"
FT                   /product="hypothetical protein"
FT   gene            350491..351804
FT                   /locus_tag="Aazo_0352"
FT   CDS_pept        350491..351804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0352"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   ava:Ava_4556 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62925"
FT                   /db_xref="GOA:D7DZH3"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZH3"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADI62925.1"
FT                   /translation="MNAMSNEKTQSVYASTLASIINTENAVLPWEKLEPSQQQHIQQAI
FT                   DSQTHPSCIVYPHTQAQLAAVIATANRKKWCVLPCGSTSKLNWGGLSKNIDIVVSTERI
FT                   NQLIEHAVGDLTITVEAGIKFGELQEILARSRQTLALDPAFPNSATIGGIVATADTGSL
FT                   RQRYGGVRDQLLGITFVRADGQIAKGGGRVVKNVAGYDLMKLFTGSYGTLGIISQVTFR
FT                   VYPLPETSGTVVLTGKVEAISQAVTILQGSELTPTQADLISNQLVFRLGLGTGVGLITR
FT                   FQSISESVKEQSNRLLSVGEQLGLHGAIYSGENEVELWQRLPEQIYSNVTSSLIICKIG
FT                   VMPTTGIEVINQISTGLIHLSSGLGLVSLENEDLVLTLRNLCQSNCGFLGVLAASVEIK
FT                   KRLGVWGYTGNALHIMRGIKEQFDGNYILSPGRFVGGI"
FT   gene            351996..353345
FT                   /locus_tag="Aazo_0353"
FT   CDS_pept        351996..353345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0353"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: npu:Npun_F0763
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62926"
FT                   /db_xref="GOA:D7DZH4"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZH4"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADI62926.1"
FT                   /translation="MQVSDGGVNNVASIKNLKGFDESHPPDPKLIDSCVHCGFCLSTCP
FT                   SYRVLGKEMDSPRGRIYLMDAINEGRIALNTVTIEHFDSCLGCLACVSTCPSGVQYDKL
FT                   ISATRHQVERNYNRSLPDKLVRKLIFSLFPNPDILRILLFPLLVYQKLGVSKLLQATGL
FT                   IKAISPRLAAMESMLPEITLQCFQDNLPDVIPAKGDKRYRVGVILGCVQRLFFSPVNEA
FT                   TVRVLTANGCQVVIPKSQGCCAALPEHQGQTEQAQALARQMIDSFADTNVDFIIINAAG
FT                   CGHTLKEYGRILADDQEYAEKAKAFAAKVKDAQEFLANVGLTAKLSPLADKHLTLVNQD
FT                   ACHLLHGQKISVQPRQLLRKIPGVNLREPIDAALCCGSAGVYNMLQPEVAEELGKQKVQ
FT                   YLLNTGADLIASANPGCTLQIRKYLPGQNISVMHPMELLDYSIRGEKLKL"
FT   gene            353451..354668
FT                   /locus_tag="Aazo_0354"
FT   CDS_pept        353451..354668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0354"
FT                   /product="acetate kinase"
FT                   /note="KEGG: ana:all2561 acetate kinase; TIGRFAM: acetate
FT                   kinase; PFAM: acetate and butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62927"
FT                   /db_xref="GOA:D7DZH5"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZH5"
FT                   /inference="protein motif:TFAM:TIGR00016"
FT                   /protein_id="ADI62927.1"
FT                   /translation="MKILVLNAGSSSQKSCLYEIPDANLPKEVLQPLWEGKVDWNQERN
FT                   EPEIEVKTATGAVLQESIDGDSRAVQVAYMLDTLTRGATQVIRQLSEIDVVGHRVVHGG
FT                   LYYRHSVVITEDIKKAITHLSPLAPAHNPAAVEGIEAIKKSLGTITQVAVFDTSFHSTL
FT                   PDAAAIYPGAYEWVEQGIRRYGFHGISHQYCANRAAQILNRDLTSLRLITCHLGNGCSL
FT                   AAIKNAKSVDTTMGFTPLDGLMMGSRSGSIDPGILIHLLRQSDYSVEELDYVLNKTSGL
FT                   KGISGISGDLREIMTAINQGSERAQLAYDIYVHRLQTGIGSMLASLGGLDALVFTAGVG
FT                   EKSPGIRQSACEAWEFLGLKIDPEKNQQQPVDVDIATLDSNVRILVIHTQEDWEIAQQC
FT                   WHLLQE"
FT   gene            354694..355479
FT                   /locus_tag="Aazo_0355"
FT   CDS_pept        354694..355479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr1259 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62928"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZH6"
FT                   /inference="similar to AA sequence:KEGG:alr1259"
FT                   /protein_id="ADI62928.1"
FT                   /translation="MFLSREFIITPLVACFCIVGISFSQLPRLHKLLNSKESMSVEALE
FT                   REQEKERFRLGLLQEIPTFGYDNIIANWVYVDFLQYFGDNEVRDKIGYTLSPEFFEVVL
FT                   KRDPKFLEAYLGLFVSTSLYAGMPERTIAIMDNGLKSMSPNLPAKSYYIWRYKGTDELL
FT                   FLGDSQAARKSFLQAAEWASKYDDQESKNVVFISQKTAEFLRNNPDSKFARIATWTMVL
FT                   QNNVDERNRKRAIKEIENLRGKVVINSNGVPAVILPEKD"
FT   gene            355645..356496
FT                   /locus_tag="Aazo_0356"
FT   CDS_pept        355645..356496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0356"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG:
FT                   npu:Npun_F4880 aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62929"
FT                   /db_xref="GOA:D7DZH7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZH7"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ADI62929.1"
FT                   /translation="MFVAYSSCQLSLVTFFPVPFMYWYCNKLIESQKLELDINDPGLIY
FT                   GATVFTTLRVYDHSLDHNLTNWQAHCSRLQFSLQTFDWTEPDWDFVRQGAEILLQHFPV
FT                   LRITIFPDGREWITGRLLPENLTQKQKHGIIATLTNGEFARSLPSHKTGNYLSAWLARN
FT                   IVQSSKAEEVILIDCEGNWLETSTGNLWGWKEESWWTPPLTVGILPGIERSHIITHLEK
FT                   RQTTIQQQLWTPELVKKLEAISYTNSVVEIIPIHTVQQPIGSLEYNPYHPCYSQLKGLF
FT                   LP"
FT   gene            356612..358453
FT                   /locus_tag="Aazo_0357"
FT   CDS_pept        356612..358453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0357"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: npu:Npun_F4881 ATP-dependent
FT                   metalloprotease FtsH; PFAM: peptidase M41; AAA ATPase
FT                   central domain protein; peptidase M41 FtsH extracellular"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62930"
FT                   /db_xref="GOA:D7DZH8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZH8"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADI62930.1"
FT                   /translation="MNKRWRNTGLYALLFIVVIALGTAFFDNQPPQVETWRYSQFIQEV
FT                   ESGRVEKVSLSSDRSTAMVTPKYDPNKKRVTLVNDPDLINTLTTKGVDIAVLPQTDEGF
FT                   WFKALSSLFFPVLLLVGLFFLLRRAQSGPGSQAMNFGKSKARVQMEPQTQVTFGDVAGI
FT                   DQAKLELNEVVDFLKNADRFTAVGAKIPKGVLLVGPPGTGKTLLARAVAGEAGVPFFSI
FT                   SGSEFVEMFVGVGASRVRDLFEQAKTNAPCIVFIDEIDAVGRQRGAGLGGGNDEREQTL
FT                   NQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVVVDRPDYGGRSEILKVH
FT                   ARGKTLSKDVDLDKIARRTPGFTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVL
FT                   AGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSE
FT                   DRMDTGLYSRAYLENQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMITRFG
FT                   MSDRLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRKLVDVAYARAKEVLVNN
FT                   RHILDEIAQMLIDKETVDADELQEVLANNDVKTAAFA"
FT   gene            358572..360466
FT                   /pseudo
FT                   /locus_tag="Aazo_0358"
FT                   /product="hypothetical protein"
FT   gene            360940..361572
FT                   /pseudo
FT                   /locus_tag="Aazo_0359"
FT                   /product="hypothetical protein"
FT   gene            complement(362020..362343)
FT                   /locus_tag="Aazo_0360"
FT   CDS_pept        complement(362020..362343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F4074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62931"
FT                   /db_xref="GOA:D7DZH9"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZH9"
FT                   /inference="similar to AA sequence:KEGG:Npun_F4074"
FT                   /protein_id="ADI62931.1"
FT                   /translation="MMNHYSIEWIEAWCMENGWTDLFVERRGNYWAFPPGGVMPEPIPV
FT                   HVLRVIKEENGLTNQELFWSLAAVFITILSVIYTFAFKCPIPLVFAFAFNAVTVAQLEP
FT                   EDV"
FT   gene            362380..362526
FT                   /locus_tag="Aazo_0361"
FT   CDS_pept        362380..362526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62932"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZI0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62932.1"
FT                   /translation="MNIDLSQILDKVINAYKLNANSIIMNEIISKLSSAVYIAVPNQKD
FT                   NRE"
FT   gene            362772..363263
FT                   /locus_tag="Aazo_0362"
FT   CDS_pept        362772..363263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0362"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   npu:Npun_R4073 pentapeptide repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62933"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZI1"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ADI62933.1"
FT                   /translation="MMYSRQGLALLLTVIICWVASPVLADWTHPLSFSNAELGRQDFSG
FT                   QSLQAAEFSNANLEMANFAGADLRGTVFSASVMTKANLHGANLTNAMVNEVKLNGADLS
FT                   DAILLEALLLRSIFTDVNIEGADFSDAILDRSQIQELCKKASGVNSQTGVETRESLGCR
FT                   "
FT   gene            363254..364393
FT                   /locus_tag="Aazo_0363"
FT   CDS_pept        363254..364393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0363"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   ATPase subunit; KEGG: npu:Npun_R4072
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62934"
FT                   /db_xref="GOA:D7DZI2"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZI2"
FT                   /inference="protein motif:TFAM:TIGR01161"
FT                   /protein_id="ADI62934.1"
FT                   /translation="MSIKRIGIIGGGQLAWMMVHASKKLGIELIVQTPSKNDPAVSIAQ
FT                   AIVLAAVDDAAATEFLSKKCDVITFENEFVNLDALSLLETQGVCFRPRLAALSPLLDKY
FT                   HQRCYLRDLGLRVPQFFALGKSADIQSKIEYLGFPIVLKARRHGYDGQGTFIIHDLATL
FT                   STVVNKSNTQLLVEEFVPFTRELAIIAARSVNGEIVTYPVVETQQEQQVCRRVIAPADI
FT                   TPEQAAEINVIAHIILNSLQAVGIFGIELFITADGKILINEIAPRTHNSGHFSLDACET
FT                   SQFEQHLRAVTGLPLTNTSLNCPSAVMVNLLGYENSHSDYSKQRQKLIDIPQAYLHWYG
FT                   KTESRPRRKLGHITVLLERQSRDMIESIIQTIESIWYPG"
FT   gene            364511..364694
FT                   /locus_tag="Aazo_R0003"
FT   ncRNA           364511..364694
FT                   /locus_tag="Aazo_R0003"
FT                   /product="6S RNA"
FT                   /note="6S / SsrS RNA as predicted by Rfam (RF00013), score
FT                   96.67"
FT                   /ncRNA_class="other"
FT   gene            364925..366166
FT                   /locus_tag="Aazo_0364"
FT   CDS_pept        364925..366166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0364"
FT                   /product="processing peptidase"
FT                   /EC_number="3.4.24.64"
FT                   /note="KEGG: npu:Npun_R4070 peptidase M16 domain-containing
FT                   protein; PFAM: peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62935"
FT                   /db_xref="GOA:D7DZI3"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZI3"
FT                   /inference="protein motif:PRIAM:3.4.24.64"
FT                   /protein_id="ADI62935.1"
FT                   /translation="MFPASVFHLDNGLTFIHQEIPTTPVVVADVWVRAGATLEREPCFG
FT                   MAHFLEHMIFKGTDTLPPGEFDYNIEKMGGVSNAATSHDYAHYSLTTATPYLAETLPHL
FT                   GELLLNAAIPKDEFIRERDVVLEEIRACADDPDWIGYESLQKNVYRNHPYGRSVLGTEQ
FT                   ELMQQSPEAMRCFHRSHYQPENMTVVVVGGIGQEYAWELVNSSFADFSERSDSPVSDKI
FT                   PAPVITGICRRELILPRLEQARLMMAWIAPGVEQLRDGHGLDFLSVLLAQGRTSRLVYD
FT                   LREEKQLVQAICSNFSLQRESSLLTITAWLEPEYLERVESLIQEHLQNLQTIGITEQEL
FT                   NRTSRSLCNEYAFATETPNQLTSLYGYYHTIAQAELAVAYPQEIQSFDAQELQKLAQKY
FT                   LSPQSYAVTILKPY"
FT   gene            366305..367579
FT                   /locus_tag="Aazo_0365"
FT   CDS_pept        366305..367579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0365"
FT                   /product="processing peptidase"
FT                   /EC_number="3.4.24.64"
FT                   /note="KEGG: ava:Ava_4310 peptidase M16-like; PFAM:
FT                   peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62936"
FT                   /db_xref="GOA:D7DZI4"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZI4"
FT                   /inference="protein motif:PRIAM:3.4.24.64"
FT                   /protein_id="ADI62936.1"
FT                   /translation="MQNIDNSNSSIYRTVLPNAIVVLVVENQAADIIAGRIFVRAGSCY
FT                   EHREKAGLAHLLSSVMTKGCDGLSSLEIAEKVESVGASLSTHAGTDYFLLSLKTVSADF
FT                   ADILTLSGLLLRSPTFPETQVELEKRLALQDIRSQKEQPFNLAFEQMRQAMYQKHPYSM
FT                   SVLGTETTINSITRADLVEFHQTHFRPDNIVISIVGRITPQAALDLVGEVFGDWPQPPQ
FT                   LRPILDLPAISVKPKSCLKPLNTQQSVVMLGYMGPSVSAPGYAALKLLSTYLGNGLSSR
FT                   LFVELREKRGLAYEVSAMFSTRLFPASFIVYMCTAPENTSIALQRLRQEVELLCTTELS
FT                   TDELQTAKNKILGQYALGKQTNGQIAQIYGWYEILGLGIEFDQEFSELIKKVSSKLAMT
FT                   AANRYLQEPYLSLVGQEEAITTAVS"
FT   gene            367657..368481
FT                   /locus_tag="Aazo_0366"
FT   CDS_pept        367657..368481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0366"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="KEGG: npu:Npun_F4464 phosphomethylpyrimidine kinase;
FT                   TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62937"
FT                   /db_xref="GOA:D7DZI5"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZI5"
FT                   /inference="protein motif:TFAM:TIGR00097"
FT                   /protein_id="ADI62937.1"
FT                   /translation="MIKTNAKLIPVALTIAGSDSGGGAGIQTDLRTFAFHCVHGTSAIT
FT                   CVTAQNTVGVVRVDAMSKEAVIAQIRAVVEDIGVQAAKTGMLLNEEIITAVAREVTALE
FT                   IDHLVVDPVMVSRTGAQLIDDDAVQTLCDELIPQAAIITPNRYEAQILSGLEIVSLEDM
FT                   QTAAEIIFKKLGIKAVLVKGGVMSGSLRGVDVWFDGQRLETLTTQQIETKNTHGTGCTL
FT                   SAAITANLALGKDLWTAVQQAKDYVTTALTYSLEIGKGQGPVGHFFPLLVKG"
FT   gene            368744..369556
FT                   /locus_tag="Aazo_0367"
FT   CDS_pept        368744..369556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0367"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="KEGG: ava:Ava_2424 molybdenum ABC transporter
FT                   periplasmic-binding protein; TIGRFAM: molybdenum ABC
FT                   transporter, periplasmic molybdate-binding protein; PFAM:
FT                   extracellular solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62938"
FT                   /db_xref="GOA:D7DZI6"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="InterPro:IPR041879"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZI6"
FT                   /inference="protein motif:TFAM:TIGR01256"
FT                   /protein_id="ADI62938.1"
FT                   /translation="MEKTFSTKRRRLMILIATALATVLIAISLPILTPTAVEAQLNTNL
FT                   LISAAASLKDVLEEIKPLYQQSQPNVKISYNFGASGALEQQIEQGAPADIFISAAKKQV
FT                   DALEQKNLLVPGTRTVIAKNRLVLVVPNNVSRVSSFYNLKDAKVEKIAIGEPRSVPAGQ
FT                   YAQQVLEKLKIWELVKPKLVYTNNVRQVLASVESGNADAGLVYVTDAKISKNAKVVVGA
FT                   DEKYHSAIIYPLAVIKRSKNPDLARNFSQFLSSDQAKGIFKKYAFILP"
FT   gene            complement(369770..371461)
FT                   /locus_tag="Aazo_0368"
FT   CDS_pept        complement(369770..371461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0368"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="TIGRFAM: dihydroxy-acid dehydratase; KEGG:
FT                   npu:Npun_R3783 dihydroxy-acid dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62939"
FT                   /db_xref="GOA:D7DZI7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZI7"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ADI62939.1"
FT                   /translation="MSENIKSKFITQGVQRSPNRAMLRAVGFQDADFNKAIVGIANGYS
FT                   TITPCNMGINQLAQRAEMSLRNAGAMPQVFGTITISDGISMGTEGMKFSLVSREVIADS
FT                   IETACTGQSMDGVLAIGGCDKNMPGAMLAIARMNIPAIFVYGGTIKPGHYDGKDLTVVS
FT                   SFEAVGQHSAGKIDETELLEIERRACPGAGSCGGMFTANTMSSAFEAMGMSLPYSSTMA
FT                   AEDAEKADSTEKSAFILVEAIRKQILPRQLITRKSIENAISVIMAVGGSTNAVLHFLAI
FT                   ARAAGVELTLDDFETIRARVPVLCDLKPSGRYVATDLHKAGGIPQVMKILLVRDLLHGD
FT                   CLTISGQTVAEVLADIPAEPSPKQNVIRPWDRPIYAQGHLAILKGNLGTEGAVAKITGV
FT                   KKPIITGPARVFESEESCLDAILAGKIKAGDVIIIRYEGPKGGPGMREMLAPTSAIIGA
FT                   GLGDSVGLITDGRFSGGTYGMVVGHVAPEAAVGGNIALVEEGDSITIDANSRLLQVNIS
FT                   DAELASRRANWQPRPPRYTKGVLAKYAKLVSSSSVGAVTDLDLFGN"
FT   gene            complement(371647..372417)
FT                   /locus_tag="Aazo_0369"
FT   CDS_pept        complement(371647..372417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0369"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; TPR
FT                   repeat-containing protein; KEGG: npu:Npun_R5368
FT                   pentapeptide repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62940"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZI8"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ADI62940.1"
FT                   /translation="MKSQIISTAAFLLTISLPVTAQATNDDQIRQLLATKKCQNCQLIN
FT                   AGLALADLSGADLRGANLEGANLSRANLTGADLRSANLAGASLFGVNLSRAKLNEANLT
FT                   GADLRNTYLMNIELTNANLNGANFQGAVGIPLQIAKPEEFYAWGVAAADKGNLKPAIDY
FT                   FSQALALKPDYAGAYLSRGVASYQNLDRKNALEDAQMAAKLFEEQKNAEGVKTALAFIL
FT                   ELKTPYGEKVTTGKPSFMDFVGSLGSILLQFLPF"
FT   gene            complement(372594..373326)
FT                   /pseudo
FT                   /locus_tag="Aazo_0370"
FT                   /product="hypothetical protein"
FT   gene            373436..373558
FT                   /locus_tag="Aazo_0371"
FT   CDS_pept        373436..373558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62941"
FT                   /db_xref="GOA:D7DZI9"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62941.1"
FT                   /translation="MIRRSSPAGTRSILITLTFSIITLTFSIIKFSGFENSLDR"
FT   gene            complement(373906..377046)
FT                   /pseudo
FT                   /locus_tag="Aazo_0372"
FT                   /product="hypothetical protein"
FT   gene            complement(374224..376441)
FT                   /pseudo
FT                   /locus_tag="Aazo_0373"
FT                   /product="hypothetical protein"
FT   gene            complement(375151..376164)
FT                   /pseudo
FT                   /locus_tag="Aazo_0374"
FT                   /product="hypothetical protein"
FT   gene            complement(377009..377412)
FT                   /pseudo
FT                   /locus_tag="Aazo_0375"
FT                   /product="hypothetical protein"
FT   gene            377575..377960
FT                   /pseudo
FT                   /locus_tag="Aazo_0376"
FT                   /product="hypothetical protein"
FT   gene            378133..380691
FT                   /locus_tag="Aazo_0377"
FT   CDS_pept        378133..380691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R1202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62942"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZJ0"
FT                   /inference="similar to AA sequence:KEGG:Npun_R1202"
FT                   /protein_id="ADI62942.1"
FT                   /translation="MEPDKLARFKEYGEFILRKIDSVPQRPSQQEDWVPTSLDDCLMGL
FT                   REAAQKTLELATSPVKIGVMGEFSSGKSLLLGSLIGYADALPVSENPTTGNVTAIHIKP
FT                   QESFVTTKLGNYAVEYLSHEGVNECLHFMLGEANRRATAAGLPSLQVSKIQTGKDISNW
FT                   CEEAWKSSNNLELRYLLRELLLFLRAYQAYGEALCSKHYHIDAITAYEGLQLTEMPMAI
FT                   QTLKFEDIPSAHIRLPSAPQILETQLLQNSFPLIRRVHLEVKICREIWDLTGAEEFVLL
FT                   DFPGLGAANSGARDTFLSLRELAQVQTILVLLNGKSPGSDHANKIFTMMQQQRPGQDLK
FT                   DLILVGVGRFDQLPLDSEGRERTLDFLIEDHPNAQPLQTDVVFQKLKVLQTIIDGADAF
FT                   TTEKDRIVLLSPLLGLAELAKSSTTIKVGSEQFLANLDYPDYLDRSKRLQQKWGKLSER
FT                   LLTTDPGNSLGRQLNYFAQDGGINKLRELIQNHVATHGLKQLYKDTRRSADVIRQQQEQ
FT                   LKDIIAEIHEQGIPTADNPALIQLSLAIESLEKTYRSVQKDLGKEPLKDRRGVVVSDVI
FT                   KDELTFRILNWSQWTFLFNKSQNGTIAIAESKGAAGKLFDRGNRVNNSLPTKSDDFYPE
FT                   FAKTVKQLEEFARERICQAVVDLLNKLAHQVVLEREKLQVILNPEMEEFIEDKFGVEAA
FT                   DLFYKLLLGCDPNQWKEAIILEINNQDKSISPEIMFPLARQDEKHTIGQIFDWSPDRNQ
FT                   ISSRTANHQLFVLRLRDEITTSASLHLVQYVSEVNQQVNAELEGILDQIIPNLQNLSKK
FT                   EELLRYIAAGDLPPELAISTWLEILTKIATINESDIYEYL"
FT   gene            380766..384177
FT                   /pseudo
FT                   /locus_tag="Aazo_0378"
FT                   /product="hypothetical protein"
FT   gene            384271..385362
FT                   /locus_tag="Aazo_0379"
FT   CDS_pept        384271..385362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr1148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62943"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZJ1"
FT                   /inference="similar to AA sequence:KEGG:alr1148"
FT                   /protein_id="ADI62943.1"
FT                   /translation="MMQHLHQLFATENSQLAQALKFSLYGLEAVLNQALIEYPQDPGND
FT                   LCEQVLQELHTLLNHTRVTHIDIHDEPKLIQLHDTFNSDIELNFYLGDTHLQSQNDDDL
FT                   WNEIHRKLLRVPEYLATSWRKRALEMVQKVGATEDYVNLYHLPFIRDEIIYPGLNGSVQ
FT                   ARGLCLSKEAFLKSDIAQTYNYEYVHLLTGFVLLYIKLIEIEPDLHHALKSVFSFDVVS
FT                   LDSEPEQCHLYIKALSDRLERVQKYEDNTDPILNLRAWIDMDESIHSLVFVPPAERYSW
FT                   WGNLQQESRRILKKLADKAIQAGHDVKIRQLSGLYADICAYSKDDLQLDCGGTPGEVLT
FT                   CLRLYTRINEEQNPGRVIFRSLR"
FT   gene            complement(385417..385605)
FT                   /locus_tag="Aazo_0380"
FT   CDS_pept        complement(385417..385605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62944"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62944.1"
FT                   /translation="MRNLALVSLAGFLVTAAAFAIPKDSVAMNAPQTLLSQKLARKNPS
FT                   PTSPPRPISTPGSPRME"
FT   gene            complement(385996..386263)
FT                   /pseudo
FT                   /locus_tag="Aazo_0381"
FT                   /product="hypothetical protein"
FT   gene            complement(386445..387170)
FT                   /locus_tag="Aazo_0382"
FT   CDS_pept        complement(386445..387170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all1151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62945"
FT                   /db_xref="GOA:D7DZJ3"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZJ3"
FT                   /inference="similar to AA sequence:KEGG:all1151"
FT                   /protein_id="ADI62945.1"
FT                   /translation="MNRSAPYQPLLLRILHGVSGILVIAAIISGFLVYNTFDKRFGKIP
FT                   IPKIDPIQDIHGTVGLFLLLLLPAFTLYSFHAGEKRLLQPDFLQKLSQVGKPIWWVSLQ
FT                   RLTNTLMLIAAVLAVISGRMMKEEWLPIGELNHVWYYFHLTAWVIMICCLAIHVLMSAK
FT                   VVGAPLLLSMLSWKVRHEDSPKNWFSRLRGWFSNFPNHLQAGINQFVQGSLILRIIEVV
FT                   VLGGVITAFVLPLFFSAGE"
FT   gene            387271..388416
FT                   /pseudo
FT                   /locus_tag="Aazo_0383"
FT                   /product="hypothetical protein"
FT   gene            388424..389257
FT                   /locus_tag="Aazo_0384"
FT   CDS_pept        388424..389257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0384"
FT                   /product="D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /note="PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase; KEGG: npu:Npun_R1196 D12 class N6
FT                   adenine-specific DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62946"
FT                   /db_xref="GOA:D7DZJ4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZJ4"
FT                   /inference="protein motif:PFAM:PF02086"
FT                   /protein_id="ADI62946.1"
FT                   /translation="MIKSPLGYPGGKSRAIEKISEYLPETFTHFREPFVGGGSVFIYLK
FT                   EKFPQLKIWINDLNRELFLFWHFPQSDLSKLVSEVGHIKEHHKNGRLLFSELTSVDVNT
FT                   LSDSDRAVRFFVLNRITFSGTVESGGFSLGAFHKRFTNSSIELLEKSEHILTADVKITN
FT                   LDYSQLLHGDEKNVFIFLDPPYVKAEKPKLHGKRGDLHTVFDHIRLAKSLEKCPHKWLL
FT                   TYEDALQNHEDFTWTTITEWELQYGMNNYKQTKADLSKELFISNNQVSLNEENRI"
FT   gene            complement(389278..389508)
FT                   /locus_tag="Aazo_0385"
FT   CDS_pept        complement(389278..389508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62947"
FT                   /db_xref="GOA:D7DZJ5"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZJ5"
FT                   /inference="similar to AA sequence:KEGG:Ava_0388"
FT                   /protein_id="ADI62947.1"
FT                   /translation="MNKKIIYMGLIILPVYISNSTLGLITSILLAPKYTFPVIITHNTL
FT                   VTDANFLPDWKPICPRDDQTEDCLRSGNCKA"
FT   gene            390010..390804
FT                   /locus_tag="Aazo_0386"
FT   CDS_pept        390010..390804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0386"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="KEGG: npu:Npun_R0139 sec-independent protein
FT                   translocase, TatC subunit; TIGRFAM: Sec-independent protein
FT                   translocase, TatC subunit; PFAM: Sec-independent
FT                   periplasmic protein translocase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62948"
FT                   /db_xref="GOA:D7DZJ6"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZJ6"
FT                   /inference="protein motif:TFAM:TIGR00945"
FT                   /protein_id="ADI62948.1"
FT                   /translation="MTPSPDLDTINSPDTDMKGYSNSEANPLDELPDEVEMSFFDHLEE
FT                   LRRRIFYSLIAIALGVVGCFIVVKPLVQLLEIPAHGIKFLQLAPGEYFFVSIKVAGYSG
FT                   LVLASPFILYQIIQFVLPGLTRRERRLLGPVVLGSSILFVGGLTFAYSLLIPAALQFFI
FT                   NYGADVVEQLWSIERYFEFVLLLLFTTGLAFQIPIIQLLLGNLGIVSSTQMLAGWRFVI
FT                   MSAVVLGAILTPSTDPLTQSLLAGAVLGLYFAGIGLVKITGK"
FT   gene            complement(391194..392180)
FT                   /pseudo
FT                   /locus_tag="Aazo_0387"
FT                   /product="hypothetical protein"
FT   gene            complement(392483..393451)
FT                   /locus_tag="Aazo_0388"
FT   CDS_pept        complement(392483..393451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0388"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   npu:Npun_R1902 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62949"
FT                   /db_xref="GOA:D7DZJ7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZJ7"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADI62949.1"
FT                   /translation="MTYLETVAQFYSEVAQTPEVGLCCIQSTPLQLPGLKIPLPMQEMN
FT                   YACGTTVHTNELVNQPTVLYVGVGGGLEALQFAYFSRRPGAIIAIEPVEAMREAAARNL
FT                   EIAAQENPWFDTSFVKICPGDALNLPVTDASVDVLAQNCLFNIFEPADLTRALKEAYRV
FT                   LKPGGRLQMSDPITTRSIPKHLQQDKRLRALCLSGALTYQEHTQLIINAGFGQIEIRAR
FT                   RPYRLLDKQTYNLEENILLESLDSVSFKVDMPEDGACIFTGKTAIYAGTQTFFDDAAEH
FT                   ILQRGIAVAVCDKTAAKLAALKPTEIMVTGSTWYYDAGWCC"
FT   gene            complement(393566..394240)
FT                   /locus_tag="Aazo_0389"
FT   CDS_pept        complement(393566..394240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0389"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: ana:alr1194 two-component response regulator;
FT                   PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; transcriptional regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62950"
FT                   /db_xref="GOA:D7DZJ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZJ8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADI62950.1"
FT                   /translation="MTHILLVEDEVKLARFIELELSYEGYQVSVAYDGLTALTAARQLN
FT                   LDLIILDWMLPGVSGLEICRRLRASGDKVPIILLTAKDEVSACVAGLDAGADDYVVKPF
FT                   SLEELLARVRAHLRRSKETDSADILMFDDLSLNRSTGEVYRGQRLVELTAKEFDLLDYL
FT                   LTHPRQVITRDRILEEVWGYDFMGDSNVIEVYIRYLRLKLEANNEKRLLQTVRGVGYVL
FT                   RD"
FT   gene            complement(394593..394997)
FT                   /pseudo
FT                   /locus_tag="Aazo_0390"
FT                   /product="hypothetical protein"
FT   gene            395216..396133
FT                   /pseudo
FT                   /locus_tag="Aazo_0391"
FT                   /product="hypothetical protein"
FT   gene            complement(396193..397645)
FT                   /pseudo
FT                   /locus_tag="Aazo_0392"
FT                   /product="hypothetical protein"
FT   gene            complement(397695..398195)
FT                   /pseudo
FT                   /locus_tag="Aazo_0393"
FT                   /product="hypothetical protein"
FT   gene            complement(398572..399027)
FT                   /locus_tag="Aazo_0394"
FT   CDS_pept        complement(398572..399027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0394"
FT                   /product="Electron transfer DM13"
FT                   /note="PFAM: Electron transfer DM13; KEGG: ana:alr1534
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62951"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZJ9"
FT                   /inference="protein motif:PFAM:PF10517"
FT                   /protein_id="ADI62951.1"
FT                   /translation="MKFHLLVIVGMVIFFSLGCTKEIKSTPINNQPQSVKNMDNSVAAS
FT                   ESFKTLEHRIHGKVSFITENGISYLEFDKSFKTENRPDLFLNLYHSNTPAKYGIKEKDY
FT                   ARIAPLQKISGSQRYALPNNVKLANFGFLAMWCRSFNVSFGYAGLPK"
FT   gene            complement(399258..400031)
FT                   /locus_tag="Aazo_0395"
FT   CDS_pept        complement(399258..400031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R5620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62952"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZK0"
FT                   /inference="similar to AA sequence:KEGG:Npun_R5620"
FT                   /protein_id="ADI62952.1"
FT                   /translation="MYYHIISSQLHPIDFPILQNDKYIVRLAANEEELESVFRLRFEVF
FT                   NLELGLGFSGSNVTAMDRDKFDDVCHHLILIAKHTGKTIGTYRMQSYTMAGKGLGFDSA
FT                   DIFNLSKFPDLLLQSSVEVGRACIAKEYRNLHTFLLIWEGLANYLIWSGKEYFFGCASL
FT                   LTQCPVQANYAYHYFQHHDLMHPSILVEPNSEYSVEIAQDCPNIYNVEIPKILQAYLSI
FT                   GAKICSLPAIDRQFKTIDFLILSNITDFAKFMLWE"
FT   gene            complement(400050..400157)
FT                   /locus_tag="Aazo_0396"
FT   CDS_pept        complement(400050..400157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62953"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZK1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62953.1"
FT                   /translation="MVKAQDLSVSSIQNRSTESLKRPKFKIQNRMTAAV"
FT   gene            complement(400346..400477)
FT                   /locus_tag="Aazo_0397"
FT   CDS_pept        complement(400346..400477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62954"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZK2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62954.1"
FT                   /translation="MVGCLCFSQKLELQGYIEISKPKEHQKYIKSKTLYHTTETILQ"
FT   gene            complement(401156..402076)
FT                   /locus_tag="Aazo_0398"
FT   CDS_pept        complement(401156..402076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0398"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: ava:Ava_2718
FT                   inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62955"
FT                   /db_xref="GOA:D7DZK3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZK3"
FT                   /inference="protein motif:PFAM:PF01513"
FT                   /protein_id="ADI62955.1"
FT                   /translation="MQLKQVIIAYKARDSQSKRWAELCAKQLEYHQCQVLVGPSGPKDN
FT                   PYPVFLASSSQPIDLALVLGGDGTVLTSARHLAPAGIPILGVNVGGHLGFLTESMDEFQ
FT                   DTEQVWDRLFEDRYALQRRMMLQAAVYEGDRTNLEPVTEQFLALNEFCVKPASADRMIT
FT                   SILEMEIDGEVVDQYVGDGLIVSTPTGSTGYTVSASGPIMHDGMEAITITPICPMSLSS
FT                   RPLILPPGSVVSIWPLGDYDLSTKLWMDGVLSTSIWPGHRVDVRMADCRAKFIVLRENN
FT                   SYYQTLREKLLWAGTRVRYSNNHRN"
FT   gene            complement(402083..402388)
FT                   /locus_tag="Aazo_0399"
FT   CDS_pept        complement(402083..402388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0399"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   npu:Npun_R5622 NADH-ubiquinone oxidoreductase, chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62956"
FT                   /db_xref="GOA:D7DZK4"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZK4"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ADI62956.1"
FT                   /translation="MQLQYFLLLAAALFCIGIYGLITSRNAVRVLMSIELLLNAVNLNL
FT                   MAFSNFLDSTLIKGQVFTVFVITVAAAEAAVGLAIVLAIYRNRDTVDMEQFNLLKW"
FT   gene            complement(402499..403116)
FT                   /locus_tag="Aazo_0400"
FT   CDS_pept        complement(402499..403116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0400"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6; KEGG: ava:Ava_2716 NADH dehydrogenase subunit J"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62957"
FT                   /db_xref="GOA:D7DZK5"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZK5"
FT                   /inference="protein motif:PFAM:PF00499"
FT                   /protein_id="ADI62957.1"
FT                   /translation="MNLAEGVQVISFGILGVMMIGAALGVVLFSNIVYSAFLLGGVFIS
FT                   MAGLYLLLNGDFVAAAQILIYVGAINVLILFAIMLVNKRQDFSPLPSAGLRKIITSLVS
FT                   IGLFGLLSTMVVATPWAYSSVPVAGESSIVLIGEHFFTDFLLPFELASILLLMAMVGAI
FT                   ILARREYLPDEVPSSDMPQTILTLPERPRELVSTGSGAGTEE"
FT   gene            complement(403292..403876)
FT                   /locus_tag="Aazo_0401"
FT   CDS_pept        complement(403292..403876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0401"
FT                   /product="NADH-plastoquinone oxidoreductase, I subunit"
FT                   /note="KEGG: ava:Ava_2715 NADH dehydrogenase subunit I;
FT                   TIGRFAM: NADH-plastoquinone oxidoreductase, I subunit;
FT                   NADH-quinone oxidoreductase, chain I; PFAM: 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62958"
FT                   /db_xref="GOA:D7DZK6"
FT                   /db_xref="InterPro:IPR004497"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZK6"
FT                   /inference="protein motif:TFAM:TIGR00403"
FT                   /protein_id="ADI62958.1"
FT                   /translation="MLKFLKQVGDYAKEALQSARYIGQGLSVTFDHMQRRPITVQYPYE
FT                   KLIPGERFRGRIHYEFDKCIACEVCVRVCPINLPVVDWEMDKATKKKKLKHYSIDFGVC
FT                   IFCGNCVEYCPTNCLSMTEEYELASYDRHELNYDNVALGRLPYKVTDDPMVTPLRELVY
FT                   LPKGVLEPHRVPADAPRAGSRPEDLVEISEQ"
FT   gene            complement(404015..405133)
FT                   /locus_tag="Aazo_0402"
FT   CDS_pept        complement(404015..405133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0402"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: npu:Npun_R5626 respiratory-chain NADH
FT                   dehydrogenase, subunit 1; PFAM: respiratory-chain NADH
FT                   dehydrogenase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62959"
FT                   /db_xref="GOA:D7DZK7"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZK7"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ADI62959.1"
FT                   /translation="MNAGIDLQGTFIQSVRDLGIPPGVAKAIWMPLPMVLMLIGATVGV
FT                   LVATWLERKISAAAQQRIGPEYQGPFGLLVPVADGLKLIFKEDIVPAKADRWLFTLGPV
FT                   IVVIPVFLSFLIVPFGENIVITNVGMGVFLWIALSSIQPIGLLMAGYASNNKYSLLGGL
FT                   RAAAQSISYEIPLALSVLAIAMMSNSLSTVDIVNQQSNFGILGWNIWRQPLGFIIFWIA
FT                   ALAECERLPFDLPEAEEELVAGYQTEYSGMKFGLFYLGSYINLILSSLLVAILYLGGWH
FT                   FPVPIDLLGNVLGVSPNNPVLQVVTAALGITMTVLKAYFLVFLAILIRWTVPRVRIDQL
FT                   LDLGWKFLLPVGLVNLLLTAALKLAFPFAFGG"
FT   gene            405360..405479
FT                   /locus_tag="Aazo_0403"
FT   CDS_pept        405360..405479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0403"
FT                   /product="cytidylate kinase"
FT                   /note="KEGG: aap:NT05HA_0349 cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62960"
FT                   /db_xref="GOA:D7DZK8"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZK8"
FT                   /inference="similar to AA sequence:KEGG:NT05HA_0349"
FT                   /protein_id="ADI62960.1"
FT                   /translation="MGGADVKFLLLTPELLILPTKLSYFPALMAVIIEVQQQF"
FT   gene            complement(405667..406803)
FT                   /locus_tag="Aazo_0404"
FT   CDS_pept        complement(405667..406803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0404"
FT                   /product="2-methylcitrate synthase/citrate synthase II"
FT                   /EC_number="2.3.3.1"
FT                   /note="TIGRFAM: 2-methylcitrate synthase/citrate synthase
FT                   II; KEGG: ava:Ava_2713 citrate synthase; PFAM: Citrate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62961"
FT                   /db_xref="GOA:D7DZK9"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZK9"
FT                   /inference="protein motif:TFAM:TIGR01800"
FT                   /protein_id="ADI62961.1"
FT                   /translation="MTVCEYKPGLEGIPAAQSSISYVDGQKGILEYRGIRIEELAERST
FT                   FLETAYLLIWGELPNKEELAAFEDEVCTHRRIKYRIRDMMKCFPESGHPMDALQASAAA
FT                   LGLFYSRRDLHNPVYIRNAVVRLVAIIPTMVAAFQLMRKGNDPVKPRDDLDYAANFLYM
FT                   LNEKEPDPLAARIFDICLILHVEHTMNASTFSARVTASTLTDPYAVVASAVGTLGGPLH
FT                   GGANEEVIEMLEEISCVDNVRSYIEDRLQKKAKIMGFGHRVYKVKDPRATILQRLAEQL
FT                   FDKFGYDKYYEVAQEVEWVMAEKVGSKGIYPNVDFYSGLVYRKMGIPTDLFTPVFAIAR
FT                   VAGWLAHWKEQLAENRIFRPTQVYNGRHEITYTPIDKR"
FT   gene            complement(406916..407410)
FT                   /pseudo
FT                   /locus_tag="Aazo_0405"
FT                   /product="hypothetical protein"
FT   gene            complement(407559..407729)
FT                   /locus_tag="Aazo_0406"
FT   CDS_pept        complement(407559..407729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cyp:PCC8801_4040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62962"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZL0"
FT                   /inference="similar to AA sequence:KEGG:PCC8801_4040"
FT                   /protein_id="ADI62962.1"
FT                   /translation="MFEFIAFLLQRYHLVEPATQSLDIDLINDGFIGMWSERQDLTESN
FT                   AWVRSVIKNEW"
FT   gene            complement(408024..408719)
FT                   /locus_tag="Aazo_0407"
FT   CDS_pept        complement(408024..408719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0407"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: npu:Npun_R4328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62963"
FT                   /db_xref="GOA:D7DZL1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZL1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62963.1"
FT                   /translation="MNPKFQRFGVIDYRIFNADVDGKTKIDHVKDMLQNLVYHQLFPFG
FT                   RVLMDTWYAVNSFMLYIDSLDRIYYCPLKKNRLVDDTFAKGKDKPIELLEWSTEELEYG
FT                   KIIKIKGFPAQKKVKLFRVAISTNRTDYVATNDLSQSSTNFVQEVCKIRWRTEDFHREI
FT                   KQITGIESCQCRKARFQRNHIACEMLVWIRLKNLAYQTGQTVYQNKHRFLSNYLIQQLK
FT                   RPSLPMCLV"
FT   gene            408939..410615
FT                   /pseudo
FT                   /locus_tag="Aazo_0408"
FT                   /product="hypothetical protein"
FT   gene            complement(410923..412363)
FT                   /pseudo
FT                   /locus_tag="Aazo_0409"
FT                   /product="hypothetical protein"
FT   gene            complement(412535..413824)
FT                   /locus_tag="Aazo_0410"
FT   CDS_pept        complement(412535..413824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0410"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein; KEGG:
FT                   ava:Ava_2676 phosphoesterase, RecJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62964"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZL2"
FT                   /inference="protein motif:PFAM:PF01368"
FT                   /protein_id="ADI62964.1"
FT                   /translation="MYLNSPVTQFESFSLTTEPNPEEVEIDKESSYELPPLTRPSLPPS
FT                   NNGDGGIYLAQRGNSLALQKSDELQKTLLGHRHERHLVILQDFPDPDALSCAWAYQLIA
FT                   QQYDIKCEIIYAGTLSHQENIALVKLTTLPAQRWTMQTLKNKDLSSYQGFVLIDNQGTT
FT                   SQLLSAVQQAGLPLVVLVDHHSLQGELKAEFVDVRPYVRATATIFTQYLQAGLLGLDSS
FT                   ISQHVKCATALMHGLRSDTNRLMQAQEEDFMAAAYLSRFYDAQLLNAILQANRSKRVMD
FT                   VIERSLKNRIVQNNFSIAGVGYLRYDDRDAIPQAADFLVTEENVHTAVVYGIVHDEDDE
FT                   LEVVIGSLRTTKLTLDPDEFIKEAFGQDSTGRFFGGGRTGAGGFEIPMGFLSGGNENSA
FT                   YAKMKWEVYDAQIKQKLLKLVNPRDNPIQS"
FT   gene            complement(414338..414835)
FT                   /locus_tag="Aazo_0411"
FT   CDS_pept        complement(414338..414835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0411"
FT                   /product="HNH endonuclease"
FT                   /note="KEGG: ana:all2457 hypothetical protein; PFAM: HNH
FT                   endonuclease; SMART: HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62965"
FT                   /db_xref="GOA:D7DZL3"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZL3"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ADI62965.1"
FT                   /translation="MGKVLVLNASYEPLNITSWRRAIVLLIKGKAEHVEHNGKFIYSDF
FT                   PLPTVIRLRHYVRVPYKEIPLTRRNILHRDGHTCQYCSYTGDQLTLDHVMPRSRGGGDT
FT                   WENIVTACVPCNVKKGCRTPQEARMPLRHPPRQPYSSLYFEVTKHLKSGLHQEWQKYVI
FT                   GL"
FT   gene            415152..416339
FT                   /locus_tag="Aazo_0412"
FT   CDS_pept        415152..416339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0412"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="TIGRFAM: alanine racemase; KEGG: ana:alr2458 alanine
FT                   racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62966"
FT                   /db_xref="GOA:D7DZL4"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZL4"
FT                   /inference="protein motif:TFAM:TIGR00492"
FT                   /protein_id="ADI62966.1"
FT                   /translation="MFSSKQTPSFADSQERDTYAWFSQRAWVEIDLGALSYNVKQLVIF
FT                   LSSRTQLMAVVKADAYGHGSVTVAKTVLEAGASCLGVATVPEGIQLREGGIKAPILILG
FT                   ATHTLEQIHAIAQWKLQPTLCSPKQALEVSNTLEAINYNSPIPVHIKLDTGMSRLGTNW
FT                   QEAGDFVQLVQGLPHLDIASVYSHLATADSPDPAIMQQQHNRFEQAIAQIKARGIKIPS
FT                   LHLANSAATLADPKLHYDMVRAGLAIYGLYPATHLENKIKLQPVLQLKARVTHVKTIAA
FT                   GTGVSYGHQFIAPREMRIAVVGIGYADGVPRSLSNQMQVLLRGQRVHQIGTITMDQIML
FT                   DVSSIPDLQEGEIVTLLGEQGQEQISADDWANQLNTISWEILCAFKHRLPRVAVI"
FT   gene            416481..416562
FT                   /locus_tag="Aazo_R0004"
FT                   /note="tRNA-Leu1"
FT   tRNA            416481..416562
FT                   /locus_tag="Aazo_R0004"
FT                   /product="tRNA-Leu"
FT   gene            417886..418929
FT                   /locus_tag="Aazo_0413"
FT   CDS_pept        417886..418929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0413"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: npu:Npun_F5636 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62967"
FT                   /db_xref="GOA:D7DZL5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024186"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZL5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADI62967.1"
FT                   /translation="MTIPLSSYKLFHKLHPLSLLAQLSTRKVTGDLSVFTNLVSWSIYL
FT                   EEGKLTYATYSDKVFERLESHFQRLNQQIPAFNHAAYAEMGLMSEANNNNQLIANADYY
FT                   AICWLVKQEYITRAQAGMLIEELAKEVLESFICLKEGNYQLNAAHDLHELPKFCHLDLQ
FT                   SIVEHCQKQLNYRENSKPGIASNNNSQPQTQTENQLGEQYSKSRTISPAKQINHKNNQY
FT                   SLSKEFYTIACIDDSQAVLNSIQHFLDEETFSVVMINEPVKALMQIIRSKPDLILLDVE
FT                   MPNLDGYELCSLLRRHSLFKNTPIIMVTGRTGFIDKAKAKIVRSSGYLTKPFTRADLLK
FT                   VVAKHIG"
FT   gene            418993..419508
FT                   /locus_tag="Aazo_0414"
FT   CDS_pept        418993..419508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0414"
FT                   /product="CheW protein"
FT                   /note="KEGG: npu:Npun_F5638 putative CheW protein; PFAM:
FT                   CheW domain protein; SMART: CheW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62968"
FT                   /db_xref="GOA:D7DZL6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZL6"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ADI62968.1"
FT                   /translation="MTNPKVTLYYQPSQKSLPDSYLKFQLNQQTTAVLSIHHTQEAIIV
FT                   PVTSVTAIPNMPAFILGLMNWRSRIIWVIDLPKMFNLEGVDYPLQQYNIIVVNVESMVL
FT                   GLVVQEIKGTIKLIADDIHSPIGQVAASLVPYLCGCVEQKEETLLVLDAQNIVNYANSC
FT                   TDYSSSKV"
FT   gene            419659..421911
FT                   /locus_tag="Aazo_0415"
FT   CDS_pept        419659..421911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0415"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: ava:Ava_0061 chemotaxis sensory transducer;
FT                   PFAM: chemotaxis sensory transducer; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62969"
FT                   /db_xref="GOA:D7DZL7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZL7"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADI62969.1"
FT                   /translation="MFNKTDTAQTGNAQNTASLLASSKVNENKGEIINQPDITITDDNH
FT                   RNYVVRHLQKFKLNAKEVIFAITIGTLPVLGIGFMAYSFSSKSISKQIVRTQEAEVTSL
FT                   SDIINRFIFSKYGDIQIISHLPFLTNQEVGKISSFTEKQAILNRFIDTYKIYDHLAVFD
FT                   LNGRVMIQSRGGTSGQEKSRKYFQEVLRNNALVISQPETLKNNKVVIYIAAPVKDIVTQ
FT                   RTIAVARTRIPIDLLAAEIKNYFPNSDDYYLLDDSGKFIFSPKQDLLGQEATVIYPGLS
FT                   KFLNKRNGGEFTQVETINQPLQLVSYVPFKKIEGLPDLNWQLILAKDAASTLYPQRQFL
FT                   IATAQITAITALLMTLLAAGLIKLLTKQNHSESARIETLANEETNIPLSERKNEELPPA
FT                   LKEWHIQAHQESTFEQEWQEKDTLRLQLLKLINQIETAAQGNLTVHADVIDGEVGNIAN
FT                   IFNSIVENLRNIVIRVQQTTCQVNTSLDSNQDYFNYLAQEATTQVENINCSLTRIEQMT
FT                   NSMQVLAASAQKVSALAHHAHQTAAESEKVMDLTVQNVLSLQETAGETAKKVRYLGESS
FT                   QQISCVVSLINQIAMQTNLLAINAGIEAARAGEEGQGFAVVAEEVGELAARSAAATQEI
FT                   EQIIEKIKRDTNEVVQAMEVGNNQVVKSTQIFAHAKQSLNDILDISQQIDTLLNSIATA
FT                   SSSQLETSQLISKLMQDIAAISQLTKDSSLQISESLQKTAAISQQLKNNVETFKIN"
FT   gene            422073..425006
FT                   /locus_tag="Aazo_0416"
FT   CDS_pept        422073..425006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0416"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="KEGG: npu:Npun_F5640 CheA signal transduction
FT                   histidine kinase; PFAM: response regulator receiver;
FT                   ATP-binding region ATPase domain protein; CheW domain
FT                   protein; Hpt domain protein; SMART: response regulator
FT                   receiver; CheW domain protein; Hpt domain protein;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62970"
FT                   /db_xref="GOA:D7DZL8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZL8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADI62970.1"
FT                   /translation="MTSDKELEIQMQFLEEATDYLNTLETILLEIDTSKHIELEKINAA
FT                   MRTAHSIKGGAAMMGFKVLSNLAHRLEDSFKVLKTRNKSLEIDTHLQSLLLSGVDWLRQ
FT                   IVDLLSEKKSLDDKWLKTFCYPIFDELHQRLGDPSPEDVTTMLSPEDGQEIVPLLFETE
FT                   VEECLQHLESLLESHPTNDLKTAVDVMASELGGLGEMLQVHAFVRLCKSVNHYLESQPD
FT                   RYLEISQLALQAWRRSQALVLTNQRDRLPTEIKLGEVVINLTPQQINIPPIAINQEDTL
FT                   VAEKQVPDFESLEIELPPEIPSLDYKHIERKGEIIGVSKDKENHENTVRVPSKQLEEIN
FT                   DLFGEIIIQRNGLNSQLERLRKLVLGLSQRVQTLDQEHREVCSAYQKLFHQTMSSGVLT
FT                   PDEQVTDSEVISLEIDRYQKLNLLSQELMETIVQVAEVASDIQLSVDDTDQIARKLNKT
FT                   SKQVQRKLTQVRMRPLSDLVERFPRAIRDLNIEYDKNVQLKIEGGKTLIERSILEALNE
FT                   PLMHLLRNAFDHGIEDHATRHAQGKPEQGLIEIKGYHRSDRTIIAITDDGRGISLEKIR
FT                   QRAIAMGLDTALIAAASEEELLSLIFEPGFTTSDKVTALSGRGVGMDVVRNNLQLVRGD
FT                   IKVDTQPGIGTTFTLSVPFTLSVARVLLVESETGSGLNHRMILAFPTDLVAEIFLLGSD
FT                   QVFAMDGGEFLKWQDTMLPLMRLGNYFDFNCSHYNNLELESPTGINASSVLIIKNDHQP
FT                   VAVQIDRCWGEQEVAIRQVEGKIPLPDGFSNCTMLGDGRVVPLINTNELVSWITNNQRP
FT                   HRSSQLSNKSPATKLKTAFLKPQKHKPITSPTHQKGMILIVDDSINVRRYLALTLEKGG
FT                   YQVEQAKDGQDAWEKLESGLKVQAVICDIEMPRLDGYSFLERVKSNDILRNIPVAMLTS
FT                   RSSNKHRQLAMQLGARAYFSKPYNEQDLLRTLEKMIFRIVESGSVNN"
FT   gene            complement(425070..426050)
FT                   /pseudo
FT                   /locus_tag="Aazo_0417"
FT                   /product="hypothetical protein"
FT   gene            426390..427827
FT                   /pseudo
FT                   /locus_tag="Aazo_0418"
FT                   /product="hypothetical protein"
FT   gene            428252..430144
FT                   /locus_tag="Aazo_0419"
FT   CDS_pept        428252..430144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0419"
FT                   /product="Transketolase central region"
FT                   /note="KEGG: ava:Ava_1655 transketolase; PFAM:
FT                   Transketolase central region; Transketolase domain protein;
FT                   SMART: Transketolase central region"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62971"
FT                   /db_xref="GOA:D7DZL9"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZL9"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ADI62971.1"
FT                   /translation="MTTQEQLYQWQELAQQLRVDSIRATTIAGSGHPTSSMSSADLMAV
FT                   FLSKYLRYDFDHPENPNSDRFILSKGHAAPLLYSMYKAAGVISDQELLSLRQSGSRLEG
FT                   HPTPILPWVDVATGSLGQGLPIGVGVALAGKYLDQLPYNVWVLLGDGETAEGSIWEAFD
FT                   HASHYTLDNLLAIIDVNRLGQRGQTELGWNTQAYGNRAKAFGWQAIEIDGHNLTEIDQA
FT                   FSAAVAINDRPTVIIARTKKGKGVKALEDLGGWHGKALKQDQEQQAITELGGERHITIT
FT                   VDKPEEQSQPATLGVPQPLQLPIYQKGNKVATRRAYGDALLALGASQPDVVALDAEVSN
FT                   STYAEDFAEAFPERYFEMYIAEQQMIAAAVGLQVRKYKPFASTFAAFLTRGYDFIRMGA
FT                   VSRANIKLVGSHGGVSIGQDGASQMGLEDLAAFRAVCNSTVLYPSDANQTAKLVPQMSN
FT                   APGIVYLRTTRESTPVIYGSEEQFSIGGSKVIHRSERDQATIIAAGITVHEALKAYDRL
FT                   KNEGITARIIDAYSVKPIDVQTLHQAAKDTNGNLVVVEDHWPEGGLGAAVLDAFAGNST
FT                   TPAYKIPQLQIIKLAVQNMPTSGTPEELLHAAKIDADAIVEVVKSQVRRLVGVS"
FT   gene            complement(430272..431489)
FT                   /locus_tag="Aazo_0420"
FT   CDS_pept        complement(430272..431489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F2412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62972"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZM0"
FT                   /inference="similar to AA sequence:KEGG:Npun_F2412"
FT                   /protein_id="ADI62972.1"
FT                   /translation="MSVLFNSKFQITAGIVTFFLVVLAHQNLYAQSEIPQVITQPQITP
FT                   TESINLFSQQNQATSIFYSVIDEWQKYKYSVNGKQILKSVQLPTAKVNFNQADLLTVLT
FT                   NTRKYFQDNTDKDPNISRNGLLLSQGVTVQDVLKTLDFMITVLQEDISNNRPTRLQDPN
FT                   FINANFRVIKWSAYNLNYPQQKQLRITKYAVFKHPGSRSKTSQYNIPIYSLKDNLGNDN
FT                   FYTKYTKQDVLSGIYEPGGKEFGRVESLAYLTRQGLEEALMQGTILINFTDGSQGLFNV
FT                   DSNNGISYVIGVKPTLQKRYWYFRKVDEIKGYGYKIDAKISIKPGVTFAGDILNIGLGR
FT                   VIVMEYNQGGRKRLQMGVMADTGGAFLPNLHQLDFLAGIFEDQKDFRQHIQQLPEYGTP
FT                   YILVKK"
FT   gene            complement(431953..433215)
FT                   /locus_tag="Aazo_0421"
FT   CDS_pept        complement(431953..433215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0421"
FT                   /product="CemA family protein"
FT                   /note="PFAM: CemA family protein; KEGG: npu:Npun_F0259 CemA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62973"
FT                   /db_xref="GOA:D7DZM1"
FT                   /db_xref="InterPro:IPR004282"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZM1"
FT                   /inference="protein motif:PFAM:PF03040"
FT                   /protein_id="ADI62973.1"
FT                   /translation="MNGKFSTQYTRVISQKIKESWRLFDQWFSNTPERAILEAYEAAQA
FT                   IQRIEVEQFGGKKITHQSGNFSENVMAFWQGNLNRNLAIIRVRLAEFHVVLTFVNISDR
FT                   SFLEKLKFIDEVISKYVDQNKIINEPIENSIRAGKKQLNSSEPAIFKEASATQRTGVFP
FT                   RSISRTFNKIAQDFTPQAEEEFVKQYRTSRNRTIRAVKFFLILIIVPLLTQHFSKQLLV
FT                   NPVVKHFRYEKTTQIFINSLMEEKALNELKTFEQGLKFRSLVRQAPEISSENFEANVKN
FT                   KAIEIAEEFRNKTNGAISNLFADFISLISFAIVIVLSKKDIIFVQSFIDKLVYGLSDSA
FT                   KAFLIILLTDIFVGFHSPHGWEILLEGFAEHLGLPASRNGIFLFIATFPVVLNTIFKYW
FT                   IFSYLSRLSPSALATLKEMDE"
FT   gene            complement(433215..434306)
FT                   /pseudo
FT                   /locus_tag="Aazo_0422"
FT                   /product="hypothetical protein"
FT   gene            434782..435189
FT                   /locus_tag="Aazo_0423"
FT   CDS_pept        434782..435189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0423"
FT                   /product="ribosomal protein L21"
FT                   /note="KEGG: npu:Npun_R6114 ribosomal protein L21; TIGRFAM:
FT                   ribosomal protein L21; PFAM: ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62974"
FT                   /db_xref="GOA:D7E065"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:D7E065"
FT                   /inference="protein motif:TFAM:TIGR00061"
FT                   /protein_id="ADI62974.1"
FT                   /translation="MTYAIIETGGKQIKVEAGRFYDIELLSTQPDEKVTIDAVLLVQHE
FT                   GEVSIGQPRVAGATVEGTVMRHFRGRKVLVYKMKPKKKTRKKRGHRQETTRLLINSINL
FT                   NGEVLAYQEAPITPEIPNTMDSIPEEAVAAE"
FT   gene            435221..435499
FT                   /locus_tag="Aazo_0424"
FT   CDS_pept        435221..435499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0424"
FT                   /product="ribosomal protein L27"
FT                   /note="KEGG: ana:asl0146 50S ribosomal protein L27;
FT                   TIGRFAM: ribosomal protein L27; PFAM: ribosomal protein
FT                   L27"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62975"
FT                   /db_xref="GOA:D7E066"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:D7E066"
FT                   /inference="protein motif:TFAM:TIGR00062"
FT                   /protein_id="ADI62975.1"
FT                   /translation="MAHKKGTGSTRNGRDSNAQRLGVKRFGGQAVRAGNILIRQRGTKF
FT                   HPGNNVGIGSDDTLFALVDGVVTFERKGKTRKQISVYPAVAAEAVAS"
FT   gene            complement(435678..436103)
FT                   /locus_tag="Aazo_0425"
FT   CDS_pept        complement(435678..436103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0425"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R4450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62976"
FT                   /db_xref="GOA:D7E067"
FT                   /db_xref="UniProtKB/TrEMBL:D7E067"
FT                   /inference="similar to AA sequence:KEGG:Npun_R4450"
FT                   /protein_id="ADI62976.1"
FT                   /translation="MPTLNRIPWFSLALAVLSYSTLGWVISETKAPWFVWLIVAVAILL
FT                   LLASFTVSWSKLAEYYSMLFQSNIRSFGITVLAAFLFFLMIAWFRVFLDTLLLLSATIL
FT                   VKIDFQVAGFKEGIAFCLTSIISLAGLATGALLHRFI"
FT   gene            436551..437459
FT                   /locus_tag="Aazo_0426"
FT   CDS_pept        436551..437459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0426"
FT                   /product="protein of unknown function DUF422"
FT                   /note="PFAM: protein of unknown function DUF422; KEGG:
FT                   ana:all0144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62977"
FT                   /db_xref="GOA:D7E068"
FT                   /db_xref="InterPro:IPR007354"
FT                   /db_xref="UniProtKB/TrEMBL:D7E068"
FT                   /inference="protein motif:PFAM:PF04240"
FT                   /protein_id="ADI62977.1"
FT                   /translation="MKQLVIVERVCLIGHIVSMVFGLVGILLVIPNAELILSLSEVGQT
FT                   VMQWSMAGGGVAYMILGAVGVFLYAYRTLGLGRALCFLLPSVLISLTSELLGTSTGFPF
FT                   GNYSYLSGLGYKIAGLVPFTIPLSWFYVGCVSYLLARVGLEVDKKPSLFRHLGAIALGA
FT                   LLLTSWDFVLDPAMSQTSLPFWYWQQPGAFFGMPYQNFAGWMGTGSVFMTVAAVLWRNN
FT                   PVKLERAQLNIPLVVYLGNFGFATVMSLAAGFSIPVLLGLVLGVAPAVALWLRGPGAST
FT                   LVGVEPATKEVSVASVKVAFK"
FT   gene            437574..438740
FT                   /locus_tag="Aazo_0427"
FT   CDS_pept        437574..438740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0427"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   npu:Npun_R6005 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62978"
FT                   /db_xref="GOA:D7E069"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7E069"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADI62978.1"
FT                   /translation="MIIESTISLLLLLIQVPATALLLSRLLKGPRRYPPLQPQQPTPDM
FT                   LGRVSVIVPTLNEALRISPLLKGLSRQSYEVREVIVVDSRSQDGTPDLVQAAQQQDPRF
FT                   RVITDDPLPSGWVGRPWALHNGFLFSSERSEWFLGMDADIQPNSGLVASLVKTAQTEGY
FT                   DLVSLSPQFILKYPGECWLQPSLLMTLLYRFDPPGIYTEEAERVMANGQCFLCRRSVLA
FT                   SINGYMSAKSSFCDDVTLARNIAAAGFKVGFLDGAKLLKVRMYEGAMETWKEWGRSLDL
FT                   KDASNRAQIWGDLWLLSAVQGLPLIILLAYLPMSSSPYLPISLVLGLNIFLLFIRFALL
FT                   LVIAPSYDRKNAKGGWLFWLSPLADPLAVLRIFLSAFHTPREWRGRKY"
FT   gene            complement(438787..439695)
FT                   /locus_tag="Aazo_0428"
FT   CDS_pept        complement(438787..439695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0428"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="KEGG: npu:Npun_F6004 ribonuclease H; PFAM:
FT                   ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62979"
FT                   /db_xref="GOA:D7E070"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7E070"
FT                   /inference="protein motif:PRIAM:3.1.26.4"
FT                   /protein_id="ADI62979.1"
FT                   /translation="MSTERIIQSIYTDGACTGNPGPGGWAVVVYFNDGSVHEMGDVSRH
FT                   TTNNKMEMQAAIAALELFEKSGQTEPITLYTDSEYVINSVTKWMQGWKKKGWKKSDGNP
FT                   VQNQDLLQTLDQLNSRLVKWQHVRGHSGNIGNERCDVIARSFASGKIPSLQQLSPANPY
FT                   PTLTNTNQINVAKVCNSSINSTKINENISDSSNLSSDITTMEPSTASAATTNDEKPPEM
FT                   RVSQLRNLVETLRVADEIAEKGYLITSSELADLMDVHASAVTSRGDQWRWRNWIVSRVR
FT                   REGNQILWELERGDQIGTEAE"
FT   gene            440268..440747
FT                   /locus_tag="Aazo_0429"
FT   CDS_pept        440268..440747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0429"
FT                   /product="protein of unknown function DUF1499"
FT                   /note="PFAM: protein of unknown function DUF1499; KEGG:
FT                   ana:all4479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62980"
FT                   /db_xref="GOA:D7E071"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:D7E071"
FT                   /inference="protein motif:PFAM:PF07386"
FT                   /protein_id="ADI62980.1"
FT                   /translation="MYRLTALSQRLHSITFKIFLTLIISVILPGVTWVTGLGIDNGHLI
FT                   SCPASDNCVVSQNADANHNIEPITYHVDREKAKEVLLKVLTVVPRTEVIEQTDNYIHPL
FT                   SKSRIFKFVDGVEFYLPVDESVIHIRSASRVGESDLGVNPRRMEQIRLAMRDLNI"
FT   gene            complement(440788..441354)
FT                   /pseudo
FT                   /locus_tag="Aazo_0430"
FT                   /product="hypothetical protein"
FT   gene            441427..442362
FT                   /locus_tag="Aazo_0431"
FT   CDS_pept        441427..442362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0431"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /note="KEGG: npu:Npun_F0596
FT                   1-aminocyclopropane-1-carboxylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62981"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7E072"
FT                   /inference="similar to AA sequence:KEGG:Npun_F0596"
FT                   /protein_id="ADI62981.1"
FT                   /translation="MSSIFLPPAIQKINSQIADSVGVKLYVLRLDLMHSQVNGNKWFKL
FT                   KYNLLSAKEKNVSTILTFGGAYSNHIFATAAAGNIFGFRTIGVIRGEETFPLNPTLSFA
FT                   VEQGMQLVYCNRTTYRQRHTTQLQEDLKQRFDEVFIIPEGGCNLNGMRGCTEIMQNLEL
FT                   FDTICLACGTATTLAGIAISLHLKQKIIGFPILKGGEFLAAEIESLINNYLTSDLPALV
FT                   NSPAPWELVCDYHFGGYAKVNQELIMFCQKFTQEHDIPLDYVYTGKMFYGVMNLLQQGF
FT                   FQPGRLLLIHTGVLQGNQGINEKLLRKVFK"
FT   gene            complement(442401..442517)
FT                   /locus_tag="Aazo_0432"
FT   CDS_pept        complement(442401..442517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62982"
FT                   /db_xref="UniProtKB/TrEMBL:D7E073"
FT                   /inference="similar to AA sequence:KEGG:Mpe_A0746"
FT                   /protein_id="ADI62982.1"
FT                   /translation="MKYVLIIHEVEDYDSWKKVFDNAGDIRKQAGEIVYHDF"
FT   gene            complement(442542..444397)
FT                   /pseudo
FT                   /locus_tag="Aazo_0433"
FT                   /product="hypothetical protein"
FT   gene            complement(444485..445694)
FT                   /pseudo
FT                   /locus_tag="Aazo_0434"
FT                   /product="hypothetical protein"
FT   gene            complement(445825..446767)
FT                   /pseudo
FT                   /locus_tag="Aazo_0435"
FT                   /product="hypothetical protein"
FT   gene            complement(447003..449368)
FT                   /pseudo
FT                   /locus_tag="Aazo_0436"
FT                   /product="hypothetical protein"
FT   gene            complement(447848..448861)
FT                   /pseudo
FT                   /locus_tag="Aazo_0437"
FT                   /product="hypothetical protein"
FT   gene            complement(449395..450499)
FT                   /pseudo
FT                   /locus_tag="Aazo_0438"
FT                   /product="hypothetical protein"
FT   gene            complement(450591..451634)
FT                   /pseudo
FT                   /locus_tag="Aazo_0439"
FT                   /product="hypothetical protein"
FT   gene            complement(451668..452594)
FT                   /pseudo
FT                   /locus_tag="Aazo_0440"
FT                   /product="hypothetical protein"
FT   gene            452766..453222
FT                   /pseudo
FT                   /locus_tag="Aazo_0441"
FT                   /product="hypothetical protein"
FT   gene            complement(453334..454875)
FT                   /locus_tag="Aazo_0442"
FT   CDS_pept        complement(453334..454875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0442"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: npu:Npun_F4515 DEAD/DEAH box helicase
FT                   domain-containing protein; PFAM: DEAD/DEAH box helicase
FT                   domain protein; helicase domain protein; SMART: DEAD-like
FT                   helicase; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62983"
FT                   /db_xref="GOA:D7E074"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E074"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADI62983.1"
FT                   /translation="MNLTFQELGISQERVEILEKLSFTTPTNIQTQAIPQLLAGRDVVG
FT                   QSQTGTGKTAAFSLPMLEKLDVSKKAVQAVVLTPTRELAMQVHDAISQFMGNDGLRVLA
FT                   IYGGQSIDRQMMQLKRGVHVVVGTPGRVIDLLERGSLKLDQVKWFVLDEADEMLSMGFI
FT                   DDVIRILSQAPTERQTALFSATMPPSIRQLVNKFLNSPVTVTVEQPKAAPNKINQVAYL
FT                   IPRHWTKAKALQPILEMEDPETALIFVRTRRTAAELTNQLQAAGHSVDEYHGDLSQQAR
FT                   ERLLTRFRNRQVRWVVATDIAARGLDVDLLSHVINFDLPDSVETYVHRIGRTGRAGKEG
FT                   TAISLVQPFERRKQQAFERHNRQNWQVLTIPTRAQIEARHIKKLQEQVAEALTGERLAS
FT                   FLPIISELIEKYDAQAIAAAALQIAYDQTRPDWLQSGVDIPQEEPSPKPKLNKHRDSGE
FT                   YPRSGGGERERSRSSWSKSDNGGDEGRGTPKPRLRTTTQRESSVTPSQKLGSHRE"
FT   gene            complement(454972..456294)
FT                   /locus_tag="Aazo_0443"
FT   CDS_pept        complement(454972..456294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0443"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /note="TIGRFAM: RNA modification enzyme, MiaB family;
FT                   MiaB-like tRNA modifying enzyme YliG; PFAM: Protein of
FT                   unknown function UPF0004; Radical SAM domain protein;
FT                   deoxyribonuclease/rho motif-related TRAM; KEGG:
FT                   npu:Npun_F4514 MiaB-like tRNA modifying enzyme YliG; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62984"
FT                   /db_xref="GOA:D7E075"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/TrEMBL:D7E075"
FT                   /inference="protein motif:TFAM:TIGR00089"
FT                   /protein_id="ADI62984.1"
FT                   /translation="MGDKPTIAISHLGCEKNRIDTEHMLGLLVEAGYGVDTNDELADYV
FT                   IVNTCSFIEAAREESVKTLVELAEANKKVVITGCLAQHFQEQLLEELPEALAVIGTGDY
FT                   HKIVNVIERVEQGERVKQITPQPTYIADETTPRYRTTTEGVAYLRVAEGCDYRCAFCII
FT                   PHLRGNQRSRTIESIVAEAKQLASQGVKEIILISQITTNYGLDIYGKPKLAELLCALGK
FT                   VDVPWIRMHYAYPTGLTPDVIAAIQEIPNVLPYLDLPLQHSHPEILRAMNRPWQGRVND
FT                   TIIESIKTALPSAVLRTTFIVGFPGETQEHFEHLLEFTERHEFDHVGVFTFSPEEGTPA
FT                   YNLLNQLPQELMVERRDQLMALQQPISLLKNQQEVDKIVDVLIEQENPESGELIGRSGR
FT                   FSPEVDGQVYVKGDAGLGTIVPVKIHSADAYDLYGQIIMSN"
FT   gene            456517..456711
FT                   /locus_tag="Aazo_0444"
FT   CDS_pept        456517..456711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0444"
FT                   /product="telomerase reverse transcriptase; K11126
FT                   telomerase reverse transcriptase"
FT                   /note="KEGG: telomerase reverse transcriptase; K11126
FT                   telomerase reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62985"
FT                   /db_xref="GOA:D7E076"
FT                   /db_xref="UniProtKB/TrEMBL:D7E076"
FT                   /inference="similar to AA sequence:KEGG:LmjF36.3930"
FT                   /protein_id="ADI62985.1"
FT                   /translation="MAILTLLIFLNDSLIGILRYRSVCVVNLPIGKPPKGLFLRSRYPQ
FT                   GNRKRDCAHKAVMLPYILG"
FT   gene            457098..457946
FT                   /locus_tag="Aazo_0445"
FT   CDS_pept        457098..457946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0445"
FT                   /product="photosystem I assembly BtpA"
FT                   /note="PFAM: photosystem I assembly BtpA; KEGG:
FT                   ava:Ava_0640 photosystem I assembly BtpA"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62986"
FT                   /db_xref="GOA:D7E077"
FT                   /db_xref="InterPro:IPR005137"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:D7E077"
FT                   /inference="protein motif:PFAM:PF03437"
FT                   /protein_id="ADI62986.1"
FT                   /translation="MDLYQLFKTRTPIIGVVHLLPLPTSPRWGGSLKAVTDRAEQEATA
FT                   LASGGVDGLIVENFFDAPFTKNQVDPAVVSAMTVVVQRIQNLVTLPVGLNVLRNDGKSA
FT                   MAIASCVRAQFIRVNILTGVMATDQGLIEGEAHQLLRYRRELGSDVKILADVLVKHARP
FT                   LSSPNLTVAVKDTIERGLADGVILSGWATGSPPNLEDLELACGAAAGTPVFIGSGANWE
FT                   NIGTLMQAANGVIVSSSLKRHDQISQPIDPIRVSQFVEAAHRNWNSKGESKSSSSIKLH
FT                   S"
FT   gene            458046..459029
FT                   /locus_tag="Aazo_0446"
FT   CDS_pept        458046..459029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0446"
FT                   /product="Vitamin K epoxide reductase"
FT                   /note="KEGG: npu:Npun_R4512 vitamin K epoxide reductase;
FT                   PFAM: Vitamin K epoxide reductase; SMART: Vitamin K epoxide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62987"
FT                   /db_xref="GOA:D7E078"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:D7E078"
FT                   /inference="protein motif:PFAM:PF07884"
FT                   /protein_id="ADI62987.1"
FT                   /translation="MIHRRSTPWIHKWSRPLIGAITGLGILNTGYLTFEKLTGGNPVCT
FT                   TPEGVKGCTDVLSSPWGTVFGQPLALFGLLTYIGMLLLAVAPLALNSVEGNKNRKQIEN
FT                   LTWWLLLVGAITMSVFSGYLMYVLAFQLQALCLYCIASALFAVSILTLTILGRDWEDIG
FT                   QIFFTALIVGMVTLITTFSIYSDINTSGNIAEPTDGKTVQIFFDAKEEPKPQVGWQITT
FT                   TSGESEIQLAKHLTQIGAKEYVAWWCPHCHEQKLLFGKEAYKEINHIECASPDNPGTPT
FT                   QECIAAKIESYPSWVMNGKTYSGVQNLNELAKITGYTGPQNFKYFK"
FT   gene            459308..463029
FT                   /pseudo
FT                   /locus_tag="Aazo_0447"
FT                   /product="hypothetical protein"
FT   gene            complement(459705..460814)
FT                   /pseudo
FT                   /locus_tag="Aazo_0448"
FT                   /product="hypothetical protein"
FT   gene            complement(463214..464884)
FT                   /locus_tag="Aazo_0449"
FT   CDS_pept        complement(463214..464884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0449"
FT                   /product="L-aspartate oxidase"
FT                   /note="KEGG: npu:Npun_F4510 L-aspartate oxidase; TIGRFAM:
FT                   L-aspartate oxidase; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62988"
FT                   /db_xref="GOA:D7E079"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D7E079"
FT                   /inference="protein motif:TFAM:TIGR00551"
FT                   /protein_id="ADI62988.1"
FT                   /translation="MNLLDIPRQFDVLIVGAGAAGLYTALCLPESLRVGLITKDTITLS
FT                   ASDWAQGGIAAAVSPEDSPKLHIADTLKAGAGLCDVKAVKFLAEKAPICIQSLVNLGVA
FT                   FDRHGNTLALTLEAAHSRHRVLHAADTTGREVTTTLAAQVLLRPNIQVIQQALALSLWI
FT                   EPETNLCQGISLFYQGKVTWVKADAVVLATGGGGQVFAQTTNPAVSTGDGVAIAWRAGA
FT                   ILRDLEFVQFHPTALTKPGRFLISEAVRGEGAHLVDNEGRRFAFDYHPDGELAPRDVVS
FT                   RAIFSHLQDTAVDLATAHVWLDMRPIPADKIRHRFPNIINVCQHWGIDVFNEPIPVGPA
FT                   AHYWMGGIFTDLHNRTNIPGLYAVGETASTGVHGANRLASNSLLECIVFGAQMAHFQDE
FT                   MLRKGQTTESPSSPNPLSFELSVSDWENQQLQLEAIRKKLPRLVWQTAGICREQSSLEN
FT                   AIATIESWQQDFANLPLSKFLQRLRPQEPASFNLPNIDQQLRLWAETHNLLDVAYLILK
FT                   SAAFRTESRGGHYRLDYPQLAPEWQVHTTIQNHHWWQSN"
FT   gene            complement(465009..465458)
FT                   /locus_tag="Aazo_0450"
FT   CDS_pept        complement(465009..465458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0450"
FT                   /product="photosystem II oxygen evolving complex protein
FT                   PsbU"
FT                   /note="PFAM: photosystem II oxygen evolving complex protein
FT                   PsbU; KEGG: ana:alr1216 photosystem II complex extrinsic
FT                   protein precursor U"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62989"
FT                   /db_xref="GOA:D7E080"
FT                   /db_xref="InterPro:IPR010527"
FT                   /db_xref="UniProtKB/TrEMBL:D7E080"
FT                   /inference="protein motif:PFAM:PF06514"
FT                   /protein_id="ADI62989.1"
FT                   /translation="MERGRKIVKGLVRLLTVFSLLLGCWGWLGTTQTAQAISFSKIALR
FT                   QVPVLAIARQNKADAKLGTEFGKKIDLNNTNIAAFQQYPGLYPTLAKKIITNAPYKSVE
FT                   DVLNLPGLSDRQKQTLQANLGNFAVTEYEPNFNEGDDRINNGIYR"
FT   gene            complement(465806..466585)
FT                   /locus_tag="Aazo_0451"
FT   CDS_pept        complement(465806..466585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F4508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62990"
FT                   /db_xref="GOA:D7E081"
FT                   /db_xref="InterPro:IPR021468"
FT                   /db_xref="UniProtKB/TrEMBL:D7E081"
FT                   /inference="similar to AA sequence:KEGG:Npun_F4508"
FT                   /protein_id="ADI62990.1"
FT                   /translation="MINNTLSAYTVENSSIDNNLHITETRHRGIKELESTLSLSPFLPS
FT                   GITWRQTWLVFVAAIFLVTVPVFIEAPLVRSLPTLSLVITGFWIWLSLTLMSRPHTYLW
FT                   GDLLLGFSWSWFTGAIYWGWLRWEPLWHLPIESLGLPFAIWCLCRNWGKVGNWFYLGSL
FT                   FGTVLTDIYFYVVDLMPYWREIMRTDADGASGILRNALAQVQTPWGEVWAIILALALLT
FT                   VGLVSLGKKQKHWYAFGGAVLSTILVDSLFLIAAILT"
FT   gene            complement(466851..468264)
FT                   /pseudo
FT                   /locus_tag="Aazo_0452"
FT                   /product="hypothetical protein"
FT   gene            468637..469020
FT                   /locus_tag="Aazo_0453"
FT   CDS_pept        468637..469020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0453"
FT                   /product="transposase"
FT                   /note="KEGG: ava:Ava_B0073 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62991"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D7E082"
FT                   /inference="similar to AA sequence:KEGG:Ava_B0073"
FT                   /protein_id="ADI62991.1"
FT                   /translation="MERKSYPTDLTDMDWEILAPLIPPAKEGGHPPTTDMGEICNSIYY
FT                   HLKTGCQWNMLPGDFPPRSTVYSYYSKWQGQGVWEKFNHTLGGQVRSKLGKSTQPTALA
FT                   ADSQSVNTDQKKGMCMVLTDVKR"
FT   gene            468990..469445
FT                   /pseudo
FT                   /locus_tag="Aazo_0454"
FT                   /product="hypothetical protein"
FT   gene            complement(469747..470822)
FT                   /pseudo
FT                   /locus_tag="Aazo_0455"
FT                   /product="hypothetical protein"
FT   gene            470832..471005
FT                   /locus_tag="Aazo_0456"
FT   CDS_pept        470832..471005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mar:MAE_34500 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62992"
FT                   /db_xref="UniProtKB/TrEMBL:D7E083"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62992.1"
FT                   /translation="MSLYLPCSLFYSSIYTHLDLVLEVVKKHGVAIKYSHLASTSLHLH
FT                   GEYSNCLSNLGQ"
FT   gene            471007..471231
FT                   /pseudo
FT                   /locus_tag="Aazo_0457"
FT                   /product="hypothetical protein"
FT   gene            471740..472648
FT                   /locus_tag="Aazo_0458"
FT   CDS_pept        471740..472648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0458"
FT                   /product="undecaprenol kinase"
FT                   /note="KEGG: npu:Npun_R4507 putative undecaprenol kinase;
FT                   TIGRFAM: undecaprenol kinase; PFAM: Bacitracin resistance
FT                   protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62993"
FT                   /db_xref="GOA:D7E084"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D7E084"
FT                   /inference="protein motif:TFAM:TIGR00753"
FT                   /protein_id="ADI62993.1"
FT                   /translation="MATILEVSSIGLLCWPLLAVAENTEKITPEWLQALILGIVQGITE
FT                   FLPISSTAHLLIVTKIFAWKELGYKDFVDAIQFGSVIAIVLYFWSLISSILKGGIAALK
FT                   DRDWEREEWKIIVGIAVGTMPALIFGFLLKDILPESALIIAIMSVLMALLLGLAEKIGT
FT                   RKRGLDSLQIRDGILVGLGQTLALIPGVSRSGSTLTTALFLGLERDTAAKFSFLLGFPT
FT                   LTIATLYKSLKIFKLFQEQQLPGNIVFLLIVGIISTFIFSYLSIAFLIRYLQTKNTFVF
FT                   VWYRLAFGSAILLAITAGWQG"
FT   gene            472743..474068
FT                   /locus_tag="Aazo_0459"
FT   CDS_pept        472743..474068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0459"
FT                   /product="FeS-containing organism-specific oxidoreductase"
FT                   /note="KEGG: npu:Npun_R4506 hypothetical protein; TIGRFAM:
FT                   FeS-containing Cyanobacterial-specific oxidoreductase;
FT                   PFAM: protein of unknown function DUF512"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62994"
FT                   /db_xref="GOA:D7E085"
FT                   /db_xref="InterPro:IPR007549"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017673"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D7E085"
FT                   /inference="protein motif:TFAM:TIGR03279"
FT                   /protein_id="ADI62994.1"
FT                   /translation="MITISPAKISKVLPESIAAEIGFDVGDAIVAINGIKPRDLIDYQF
FT                   LCADEVLKLEILDAGGKTHHIEIEKDYDDDLGLEFQTALFDSLIQCNNRCPFCFIDQQP
FT                   PGKRSSLYLKDDDYRLSFLYGSYLTLTNLSDKEWQRIEQMRLSPLYVSVHATEPEVRTR
FT                   LLKNNRAGKIIEQLKWFQKRRLQIHAQVVVCPGINDGEHLEKTLRDLISFHTGEIPTVA
FT                   SVAVVPVGLTRFRPQEDELIPVTPGKAREVITQVKSLSQEFGQKYRSSVAWLADEWFLI
FT                   AGEELPSEVEYEDYPQIDNGVGSIRLFIKQFTYAAQELLPPKIAEPRKLTWVVGNAVEQ
FT                   AFQPILQQLNAVEGLEVNMHALCSDYWGQNISVTGLLTGHDLIFHLKGQDLGEGILLPI
FT                   VILKHGELIFLDDMTVEEVSLQLNTKLFPVGGVEDLINSCCQ"
FT   gene            474153..474362
FT                   /locus_tag="Aazo_0460"
FT   CDS_pept        474153..474362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: npu:Npun_R4505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62995"
FT                   /db_xref="UniProtKB/TrEMBL:D7E086"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62995.1"
FT                   /translation="MSKNIKFPLKKVGLFCLNLNLLIFNFWVRLPLNAATQTGELNIIN
FT                   SQEDAKQLIDITNTNSMLAEKPTQ"
FT   gene            474480..476390
FT                   /pseudo
FT                   /locus_tag="Aazo_0461"
FT                   /product="hypothetical protein"
FT   gene            476759..480175
FT                   /locus_tag="Aazo_0462"
FT   CDS_pept        476759..480175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0462"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; CBS domain containing
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; PAS fold-3 domain protein; histidine kinase A
FT                   domain protein; KEGG: ava:Ava_0647 multi-sensor signal
FT                   transduction histidine kinase; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAC repeat-containing protein; PAS domain containing
FT                   protein; CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62996"
FT                   /db_xref="GOA:D7E087"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7E087"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADI62996.1"
FT                   /translation="MQASPHYLVLRNLDAIIDSSPLTVGPETLVLDAIALMAERCQDVL
FT                   VKSGSQVIGCLTSQDIMRLVALGTELRTTKIAEVMQSSVIKLKVAAGDALKPIVSLFSQ
FT                   TQTQLIAVIDEQDQMVGVITPESICLALGVVEMVENQLLQSQQMLQLIMDTIPHGIFWK
FT                   DIHSVFLGCNRNFAKMVGFENPEDIVGKTDFDLVVDPEQAEFYDATLMEANQPEYYQII
FT                   PKQQADGSQIWLETNKVPLHSIGGQVVGMLGTVQDVTQRKETQEALEKSEEWFRFLAES
FT                   IPQQVWIADADGNLVYMNQRVLDGFGSTRERVLGGKWTQWVHPDDLPNVVNVWNQSLAT
FT                   GINYEVEFRLFQKPSGTYHWHMGRALALRDRQGKIVNWFGTNTDIHDRVTAEIALRESE
FT                   EYFRLLVEGVKDYAIYMLDPEGRVMSWNSGAECMTGYQAAEIIGRDFACFFPPEDIANA
FT                   MPKQQLEAASVNSRCESESIFVRKDGSYFWANCILTALHDDTGELRGFCKLTRDITERK
FT                   LTEKSLLRLQKAIESTSDGISIANISGQVIYVNPAFTEVLDYTGIQLNTCGGLVTTFRN
FT                   PKVFETVLATVHRGESWHGEVTMQAQSGDYVQVDLRTDAIKDTTGKIVYLVSIYTDITQ
FT                   RRFIEEGLRLRDRAIAASSNGIIIADITIPDGSITYVNPAFERMTGYTAAEVMRQNFRL
FT                   FLGADINQPALEQMKIAMQTGQDCKVILRNYRKDGSLFWHELNISPVYDTEACLTHYIG
FT                   IQTDITQRKQAETALLVTQQRLQYLLSASPAVIYTSEAMRDYGTVFISNNIKGMVGYEA
FT                   QEFVKDSGFWFSHIHPEDASDVLAELSQVQVFDKKQYSLEYRFLHADGTYRWIYDQGKV
FT                   VWDKAGNPLELVGYWADITSRKQLEQELRTALEKEKELNELKSRFISMTSHEFRTPLST
FT                   ILSSAELLEHYHQRWTEEKLLIHLRRIQTAVHRMTEMLDDILVIGKAEAGKLEYKPLFF
FT                   DLVEYCRQLVEEVRLNLKSQHLIFFTSQCKSISCYMDDKLLGYILSNLLSNALKYSPDG
FT                   SLVRFTLACKNEQAVLKIQDQGIGIPEENQPRLFESFYRANNVGNILGTGLGLAIVKKC
FT                   VDIHNGEIYFTSQLGIGTQFTVKLPVEKYIK"
FT   gene            480184..481395
FT                   /locus_tag="Aazo_0463"
FT   CDS_pept        480184..481395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0463"
FT                   /product="response regulator receiver modulated diguanylate
FT                   phosphodiesterase"
FT                   /note="KEGG: npu:Npun_R4503 response regulator receiver
FT                   modulated diguanylate phosphodiesterase; PFAM: EAL domain
FT                   protein; response regulator receiver; SMART: EAL domain
FT                   protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62997"
FT                   /db_xref="GOA:D7E088"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D7E088"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADI62997.1"
FT                   /translation="MPKILVIEDEESVRENLLDLLQAEDFKTISADNGPIGLDLAISQL
FT                   PDLILCDMMMPELDGYGVLTALRQEPLTATIPFIFITAKSAKSDFRQGMDLGADDYLTK
FT                   PFTRSELLSAIKNKLEKFANLKKHLLVQTTVQKLTPRMQLLEKSLYRVIKEYDFKGFEI
FT                   YYQPIMDINTGKITSAESLLRWDSDELGQISPSEFIPLAESNGLIIPIDNWVLKNVCKK
FT                   IKNWYDAGISGFTITINLSAVEFNQPGLISKIIGLIDTNQLDPSSLEIELTESKIIEDV
FT                   QSAINTMNELRLLGIKIAIDDFGTGQSSLNYLQNFPVNTIKIDRDFIHDISNNYSKSVI
FT                   TKSMIKMAQELNLRIIAEGVETEAELLFLKQNRCDAIQGFLFSPALPAVEFEKLVFGKK
FT                   TSFM"
FT   gene            481475..481861
FT                   /locus_tag="Aazo_0464"
FT   CDS_pept        481475..481861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0464"
FT                   /product="mannose-6-phosphate isomerase type II"
FT                   /note="PFAM: mannose-6-phosphate isomerase type II; KEGG:
FT                   ana:all4538 mannose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62998"
FT                   /db_xref="GOA:D7E089"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7E089"
FT                   /inference="protein motif:PFAM:PF01050"
FT                   /protein_id="ADI62998.1"
FT                   /translation="MTQKENDLNIQTEEYSSHSGERYWGYVEVIEEGENYRISRVEIKP
FT                   RHGIKPQIHYHRHEHWVVVSGVAKVICGDKEILLNRNQSTYVPAATLHKVENPGSIPLV
FT                   ILEIQNGEYLGEDDIERPSLWNLV"
FT   gene            481861..482541
FT                   /locus_tag="Aazo_0465"
FT   CDS_pept        481861..482541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0465"
FT                   /product="uracil-DNA glycosylase"
FT                   /note="KEGG: scl:sce4747 uracil-DNA glycosylase; TIGRFAM:
FT                   uracil-DNA glycosylase; PFAM: Uracil-DNA glycosylase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62999"
FT                   /db_xref="GOA:D7E090"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D7E090"
FT                   /inference="protein motif:TFAM:TIGR00628"
FT                   /protein_id="ADI62999.1"
FT                   /translation="MKTLQMPGSWQQVLAEELVKPYFAKLQDFLIHERLSYTIYPPEKD
FT                   IFSAFELTPYQQVNVLLLGQDPYHNENQAHGLCFSVKPGIKPPPSLVNIFKELRADVGC
FT                   DIPKHGYLSQWAKQGMLMLNAVLTVRAHTPNSHKNQGWETFTDAVINKVNERSDPVVFV
FT                   LWGGYAQRKLKLIDVNRHLVIQSAHPSPLSAHNGFFGSKPFSAINSALSDYGKPEIDWQ
FT                   LPGV"
FT   gene            complement(482787..483551)
FT                   /locus_tag="Aazo_0466"
FT   CDS_pept        complement(482787..483551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0466"
FT                   /product="HEAT domain containing protein"
FT                   /note="KEGG: npu:Npun_F4500 heat domain-containing protein;
FT                   PFAM: HEAT domain containing protein; PBS lyase HEAT domain
FT                   protein repeat-containing protein; SMART: PBS lyase HEAT
FT                   domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63000"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D7E091"
FT                   /inference="protein motif:PFAM:PF02985"
FT                   /protein_id="ADI63000.1"
FT                   /translation="MIMYHEEDLSLLDAEAELDSPLDHIQPLTAESEVAKPDPELMLAL
FT                   LENPQPQQRMLAARAFCDIEYKQAIPHLISLLTDDCPLVRVSAAYGIGRNPSQEAVDPL
FT                   INQLNIDCNGYVRKGVVWALGNCRDRRSVIPLAYALRTDISAVRLWAASGLAQMAGVSY
FT                   EAVVGAIPPLIESLVQDAIAAVRSNSAWSIGQLCKELPSNVVYATAIDALIQAFAEDKD
FT                   LGVREDAKASLLGVGDPRGLQLIETLEQEGWF"
FT   gene            complement(483639..484202)
FT                   /locus_tag="Aazo_0467"
FT   CDS_pept        complement(483639..484202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0467"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   npu:Npun_F4499 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63001"
FT                   /db_xref="GOA:D7E092"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7E092"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADI63001.1"
FT                   /translation="MNFPLPGYHIRRGSTIDRAILVKFMQWTYQEIFPHQDFSHLARTV
FT                   EQYFSVDTPLWWVYEQAGEQTPGCRGEFTQSPVPNPQCPIPSAQSPVPNPQSLVPIACL
FT                   WVGNAIDQVTGSRHAHIFLLYVVPTYRRRGIGRALMRYIENWAKQRGDRQIGLQVFESN
FT                   TPALNLYHQLSYQTQSLWMIKSLQ"
FT   gene            complement(484287..484430)
FT                   /locus_tag="Aazo_0468"
FT   CDS_pept        complement(484287..484430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63002"
FT                   /db_xref="UniProtKB/TrEMBL:D7E093"
FT                   /inference="similar to AA sequence:KEGG:Ava_1402"
FT                   /protein_id="ADI63002.1"
FT                   /translation="MAIFRQYIAPLLVVLVFIVALVSVSARIFLPSDMAAPAPIGIVIR
FT                   NL"
FT   gene            complement(484535..484936)
FT                   /locus_tag="Aazo_0469"
FT   CDS_pept        complement(484535..484936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63003"
FT                   /db_xref="GOA:D7E094"
FT                   /db_xref="UniProtKB/TrEMBL:D7E094"
FT                   /inference="similar to AA sequence:KEGG:Ava_1401"
FT                   /protein_id="ADI63003.1"
FT                   /translation="MGNQVVIIVGTFVLVVTGLLLGYVLSQLVLGYLGFNLLTLLGTIS
FT                   LVLIFSTLYYVLFWQLRREPSQPFKGKIPNQPDEEITGNYLKNRLIARLSGDIAAAERL
FT                   IEQAKQNYPGMPENWYCERVLDDLDRDQR"
FT   gene            complement(484921..486207)
FT                   /locus_tag="Aazo_0470"
FT   CDS_pept        complement(484921..486207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0470"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cyn:Cyan7425_1218 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63004"
FT                   /db_xref="GOA:D7E095"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7E095"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADI63004.1"
FT                   /translation="MNTVKSLLQVFGSRKMAALILLGFSSGLPLFLTSKTLQAWMTVEN
FT                   VDLTAIGLFSLVGVPYSLKFLWSPLLDWFTLPFLGRRRGWLIAIQIGLLIALACMALQQ
FT                   PKQALQLLAINAVAIAFLSATQDIAADAYRTDILEQLEMGAGAAVFVLGYRIALLLTGS
FT                   LALILADIIPWSSVYLLMAVGMVVGIIATVFAPEPKEISPPESLSAAVILPFREFIQRQ
FT                   GVVQAILTLLFIVLYKLGDSFVNNMSTSFLLKTGFSQTDIGAIQGGMGLIATIVGILAG
FT                   GAFLSKIGLNRSLWLFGALQAVSNLAYLLLAQVGKNYQVLLLTINIENFCAGLGTAAFV
FT                   AFLMNMCNQRYSATQYALLSSFMAVSRDILVAPAGSLAKSTGWPLFFVISIVAAIPGLL
FT                   LLPLFAPWNSKPLPLKRPGIEEEDIWGTK"
FT   gene            complement(486302..486702)
FT                   /pseudo
FT                   /locus_tag="Aazo_0471"
FT                   /product="hypothetical protein"
FT   gene            complement(486744..490116)
FT                   /pseudo
FT                   /locus_tag="Aazo_0472"
FT                   /product="hypothetical protein"
FT   gene            487108..488393
FT                   /pseudo
FT                   /locus_tag="Aazo_0473"
FT                   /product="hypothetical protein"
FT   gene            complement(490278..490896)
FT                   /pseudo
FT                   /locus_tag="Aazo_0474"
FT                   /product="hypothetical protein"
FT   gene            complement(491107..492616)
FT                   /pseudo
FT                   /locus_tag="Aazo_0475"
FT                   /product="hypothetical protein"
FT   gene            492915..493558
FT                   /pseudo
FT                   /locus_tag="Aazo_0476"
FT                   /product="hypothetical protein"
FT   gene            complement(494101..495174)
FT                   /pseudo
FT                   /locus_tag="Aazo_0477"
FT                   /product="hypothetical protein"
FT   gene            complement(495295..495897)
FT                   /locus_tag="Aazo_0478"
FT   CDS_pept        complement(495295..495897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0478"
FT                   /product="transcriptional repressor, LexA family"
FT                   /EC_number="3.4.21.88"
FT                   /note="TIGRFAM: LexA repressor; KEGG: npu:Npun_F4481
FT                   SOS-response transcriptional repressor, LexA; PFAM: LexA
FT                   DNA-binding domain protein; Peptidase S24/S26A/S26B,
FT                   conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63005"
FT                   /db_xref="GOA:D7E096"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:D7E096"
FT                   /inference="protein motif:TFAM:TIGR00498"
FT                   /protein_id="ADI63005.1"
FT                   /translation="MEKLTEAQQELYEWLAEYIRVNQYSPSIRQMMQAMNLKSPAPIQS
FT                   RLEHLRNKGYIDWNEGKARTIRVLRQTKQGVPILGTIAAGGLIEPFTDAVEHLDFSNLS
FT                   LPAHSYALRVAGDSMIEDLIADGDVVFLRPVPEPNHLKNGTIVAARVEGHGTTLKRFYR
FT                   QENMVTLKPANPKYQPIEVPAMHVEVQGSLVGVWRGV"
FT   gene            complement(496069..496989)
FT                   /locus_tag="Aazo_0479"
FT   CDS_pept        complement(496069..496989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0479"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; KEGG:
FT                   npu:Npun_F4480 ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63006"
FT                   /db_xref="GOA:D7E097"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D7E097"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ADI63006.1"
FT                   /translation="MAALIGRDLLGLADLSSTELQELLEMATQLKSQQLKLHSNKVLGL
FT                   LFSKASTRTRVSFTVAMYQLGGQVIDLNPNVTQVSRGEPVQDTARVLDRYLDILAIRTF
FT                   AQQELEIFANYAKIPVINALTDLEHPCQVLADLQTIQEYFGTLAGLTLAYVGDGNNVAN
FT                   SLMLGCALAGMHVQVAFPSGYAPDAEIVEKARAVANNKTEVVLTHDPKAAAEGAHILYT
FT                   DVWASMGQEAEADNRLPIFQPYQISEQLLGLADPQAIVLHCLPAHRGEEITEEVIEGSQ
FT                   SKVWDQAENRLHAQKALLASILGAE"
FT   gene            497427..497498
FT                   /locus_tag="Aazo_R0005"
FT                   /note="tRNA-Thr1"
FT   tRNA            497427..497498
FT                   /locus_tag="Aazo_R0005"
FT                   /product="tRNA-Thr"
FT   gene            complement(497542..498031)
FT                   /pseudo
FT                   /locus_tag="Aazo_0480"
FT                   /product="hypothetical protein"
FT   gene            498147..499208
FT                   /locus_tag="Aazo_0481"
FT   CDS_pept        498147..499208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0481"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   npu:Npun_F0587 Rieske (2Fe-2S) domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63007"
FT                   /db_xref="GOA:D7E098"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D7E098"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADI63007.1"
FT                   /translation="MIDNNILLRNIWYYALPSYLLKPGKMVAKILLEEPILLIRNKDGQ
FT                   VSAVRDICPHRAVPLSCGRFNGQEVECCYHGWRFDPKGRCVEIPSLLPEQNTDLSRFDV
FT                   QSYPIQETQGNIWIYMSDGDKYKPSPVENEVPIVSGVIEQQPHLVEVIRFPCFIDHAVT
FT                   GLMDPAHSPYVHRVWWWRSGELHEEVKEFDPSPYGFTVRRHKLSENMENMSRLYWLVGG
FT                   GIPEVEISFRLPGVRIEEITFGKHRVSNLTAVTPISETETEVNFVLYGIPAWLRIFKPL
FT                   IHILARKFLGQDRTVVEKQQVGLKYNPVLRLIKDSDMQAQWYYQLKREFARATSEKREF
FT                   INPVKSILLRWRA"
FT   gene            499374..500108
FT                   /locus_tag="Aazo_0482"
FT   CDS_pept        499374..500108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0482"
FT                   /product="Domain of unknown function DUF1995"
FT                   /note="PFAM: Domain of unknown function DUF1995; KEGG:
FT                   npu:Npun_R2561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63008"
FT                   /db_xref="InterPro:IPR018962"
FT                   /db_xref="UniProtKB/TrEMBL:D7E099"
FT                   /inference="protein motif:PFAM:PF09353"
FT                   /protein_id="ADI63008.1"
FT                   /translation="MAELPKTLEEAITQSREAVKSALADGVTRIQVDFLFPELKFMPVA
FT                   EQFVPLFAEYESRVKVFFADAGAAALARRDWQNVPFKVEDIGTGRAASLQTKIQPEDEI
FT                   FLFIAPTPVEVPQLEKMCEIIDTRPIVLLNPRLEDSGVVGIGYAARETRRRFISTIESC
FT                   YYLRPVDDESALFRCYPGQWEVWLESNNEYEKIAELPKRPSGDEIDMILMKGQPAKTSE
FT                   GTPAKKPSVFKSLQRFIKALSS"
FT   gene            complement(500286..500489)
FT                   /locus_tag="Aazo_0483"
FT   CDS_pept        complement(500286..500489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F1820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63009"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0A0"
FT                   /inference="similar to AA sequence:KEGG:Npun_F1820"
FT                   /protein_id="ADI63009.1"
FT                   /translation="MNQTQAALRNEVRELAKVAFHRKLISGYTGGADINEYQIIYQGKP
FT                   RHIYLEQARLLLIDLLYRNQIY"
FT   gene            500914..501150
FT                   /locus_tag="Aazo_0484"
FT   CDS_pept        500914..501150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0484"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_C0173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63010"
FT                   /db_xref="InterPro:IPR027805"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0A1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63010.1"
FT                   /translation="MFYWRKMPTFEVLGLHFGIWKTEAKDTFHYWLEILRNVFPPSLLK
FT                   QVEKHDSDYAMATQNKRQETKSFPPRVFLLNRS"
FT   gene            complement(501657..501791)
FT                   /locus_tag="Aazo_0485"
FT   CDS_pept        complement(501657..501791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:all2585 iron(III) dicitrate transport
FT                   system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63011"
FT                   /db_xref="GOA:D7E0A2"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0A2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63011.1"
FT                   /translation="MKADWLVIRSSAISFRIDLRIPVMVFSLLAVIGIAIQCAGKFLI"
FT   gene            complement(501788..502785)
FT                   /pseudo
FT                   /locus_tag="Aazo_0486"
FT                   /product="hypothetical protein"
FT   gene            complement(502803..503216)
FT                   /locus_tag="Aazo_0487"
FT   CDS_pept        complement(502803..503216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0487"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   ava:Ava_2305 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63012"
FT                   /db_xref="GOA:D7E0A3"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0A3"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ADI63012.1"
FT                   /translation="MRLQDEPELPAQINPAQINIVPMIDVIFATLTFFIMSTLYLTRSE
FT                   GLPVNLPQAGRGKINRPVQVILTINNTGKIFLNKEAVSLDHLAAQVREKVEPSQPLMVI
FT                   LNADAVVNHGQVVAVMDKVRQLEEVKLGIATRK"
FT   gene            complement(503200..504999)
FT                   /pseudo
FT                   /locus_tag="Aazo_0488"
FT                   /product="hypothetical protein"
FT   gene            503580..504609
FT                   /pseudo
FT                   /locus_tag="Aazo_0489"
FT                   /product="hypothetical protein"
FT   gene            505284..505599
FT                   /pseudo
FT                   /locus_tag="Aazo_0490"
FT                   /product="hypothetical protein"
FT   gene            complement(505986..507035)
FT                   /locus_tag="Aazo_0491"
FT   CDS_pept        complement(505986..507035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0491"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; KEGG: npu:Npun_R1026
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM: DAHP
FT                   synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63013"
FT                   /db_xref="GOA:D7E0A4"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0A4"
FT                   /inference="protein motif:TFAM:TIGR00034"
FT                   /protein_id="ADI63013.1"
FT                   /translation="MINKLINTNIKSSHVLLTPNEVKAKLPLTKYAENTILKFRQQIED
FT                   ILDFQDIRKFIVVGPCSIHDPKAAIEYAEKLKVLAEKVQDKLVLIMRVYFEKPRTTVGW
FT                   KGLINDPEMDDSFHVEHGILIARNLLLTLAELGLPTATEALDPIIPQYISELVAWSAIG
FT                   ARTTESQTHREMASGLSMPVGFKNGTDGNIHVALNALKSAKTPHNFLGINQKGQVSVFQ
FT                   TRGNAHGHVILRGGNQPNFDPESIRLVEEQLKAENLPPRIVIDCSHGNTNKDYRLQSLV
FT                   LENVIQQIVDGNTSIVGMMLESNLYEGSQPITGKREELQYGVSVTDKCISWKETEKIIL
FT                   AAHSKLKYI"
FT   gene            complement(507471..507845)
FT                   /locus_tag="Aazo_0492"
FT   CDS_pept        complement(507471..507845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0492"
FT                   /product="Domain of unknown function DUF1823"
FT                   /note="PFAM: Domain of unknown function DUF1823; KEGG:
FT                   npu:Npun_R1028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63014"
FT                   /db_xref="InterPro:IPR014952"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0A5"
FT                   /inference="protein motif:PFAM:PF08853"
FT                   /protein_id="ADI63014.1"
FT                   /translation="MSNLPPLNTQTIWAIINDTIDDSTVNQLVWHYLGYRYDSISEKWD
FT                   SSSVAVEWQHEYPEPPNFLGSRRGTMKLTRSIPQENKQILKQKLGFKGYKIGEFGPRQT
FT                   RRATAANWLLSYMQLNSLFS"
FT   gene            complement(508036..509594)
FT                   /pseudo
FT                   /locus_tag="Aazo_0493"
FT                   /product="hypothetical protein"
FT   gene            complement(509675..510388)
FT                   /pseudo
FT                   /locus_tag="Aazo_0494"
FT                   /product="hypothetical protein"
FT   gene            complement(510450..512560)
FT                   /pseudo
FT                   /locus_tag="Aazo_0495"
FT                   /product="hypothetical protein"
FT   gene            complement(512567..513010)
FT                   /locus_tag="Aazo_0496"
FT   CDS_pept        complement(512567..513010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckr:CKR_3077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63015"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0A6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63015.1"
FT                   /translation="MHRNSSDFEKVLLGNFEVHQYLLKMSEVVRKYFPENTSEAELWCE
FT                   KMFEGFKMFIPNAESLIDGMLKVCFWQQSSEDGTFSFSAPYKLDHIEFHSIWDEITQVD
FT                   AYYSYCGNWAYSGWATEYKISPDIVKDICVELFTLFQDLTISV"
FT   gene            complement(513051..513329)
FT                   /locus_tag="Aazo_0497"
FT   CDS_pept        complement(513051..513329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63016"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0A7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63016.1"
FT                   /translation="MITILDLGLNNLKLKILPAVPLVLQYQSKIKMAGDRREESRLNQL
FT                   FGLIRFFHFIYFDICENILGLALKNSLHPCLSTFLPTQAIKNHIKLL"
FT   gene            complement(513330..513434)
FT                   /locus_tag="Aazo_0498"
FT   CDS_pept        complement(513330..513434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63017"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0A8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63017.1"
FT                   /translation="MFEKLVNYETGIFGVSLKKWTADGCSRSVPLGIS"
FT   gene            complement(513495..514280)
FT                   /locus_tag="Aazo_0499"
FT   CDS_pept        complement(513495..514280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0499"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: gem:GM21_1920
FT                   dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63018"
FT                   /db_xref="GOA:D7E0A9"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0A9"
FT                   /inference="protein motif:PFAM:PF01738"
FT                   /protein_id="ADI63018.1"
FT                   /translation="MKTLLSVLFTPVVILFTTMDVLAAIKTKTIEYKQCDTVLGGYLAY
FT                   NDAIKGKRPTVLVVHDWTGLQSFTKKRTEQLAKLGYVAFAADIYGKGIRPENIQESGTQ
FT                   AKIYRDNRSLMRDRVNAGVQVLQKYQLTDPKRIAAIGYCFGGGTVLELARTGANIQGVA
FT                   SFHSNLDTPNPEDAKNIKSKVLVLHGANDPFIPQEQVQGFEREMRQANVDWQLISYGGA
FT                   VHSFTNPEAKNGPKGSLYNPTVEQRSWKAMRQFFAEIFR"
FT   gene            514514..516619
FT                   /locus_tag="Aazo_0500"
FT   CDS_pept        514514..516619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0500"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="KEGG: ana:alr0880 oligopeptidase A; PFAM: peptidase
FT                   M3A and M3B thimet/oligopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63019"
FT                   /db_xref="GOA:D7E0B0"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0B0"
FT                   /inference="protein motif:PRIAM:3.4.24.70"
FT                   /protein_id="ADI63019.1"
FT                   /translation="MSATAIISQNPLLQGFGLPAFAEITPEQVEPAFRHLLADLEQQLN
FT                   ILEANVQPTWDGLVEPLEKLTERLHWSWGILNHLMGVQNSPELRIAYQKVQPLVVQFIN
FT                   TLGQSKPIYKAFKALRASDTWETLESAQQRIIEAAIRDAKLSGVGLEGQARERFNAIQM
FT                   ELAELATKFSNHLLDATTAFSLILTTKAEIEGLPSSLLSLAAQAARIAGEEYATPETGP
FT                   WHITLDFPSYFPFMQHSTRRDLREKLYKAYITRASFGELDNNPLIERILELRQELSELL
FT                   SFDNFAELSLASKMAKNVPAVEKLLEELRQASYDAAVKDLEALKAFAQSKGAAEADNLQ
FT                   HWDISFWAERQREEKFAFTEEELRPYFPLPQVLDGLFGLIKRLFGVTVTPADGQAPVWH
FT                   EDVRYFKISDKYANAIAYFYLDPYSRPAEKRGGAWMDACIHRRKITELGITSIRLPVAY
FT                   LICNQTPPVDHKPSLMTFDEVETLFHEFGHGLHHMLTKVNYTGAAGINNVEWDAVELPS
FT                   QFMENWCYDRPTLFDMAKHYETGKPLPEHYYQKLLASRNYMSGSAMLRQIHLSSVDLEL
FT                   HYRYRPSGDETPIDVRQRIAKTTTVLPPLPEDGFLCAFGHIFEGGYAAGYYSYKWAEVL
FT                   SADAFAAFEEAGLEDEEAIYVTGRLYRDTVLALGGSMHPMEVFQAFRHREPSTTALLKH
FT                   NGLLPTI"
FT   gene            517358..518209
FT                   /locus_tag="Aazo_0501"
FT   CDS_pept        517358..518209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0501"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: ava:Ava_4486
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63020"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0B1"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADI63020.1"
FT                   /translation="MIRKILLAVSGLGHAEEMMKTLKEMPSILSAKVTVLHVVPPQSTA
FT                   AAMTDKWEEGGKILANAIQSLNLDPSRVSSILRQGDPKDVVCQVAEEMDADLIIMGSRG
FT                   LKRLQSILANSVSQYVFQLSSRPMLLVKDDIYVKRIKRIMVASDNSEASTNCLKIALFL
FT                   LQGVEGGQLILSHINTDLCGKLSGITDIKPERNSVLGNAVAEAEKQNIPVRCVTSSGKP
FT                   GEEICRLAEELNVDLLLLGSPDRRPSIAKKFVDLDRLIGASLSDYVRVNAPCPVLLART
FT                   VG"
FT   gene            complement(518336..518449)
FT                   /locus_tag="Aazo_0502"
FT   CDS_pept        complement(518336..518449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0502"
FT                   /product="photosystem II reaction center protein PsbM"
FT                   /note="KEGG: ava:Ava_4486a photosystem II reaction center
FT                   protein M; TIGRFAM: photosystem II reaction center protein
FT                   PsbM; PFAM: photosystem II protein PsbM"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63021"
FT                   /db_xref="GOA:D7E0B2"
FT                   /db_xref="InterPro:IPR007826"
FT                   /db_xref="InterPro:IPR037269"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0B2"
FT                   /inference="protein motif:TFAM:TIGR03038"
FT                   /protein_id="ADI63021.1"
FT                   /translation="MQVNDLGFVASILFVLVPSVFLIILYIQTASREGGKN"
FT   gene            complement(518571..518867)
FT                   /locus_tag="Aazo_0503"
FT   CDS_pept        complement(518571..518867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0503"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: npu:Npun_F0277 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63022"
FT                   /db_xref="GOA:D7E0B3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0B3"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ADI63022.1"
FT                   /translation="MGNIKFVKENKEIVAADGANLRLKAIENGIDIYKFLGKMTNCGGY
FT                   GQCATCIVEVVEGLENLSPRTDFENRKFKNKPDNYRLACQTMVNGPVSVITKP"
FT   gene            complement(519063..519200)
FT                   /locus_tag="Aazo_0504"
FT   CDS_pept        complement(519063..519200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0504"
FT                   /product="photosystem II protein PsbK"
FT                   /note="PFAM: photosystem II protein PsbK; KEGG:
FT                   npu:Npun_F0276 photosystem II protein PsbK"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63023"
FT                   /db_xref="GOA:D7E0B4"
FT                   /db_xref="InterPro:IPR003687"
FT                   /db_xref="InterPro:IPR037270"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0B4"
FT                   /inference="protein motif:PFAM:PF02533"
FT                   /protein_id="ADI63023.1"
FT                   /translation="MEAALLLAKLPEAYQIFEPLVDVLPVIPVFFLLLAFVWQAAVGFR
FT                   "
FT   gene            complement(519283..520467)
FT                   /locus_tag="Aazo_0505"
FT   CDS_pept        complement(519283..520467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0505"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="TIGRFAM: queuine tRNA-ribosyltransferase;
FT                   tRNA-guanine transglycosylase, various specificities; KEGG:
FT                   npu:Npun_F0275 queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63024"
FT                   /db_xref="GOA:D7E0B5"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0B5"
FT                   /inference="protein motif:TFAM:TIGR00430"
FT                   /protein_id="ADI63024.1"
FT                   /translation="MTNFSFQLLATCSQTKARAGVFSTPHGPVETPRFMPVGTLANVKT
FT                   ITPAQLKDTGAQMVLSNTYHLHIQPGEAIVAAGGGLHKFMGWNGPMLTDSGGFQVFSLS
FT                   EMRNITEAGVTFRSPYNGQVIELTPERSIEIQNILGADVIMAFDECPPYPATRQEVEAA
FT                   TDRTYRWLERCIVAHQRTDQALFPIVQGGVYLDLRACAAEALAKLDMPGYAIGGVSVGE
FT                   PPELMAEIVKTTAPLLPHNKPRYLMGVGTYREMAIGIASGVDLFDCVIPTRWARHATAI
FT                   VSGERWNLKNAKFREDFTPLDETCPCYACQNFSRAYISHLVRAQEILAYTLLSIHNITE
FT                   LVRFTQKIRESILSDRFITDFGHWLKDEEVTGDYGLGTGEDGKITSPSSPVPNK"
FT   gene            complement(520502..520954)
FT                   /locus_tag="Aazo_0506"
FT   CDS_pept        complement(520502..520954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F0274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63025"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0B6"
FT                   /inference="similar to AA sequence:KEGG:Npun_F0274"
FT                   /protein_id="ADI63025.1"
FT                   /translation="MSHHLPDTRIPAPCIVNTGIIVNKLDIRRLLTDLGRVHYIYTQDN
FT                   KLLSEGDGDVMEVFVHHQRSTIVANHALYLNINSFDCLELKQPSEKESFFDLIQEDICL
FT                   RLIPLSTPLQERYERHFQGTTIEAMMDQVLSARWDAEIDDDCSDCF"
FT   gene            521361..522128
FT                   /locus_tag="Aazo_0507"
FT   CDS_pept        521361..522128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0507"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /note="KEGG: npu:Npun_R0273 cobalamin 5'-phosphate
FT                   synthase; TIGRFAM: cobalamin 5'-phosphate synthase; PFAM:
FT                   cobalamin-5-phosphate synthase CobS"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63026"
FT                   /db_xref="GOA:D7E0B7"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0B7"
FT                   /inference="protein motif:TFAM:TIGR00317"
FT                   /protein_id="ADI63026.1"
FT                   /translation="MLYWCKQQLLDLVATIIFYTAIPLPYIKSLEFGRVACFAPLVGLM
FT                   IGGILGLLDTTFNYLNFSILTRSALVVIIWIFTTGGLHLDGAMDTADGLAVTNPERRLQ
FT                   VMADSATGAFGAMSAIAIVLLKITALTDMPENRYLVLIAACGWGRWGQQVAICRYPYLK
FT                   PTGKGALHKQAIHSEKDLLPSLLLMLGLSGVIWFINPQNLVLSVGMILAGSALATLTGA
FT                   WFNHKLGGHTGDTYGAVVEWTEALFLCVLTSFN"
FT   gene            complement(522468..524088)
FT                   /pseudo
FT                   /locus_tag="Aazo_0508"
FT                   /product="hypothetical protein"
FT   gene            complement(524164..524589)
FT                   /locus_tag="Aazo_0509"
FT   CDS_pept        complement(524164..524589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R2849 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63027"
FT                   /db_xref="InterPro:IPR025567"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0B8"
FT                   /inference="similar to AA sequence:KEGG:Npun_R2849"
FT                   /protein_id="ADI63027.1"
FT                   /translation="MSLRLNTDWPIENLPGLNATEQNQLLDFGISTTGALFKHGKTPET
FT                   RLALASKLQLHLQYVNKWIALADLARIPSVGTQYCGLLLHTGMISVAQLAQTPTHILHQ
FT                   QTLRLQVATLQRRDLCPAIELVKQWSQQAGTFVTANK"
FT   gene            complement(524632..525431)
FT                   /pseudo
FT                   /locus_tag="Aazo_0510"
FT                   /product="hypothetical protein"
FT   gene            525486..526718
FT                   /locus_tag="Aazo_0511"
FT   CDS_pept        525486..526718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0511"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /EC_number="2.1.1.132"
FT                   /note="TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit; precorrin-6Y
FT                   C5,15-methyltransferase (decarboxylating), CbiT subunit;
FT                   KEGG: ava:Ava_3558 precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating); PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63028"
FT                   /db_xref="GOA:D7E0B9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0B9"
FT                   /inference="protein motif:TFAM:TIGR02467"
FT                   /protein_id="ADI63028.1"
FT                   /translation="MSKKWLSIIGIGEDGIEGLSLMARSLLDQAHIIIGGERHLSILSP
FT                   NDTREKIIWKSSFQDSIAEIVQRRGESICILASGDPMCYGVGATILKHITIAEVSILPS
FT                   LSAFSLACSRLGWSFTEVECLSLCGRPAYLLQSYIYPGAKLLILSEGKNTPRIVAEILR
FT                   KRGYGDSKFTVLERMGGIHERILTGTAASWNETDIAALNTIAVECIADGETVTLSIFPG
FT                   LPDDAFHHDGQLTKREVRAVTLSSLAPLPGELLWDIGAGCGSISIEWMRSNFKCRAIAV
FT                   EQNSTRLNYIADNAAALGTPNLQIIAGKAREVIPDLPTPDAIFIGGGVTASGLFDVCWN
FT                   ALRPGGRMVANVVTLEGEQTLFQWYEKVGGNFTRISIQRAEPIGKFLGWKGMSQVTQWV
FT                   GYKNSKFKIQD"
FT   gene            complement(526843..527451)
FT                   /locus_tag="Aazo_0512"
FT   CDS_pept        complement(526843..527451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F3561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63029"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0C0"
FT                   /inference="similar to AA sequence:KEGG:Npun_F3561"
FT                   /protein_id="ADI63029.1"
FT                   /translation="MSKVYTTQELIQILAAERQACLKGERLKLELKVSGNPIIDQFITT
FT                   EGLQKFTAYQDFKASIHEYQRDNVVSGIVWKNLTIKTKTLDYPEVDAQLIALNSDLEIL
FT                   KTAKDSMLEFWQEITSEMELYLSVSNGKQHAKINKLDVERIAQRTEWVSLIKWENTNFL
FT                   EVILQMGWGKPEEATYKRGRPHSGSEFIHAVNPGNYPIG"
FT   gene            complement(527754..528344)
FT                   /locus_tag="Aazo_0513"
FT   CDS_pept        complement(527754..528344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all2716 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63030"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0C1"
FT                   /inference="similar to AA sequence:KEGG:all2716"
FT                   /protein_id="ADI63030.1"
FT                   /translation="MNSIKWLFLQTKIITNWRRLVSKSLLLLFCIFIISMQPAFAGMKD
FT                   DRYEGNIFVVFAGNGSLVPSKLTLAQTLAEHKPAMLAFYVDDSRDCKQYAVFISQTQAF
FT                   YGRAAEIIPIGVDTIPMKETYDPTEPGYYYSGAVPQVVLFDQSGKVILNKTGQVPFDEI
FT                   DDKFREVFNLLPRDQSIEFKQRSFNEYSSEFSQ"
FT   gene            528535..529872
FT                   /locus_tag="Aazo_0514"
FT   CDS_pept        528535..529872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0514"
FT                   /product="domain of unknown function DUF1727"
FT                   /note="PFAM: domain of unknown function DUF1727; Mur ligase
FT                   middle domain protein; KEGG: npu:Npun_R3559 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63031"
FT                   /db_xref="GOA:D7E0C2"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0C2"
FT                   /inference="protein motif:PFAM:PF08353"
FT                   /protein_id="ADI63031.1"
FT                   /translation="MGKKIQLIDRVRLGLAVSIAKSVTFLVRSLRLGAASVLPGSIARR
FT                   IEPRLLHLLSQQVKKGVILIAGTNGKTTTSLLLCTILKHKGYRIAHNSTGANLENGLAT
FT                   ALIENTGLLGSLDVDYAILEVDENIFPKVLKPLEPRIILCLNLFRDQLDRYGEVDTISK
FT                   RWTKVISTLPADTVVISNADDPTLSYLGQQLNQKVLFFGLNEPEHYLEAIPHAVDSIYC
FT                   PRCGHSLDYQGIYLSHLGDFTCPSCGFSKSRPSLESGKWSQILVGLYNKYNTLAAATAA
FT                   KELGVDEGTIRETINNFQAAFGRAEDLVIDGKRVRILLSKNPVGTNETIRVVTQSNDTT
FT                   TLVVLNDRTPDGTDISWIWDVDTEKLVERGGTLVVSGDRVYDMALRLRYSEKSVESKIN
FT                   LIVDEDLRRAIGTALEHTPANETLHILPTYSAMLEVREVLTGRKIR"
FT   gene            530227..530928
FT                   /pseudo
FT                   /locus_tag="Aazo_0515"
FT                   /product="hypothetical protein"
FT   gene            complement(531180..532331)
FT                   /locus_tag="Aazo_0516"
FT   CDS_pept        complement(531180..532331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0516"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="TIGRFAM: UDP-galactopyranose mutase; KEGG:
FT                   npu:Npun_F0220 UDP-galactopyranose mutase; PFAM:
FT                   UDP-galactopyranose mutase-like; FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63032"
FT                   /db_xref="GOA:D7E0C3"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0C3"
FT                   /inference="protein motif:TFAM:TIGR00031"
FT                   /protein_id="ADI63032.1"
FT                   /translation="MEPNYSSTTVTPDTFERDFVFDYLIVGAGFSGSVIAERLASHSGK
FT                   KVLIVDKRNHIGGNTYDHYNEHGILIHKYGPHIFHTNSREVFEYLSCFTQWRTYEHRVL
FT                   TSVDGQLVPIPINLDTINKLYGMNLNSFEVEEFFKSLAEPKEYIRTSEDVVVSKVGRDL
FT                   YEKFFRGYTRKQWGLDPSELDKSVIARVPTRTNRDNRYFTDTYQAMPLHGFTRMFEKML
FT                   AHPYIKVMLNTDYREILRAIPYREIVYTGPIDEFFNYRHGILPYRSLDFQHETHDTPVF
FT                   QSAPVINYPNEHLYTRVTEFKYLTGQEHTKTSIVYEFPKAEGDPYYPVPRSDNNEIYKQ
FT                   YKALADAMLGVYFVGRLATYKYYNMDQCIAQALSVYGKIALKV"
FT   gene            complement(532458..534323)
FT                   /locus_tag="Aazo_0517"
FT   CDS_pept        complement(532458..534323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0517"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   aap:NT05HA_0635 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63033"
FT                   /db_xref="GOA:D7E0C4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR040492"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0C4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADI63033.1"
FT                   /translation="MSQALLNSRPTHQNVQTTVKLQNIILPNLDICTVEELYFRLNSEF
FT                   SMNYEQNIIEINKSEIISFDTYFNSFSIQKWQEHTNINSININLNVKGKFKINLLNINY
FT                   SSQIKGLVHQKIITNTELREVCVFNDIDTQPYKGLLYLELEPLEDNCIFAGGYFYANAN
FT                   INNFCKSNQKIAIVICTYKREAYVNRNVSLLETHLFSQPDIGNKFEVFIIDNGRTIKDF
FT                   YNSKIHVIPNKNAGGTGGYCRGIIEVMKRKSDFSHIVFMDDDVVINPEVFERIYNFQTV
FT                   AHNQNLCLGGSMLRLDTKYIQYENGAVWNKEVIRLKPDLDLRTVRNILLNEIEEHLSYN
FT                   GWWLFCFPIKSIDDSKLPYPFFIKMDDMEFPIRLNHKIITLNGVCVWHEALENKYSPMM
FT                   NYYLKKNELILNVIVSDDFSKLDAIKRIIKFTLREAFCYKYQSANVILKAAADFLKGPR
FT                   HLTEIDPEEKNIEIRSMGEKCVKDTELPFMYIKYEESVNKIESTMHRWLRFITLNGHLL
FT                   PSPFFYQDIKLTGQGYKVIPMQEYRPTNVFRARKALYYNLIDQEGFVVSFSREEFFKVL
FT                   MKTLALSVEIYFKFSKLKQDYRETLPELTNREFWETYLETNKYSK"
FT   gene            complement(534381..536645)
FT                   /locus_tag="Aazo_0518"
FT   CDS_pept        complement(534381..536645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0518"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   cac:CAC2172 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63034"
FT                   /db_xref="GOA:D7E0C5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0C5"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADI63034.1"
FT                   /translation="MKITKLAIIIVTWNKMNQVCLLLKDLNKLELPDINIDIYVVDNAS
FT                   TDGTQSYIEKYYSDQVKVLQTGSNLGGSGGFSCGLQFVSKLDYNYIWLLDDDIRLDSLA
FT                   LIPLINTLQNYEEVGVVGSQIRKLQKPNAIQEIGSFINNKKAHLKVNFGNQVNISTEDI
FT                   LQGKPYVNVDICAAASLLVRCKIVQNMGVFEDYFLHFDDVEWCLRVKQAGWVIAVNPHS
FT                   IVWHDSPDFKSRPWMNYYDERNLCYCWQKHRPELLLKRVVVSFPRLVYYAATGRYFLAE
FT                   ISIAGFQDFINGVQGKMLRKINYTEYPLGEIIHEPAKVFVQSSIYQDEFQSQNLKKIEV
FT                   DEKVTFWPLPNKFSRIWLWIIAWFWKPIDIAIVTYQHPTLDVLNLAKWVYYFTGNGYVP
FT                   VVINPLVLTKAVMKTSNEMWQIYWQIRKLKLSSIPEIMPTPLSPLVSIILCTSNRPNCL
FT                   EKALQSLELIHYQNFEVIVIDASSTNQTIEMVNQVSSKNNLKINFLQVEPKNISYSRNM
FT                   GIKLATGSIVAFFDDDAIPPSEWIEKLLDIYAIHDEKCAAVGGTVRDLTRPGYPLQFHR
FT                   GITNLFSETIAIRSADATNYNQANGLWFNGLMGTNCSFRKDILEKINGYDEFFDYFLDE
FT                   TDVCLRLIQAGYEVHYADVVIDHYPQPSHNRIDQKHLTCWYSLAKNTTYFAIKHGLTRG
FT                   LFPIFVTRLLLLITYRCWLRIIRLKFTHHIPNSVLIKYIQQTIEGIRVGWKSGMNLHQV
FT                   N"
FT   gene            complement(536750..538156)
FT                   /pseudo
FT                   /locus_tag="Aazo_0519"
FT                   /product="hypothetical protein"
FT   gene            complement(538484..541359)
FT                   /pseudo
FT                   /locus_tag="Aazo_0520"
FT                   /product="hypothetical protein"
FT   gene            538949..540364
FT                   /pseudo
FT                   /locus_tag="Aazo_0521"
FT                   /product="hypothetical protein"
FT   gene            541455..541676
FT                   /pseudo
FT                   /locus_tag="Aazo_0522"
FT                   /product="hypothetical protein"
FT   gene            541743..543338
FT                   /locus_tag="Aazo_0523"
FT   CDS_pept        541743..543338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0523"
FT                   /product="Heat shock protein 70"
FT                   /note="PFAM: Heat shock protein 70; KEGG: ava:Ava_0572 heat
FT                   shock protein HSP70"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63035"
FT                   /db_xref="GOA:D7E0C6"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0C6"
FT                   /inference="protein motif:PFAM:PF00012"
FT                   /protein_id="ADI63035.1"
FT                   /translation="MLIAIDFGTSNTVITRWNPVTQQPETLSFPGLSIQQNLNPPLIPS
FT                   LVYVEDATQGKVLVGQQVRDRGLDIKAEQRFFRNFKRGIGANTQGFLPELDGKNITFEQ
FT                   VGEWFLTKVITELAPIEGPLDSLVLTVPVDSFEAYRYWLGKVCQALPVPQVRMLDEPTA
FT                   AALGYGLSAQENLLVIDFGGGTLDLSLVCLDKKVADAKPVGFLLKWGNKFLAEDSKQKV
FT                   KTARVLAKAGQNLGGTDIDNWIVDYFAKSQGLPVNSLTTRLAERLKIQLSTQEQASEFF
FT                   FDNETFESFEMELNRKGLEELLKENGFFDRLHDAMIALLQQARRQGIELDDINAVLLVG
FT                   GSVQLQAVQTYVNQYFEPEKIRCERPFEAIAQGALQITQGMEIKDYLYHSYGVRYWDRR
FT                   NQCHSWQPIVKAGQAYPMTQPVELVLGASMENQPSIELILGEFGAETGGTEVYFDGDRL
FT                   ITRNIKCLGSTVKPLNDKEGARNIAQLIPPGFPGSDRIKVQFQVDEQRFLRITVEDLLT
FT                   NDTLVENQIVAQLS"
FT   gene            complement(543613..544146)
FT                   /locus_tag="Aazo_0524"
FT   CDS_pept        complement(543613..544146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0524"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   npu:Npun_F2720 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63036"
FT                   /db_xref="GOA:D7E0C7"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0C7"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADI63036.1"
FT                   /translation="MPMWIRSALIRGSGTFCTGIVLMLMAWFSWSLPTSNLKTTTANAY
FT                   TLKQSITDSKNHQISQSRWIEIDLSEQRLRAWEGKTVVYSYRISTGKSRTPTPVGRFQI
FT                   NSKYPTHQMRGPGYDIPDVPYTMYFYQGYAIHGAYWHNRFGTPVSHGCVNLPVSQARRL
FT                   YNWSGMGTVVVVRR"
FT   gene            complement(544475..544942)
FT                   /locus_tag="Aazo_0525"
FT   CDS_pept        complement(544475..544942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0525"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   ana:all4770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63037"
FT                   /db_xref="GOA:D7E0C8"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0C8"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADI63037.1"
FT                   /translation="MLLAGTVVSASICNPISSQVWANSDNNKIATAIQTLKQSEQRWIQ
FT                   INLSKQNLTAWEGNKPVYAITISSGKGSTPTRIGTFKIQTKQKKSRMRGRGYDVPNVPH
FT                   IMYYQGGYAIHGAYWHNKFGTPVSHGCINLAPNHAKWIFEWADIGTPVVIQ"
FT   gene            545344..545529
FT                   /locus_tag="Aazo_0526"
FT   CDS_pept        545344..545529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0526"
FT                   /product="ChpI"
FT                   /note="KEGG: lic:LIC11192 ChpI"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63038"
FT                   /db_xref="GOA:D7E0C9"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0C9"
FT                   /inference="similar to AA sequence:KEGG:LIC11192"
FT                   /protein_id="ADI63038.1"
FT                   /translation="MKTTISIPNPMFDAAEQFAKHKDLSRSQLYAVALREYFGSHKPDQ
FT                   ITQMFSKNLRSPKISK"
FT   gene            complement(545667..546302)
FT                   /locus_tag="Aazo_0527"
FT   CDS_pept        complement(545667..546302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0527"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="KEGG: npu:Npun_F2718
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; TIGRFAM:
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63039"
FT                   /db_xref="GOA:D7E0D0"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0D0"
FT                   /inference="protein motif:TFAM:TIGR01182"
FT                   /protein_id="ADI63039.1"
FT                   /translation="MSNQVWLSQLQQNRAIAVIRAPKMVWGEKMAVAVADGGMHLIEIT
FT                   WNSDRAADLISQLRTHLPHCLIGTGTLFNVQQLQDAIAAGAQFLFTPHTDPEMIKVAVS
FT                   QDVPIIPGALTPTEIATAWTQGASCVKVFPVQAVGGSNYIQSLQAPLGHIPLIPTGGVT
FT                   LENAQDFLQVGAVAVGLSGKLFPKKWVLEENWSAIGLQAKNLMGTLNS"
FT   gene            546897..549246
FT                   /pseudo
FT                   /locus_tag="Aazo_0528"
FT                   /product="hypothetical protein"
FT   gene            complement(547531..548797)
FT                   /pseudo
FT                   /locus_tag="Aazo_0529"
FT                   /product="hypothetical protein"
FT   gene            complement(549884..550156)
FT                   /pseudo
FT                   /locus_tag="Aazo_0530"
FT                   /product="hypothetical protein"
FT   gene            550640..553249
FT                   /locus_tag="Aazo_0531"
FT   CDS_pept        550640..553249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0531"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: ana:all0860 DNA
FT                   gyrase subunit A; PFAM: DNA gyrase/topoisomerase IV subunit
FT                   A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63040"
FT                   /db_xref="GOA:D7E0D1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0D1"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADI63040.1"
FT                   /translation="MTTSQERIIPTDLRQEMSQSYLEYAMSVIVGRALPDARDGLKPVH
FT                   RRILYAMHELGLLPDRPFRKCARVVGEVLGKYHPHGDTAVYDALVRMAQDFSMRSPLIN
FT                   GHGNFGSVDNDPPAAMRYTECRLQALTSASLLQDIESETVDFADNFDGSQQEPTVLPSR
FT                   IPQLLLNGSSGIAVGMATNIPPHNLGELIDGLVALIHNLEITNMQLMQYVHGPDFPTGA
FT                   QILGTSAIKEAYTTGRGSVTMRGVATIETIEQRNRPEREAIIITELPYQTNKAALIEKI
FT                   AELVNDKKIEGIADIRDESDRDGMRIVIELKRDAYPRVVLNNLYKQTPLQSNFGANMLA
FT                   LVNGEPQLLTLKNFLSVFLDFRIATINRRTCYQLRKAEERDHILQGLLIALSHLDAIIN
FT                   RIRSASDAPSAKGELITNYGLSEVQADAILQMQLRRLTALEADKIRLEHEELQVQIADL
FT                   QDILDRRERVLEIIETEVTQIKTQFATPRRTIITHAEGDIDDIDLIANEKVLILLTKQG
FT                   YIKRMPVNTFEAQSRATRGKAGAKVKDDDTIEHFLTCCDHDSVLFFSDRGVVYSLRTYQ
FT                   IPIGSRTSRGTPIVQMLPIPKEEKITSIVPVDEFTSEEYLVMLTKGGNIKKTALEAFSN
FT                   IRANGLIAISLEEGDQLRWVRRAKVEDSIIIGSRHGMAIHFRCTHDQLRPLGRATRGVK
FT                   SMKLKPGDELVGMDILPAAILETLDTETEAEIEEETIDIEETTEIEEISETTEAPNSNS
FT                   TGPWVLVITMGGYGKRVPVGQFRLQNRAGQGLTATKFKNRKTKDKLATLRIVNSDEEIM
FT                   MATNRGIIIRQTVNAISVQSRSATGVRVQRLDEDDAITGVAIVPPDTGDTGELEEVE"
FT   gene            553274..554845
FT                   /locus_tag="Aazo_0532"
FT   CDS_pept        553274..554845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0532"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="KEGG: ava:Ava_4463 apolipoprotein N-acyltransferase;
FT                   TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63041"
FT                   /db_xref="GOA:D7E0D2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0D2"
FT                   /inference="protein motif:TFAM:TIGR00546"
FT                   /protein_id="ADI63041.1"
FT                   /translation="MKYLETKLFSSFHLYGLSFISGILMGVTVAPIGAWFFAWFALAPF
FT                   WVLVVKYTTRIKTAAFLWALAYHGIAVSWIMGIHPMNWLGVPWWPSLAITIFCWTFISL
FT                   WGGILVSLWAILMVRLDKQKPWLRVLIGTALWCALESLWSSGSLWWSSLSYTQSPHNLV
FT                   ILHLGKLSGPNTVTAVIVAVNGLLGEACIYYENSTQKRKSAKEEKGLGKGLVNGYLILA
FT                   FSLFILSHLIGFILYTQPLKPTQTTALKIGIIQGNIPNQIKLRPEGLRRAVTGYTNGYL
FT                   KLANQGVNGVLTPEGALPLYERNFKSTPLLDAVKEKGVIAWIGGFGERGKSYTNSLFGV
FT                   NSKGEITSRYDKSKLVPLGEYIPFEQILRAVIQRLSPLDEHQVHGAANQVFHTPFGRVI
FT                   VGICYESAFSETFRRQAFKGGQFILISSNDAHYTAAMADQHHAQDIMRAVETDRWAVRA
FT                   TNTGYSGFVDPHGRTVWKSAYNTYETHAETIYPRQTQTLYVRFGDWLMPLLLILGILAW
FT                   FIKPVG"
FT   gene            555056..555160
FT                   /locus_tag="Aazo_0533"
FT   CDS_pept        555056..555160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asl0842 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63042"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0D3"
FT                   /inference="similar to AA sequence:KEGG:asl0842"
FT                   /protein_id="ADI63042.1"
FT                   /translation="MGILGTTIMNKETVASHAEKLNSEGDASELSPEL"
FT   gene            555341..556255
FT                   /locus_tag="Aazo_0534"
FT   CDS_pept        555341..556255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0534"
FT                   /product="Histone deacetylase"
FT                   /note="KEGG: ava:Ava_4443 histone deacetylase superfamily
FT                   protein; PFAM: histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63043"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0D4"
FT                   /inference="protein motif:PRIAM:3.5.1.98"
FT                   /protein_id="ADI63043.1"
FT                   /translation="MLPVIYSDEFLDHITGPYHPEKPERLRAIVNALKTANFAEKIEWV
FT                   NPQPVKPELMSWIEIAHHQTYIKKVKDIASSGGGYLDGDTPISPRSYDVALLAVSAWLD
FT                   GVNEVLTRENPAFVLARPPGHHAESDTGMGFCLFSNAAIAALYALQQAGVNRVAILDWD
FT                   VHHGNGTQAIVETHSQIAYCSLHQYPAYPGTGKASEKGLHNNVLNLPLPPGSDITTYQP
FT                   LWESLILPFLTKFQPDLLIVSAGYDALEDDGLASVNLQPEDFGLFTEHSLGITRKILFG
FT                   LEGGYDLQTLSKSVVATIESCCI"
FT   gene            complement(556340..556741)
FT                   /pseudo
FT                   /locus_tag="Aazo_0535"
FT                   /product="hypothetical protein"
FT   gene            557098..557235
FT                   /locus_tag="Aazo_0536"
FT   CDS_pept        557098..557235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63044"
FT                   /db_xref="GOA:D7E0D5"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0D5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63044.1"
FT                   /translation="MTTYIFFDEALRMLTNAYLISAIILIAASSIGLAVIETIGKTGEH
FT                   "
FT   gene            557734..559098
FT                   /locus_tag="Aazo_0537"
FT   CDS_pept        557734..559098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0537"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase"
FT                   /note="KEGG: npu:Npun_F4185
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl- D-alanyl ligase; TIGRFAM:
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase; PFAM: Mur
FT                   ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63045"
FT                   /db_xref="GOA:D7E0D6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0D6"
FT                   /inference="protein motif:TFAM:TIGR01143"
FT                   /protein_id="ADI63045.1"
FT                   /translation="MPVSATLSQLVEILSASSVNLSASALTKVSKSIQTDTRILQPGEV
FT                   FVALRGEKFDGHEFVAMAIVKGAIAAIVDYAYENPVFPVLQVTDTLKAYQQIGRWWRDS
FT                   YSIPVIGVTGSVGKTTTKELIAAVLATKGQVHKTYGNFNNEIGVPKTLLELGAEHDFAV
FT                   IEMAMRGRGQIAELTQIARPTIGVITNVGTAHIELLSSEEAIAEAKCELLAEMPNDSVA
FT                   ILNYDSPLLMETAKKFWQGKVISYGFSGGDIQGKLIDNETVEVAGIGLPLPLPGRHNAT
FT                   NFLAALAVAKVLEIDWQSLQAGVIVNMPNGRSQRFTLPNDVIILDETYNAAPEAMLAAL
FT                   QLLADIPGKRKIAVLGVMKELGERSQQLHQQVGEMVQKLNLDGLLLLVDSKDAEFIANS
FT                   AKGIPCECFATHADLIARLKTFMQAGDRLLFKAAHSVGLDRVVNQLRLELIISNQ"
FT   gene            complement(559101..559301)
FT                   /pseudo
FT                   /locus_tag="Aazo_0538"
FT                   /product="hypothetical protein"
FT   gene            complement(559325..559756)
FT                   /pseudo
FT                   /locus_tag="Aazo_0539"
FT                   /product="hypothetical protein"
FT   gene            complement(559835..561076)
FT                   /locus_tag="Aazo_0540"
FT   CDS_pept        complement(559835..561076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63046"
FT                   /db_xref="GOA:D7E0D7"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0D7"
FT                   /inference="similar to AA sequence:KEGG:Ava_1699"
FT                   /protein_id="ADI63046.1"
FT                   /translation="MTPVDILILSNGPGEVTTWVRPVVKALREQLGNDRSHVRISVILS
FT                   PCLHASGKEASIAKSYSEVDRVQAPEFFWQFLIWGKTAKNWDWRNKGVVVFLGGDQFFP
FT                   VIIGKKLGYKTVVYAEWEARWHKLINRFGIMKAEVAKHVSPKYADKFIIVGDLMLEAAE
FT                   YQDIKIAREQGCREEEIIGILPGSKSAKLTQGVPLTLAIAEYIHEKRPRTKFFIPVAPT
FT                   LDIPILLNFANPAINSFTKAFNFQGASLVETNLVTSRGLNVELKQGSHAYHLLSQCSIC
FT                   LTTVGANTAELGALGVPMIVLLPTQQLDAMRSWDGLPGLLANLPGVGSSFAKLINWWMA
FT                   KRKGLLAWPNIWAQKEIVPELVGKLQPSEVGEMVLELLKNPEKLENMRDKLRSARGETG
FT                   AAKKLATLVKEELL"
FT   gene            complement(561359..561829)
FT                   /pseudo
FT                   /locus_tag="Aazo_0541"
FT                   /product="hypothetical protein"
FT   gene            562235..566224
FT                   /locus_tag="Aazo_0542"
FT   CDS_pept        562235..566224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0542"
FT                   /product="magnesium chelatase, H subunit"
FT                   /EC_number="6.6.1.1"
FT                   /note="TIGRFAM: magnesium chelatase, H subunit; KEGG:
FT                   ava:Ava_3311 magnesium chelatase subunit H; PFAM:
FT                   CobN/magnesium chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63047"
FT                   /db_xref="GOA:D7E0D8"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011771"
FT                   /db_xref="InterPro:IPR022571"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0D8"
FT                   /inference="protein motif:TFAM:TIGR02025"
FT                   /protein_id="ADI63047.1"
FT                   /translation="MFTQVKSTIRHIAPNDLRGRNLIKVVYVVLESQYQSALSQAVREV
FT                   NANHPNVAIEISGYLIEELRKAENYEQFQRDIASANIFIASLIFIEDLAQKVVAAVEPH
FT                   RDNLDVSVVFPSMPEVMRLNKMGTFSLAQLGQSKSAIAQFMKKRKEKSGASFQDGMLKL
FT                   LRTLPQVLKFLPIDKAQDARNFMLSFQYWLGGSAENLENFLLMLADKYVLKSSKEQRTE
FT                   ESINYAAPVLYPDMGIWHPLATTMFEDVREYLNWYTGRKDISKDVKDPLAPCIGLVLQR
FT                   THLVTGDDAHYVAIVQEFESLGAKVLPVFAGGLDFSKPIEAYFYEPTTSRQLVDAVVSL
FT                   TGFALVGGPARQDHPKAIDALKRLNRPYMVALPLVFQTTEEWLDSELGLHPIQVALQIA
FT                   IPELDGAIEPIILSGRDGATGKAIALQDRVESVAQRALKWANLRRKPKLDKKVAITVFS
FT                   FPPDKGNVGTAAYLDVFGSIHEVMKGLRNNGYDVQDIPETAKELMEQVIHDAQAQYASP
FT                   ELNIAYKMSVPEYEALTPYSQRLEENWGPPPGNLNSDGQNLLIYGKQFGNVFIGVQPTF
FT                   GYEGDPMRLLFSRSASPHHGFAAYYTYLERIWSADAVLHFGTHGSLEFMPGKQMGMSGD
FT                   CYPDQLIGTIPNLYYYAANNPSEATIAKRRSYAETISYLTPPAENAGLYKGLKELSELI
FT                   ASYQTLKDSGRGVPIVNSIMDKCRIVNLDKDINLPETDAKDMSSEERDNIVGMVYSKLM
FT                   EIESRLLPCGLHVIGKPPTAEEAVATLVNIASLDRSEEEIFSLPRIIANSLGRDIDEIY
FT                   KNSDAGILADVQLLQDITLATRAAVGSLVQEQTDAEGRVSLVSKLNFFKMGKKEPWVES
FT                   LHKSGYSKVDTSALKPLFEYLEFCLKQVCADNELGGLLQGLEGEYILPGPGGDPIRNPD
FT                   VLPTGKNIHALDPQSIPTTAAVQSAKTVVDRLLERNKAENGGNWPETVACVLWGTDNIK
FT                   TYGESLAQIMWMVGVRPVADALGRVNKLELIPLEELGRPRIDVVINCSGVFRDLFINQM
FT                   NLLDQGVKMAAEADEPLEMNFVRKHALQQAEEMGINLRQAATRVFSNASGSYSSNINLA
FT                   VENSTWDSEAELQEMYLKRKSFSFNSDNPGVMDESRQIFETTLKTADATFQNLDSSEIS
FT                   LTDVSHYFDSDPTNLVASLRADGKKPTSYIADTTTANAQVRSLSETVRLDARTKLLNPK
FT                   WYEGMLSHGYEGVRELSKRLVNTTGWSATAGAVDNWVYEETNETFIKDEEMQKRLMNLN
FT                   PHSFRKIVSTLLEVNGRGYWETSEENLDQLRELYQEVENRIEGIE"
FT   gene            566256..566852
FT                   /pseudo
FT                   /locus_tag="Aazo_0543"
FT                   /product="hypothetical protein"
FT   gene            complement(567062..567331)
FT                   /locus_tag="Aazo_0544"
FT   CDS_pept        complement(567062..567331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63048"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0D9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63048.1"
FT                   /translation="MNHKIMNKSKKVEDFVKSQILPTVIYVWNIGGRKPHLSQPHGDID
FT                   IDSNHYSIYCEYMDQFSRSDHQGFTYSKAEECLSETLIKLGLNK"
FT   gene            567886..568363
FT                   /pseudo
FT                   /locus_tag="Aazo_0545"
FT                   /product="hypothetical protein"
FT   gene            complement(568531..570762)
FT                   /locus_tag="Aazo_0546"
FT   CDS_pept        complement(568531..570762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0546"
FT                   /product="photosystem I core protein PsaB"
FT                   /note="KEGG: ana:alr5155 photosystem I P700 chlorophyll a
FT                   apoprotein A2; TIGRFAM: photosystem I core protein PsaB;
FT                   PFAM: photosystem I psaA and psaB"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63049"
FT                   /db_xref="GOA:D7E0E0"
FT                   /db_xref="InterPro:IPR001280"
FT                   /db_xref="InterPro:IPR006244"
FT                   /db_xref="InterPro:IPR020586"
FT                   /db_xref="InterPro:IPR036408"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0E0"
FT                   /inference="protein motif:TFAM:TIGR01336"
FT                   /protein_id="ADI63049.1"
FT                   /translation="MATKFPKFSQDLAQDPTTRRIWYAIATGNDFESHDGMTEENLYQK
FT                   IFATHFGHLAIIFLWASSLLFHVAWQGNFEQWIKDPLHVRPIAHAIWDPHFGAPAVEAF
FT                   TQAGASNPVNIAYSGVYHWWYTIGMRTNQELYTGSVGLLLLAALFLFAGWLHLQPKFRP
FT                   SLSWFKSAEPRLNHHLGGLFGVSSLAWTGHLVHVAIPESRGIHVGWDNFLTAAPHPAGL
FT                   TPFFTGNWGVYAQNPDTAGHLFGTSTGAGTAILTFLGGFHPQTESLWLTDMAHHHLAIA
FT                   VLFIIAGHMYRTNFGIGHSIKEMLNSKSGLVPGSKSEGQFNLPHQGLYDTINNSLHFQL
FT                   SLALAALGTITSLVAQHMYSLPPYAFIAKDYTTQAALYTHHQYIAGFLMVGAFAHAAIF
FT                   WVRDYDPEQNKGNVLDRILQHKEAIISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQ
FT                   ILIEPVFAQFIQAAHGKLLYGLDTLLSNPDSVAYTAYPNYGNVWLSGWLDAINSGTNSL
FT                   FLTIGPGDFLVHHAFALAIHTTTLVLVKGALDARGSKLMPDKKDFGYAFPCDGPGRGGT
FT                   CDISAWDAFYLSMFWMLNTIGWVTFYWHWKHLGIWQGNVAQFNENSTYLMGWFRDYLWA
FT                   NSAQLINGYNAYGMNNLSVWTWMFLFGHLIWATGFMFLISWRGYWQELIETLVWAHERT
FT                   PLANLVRWKDKPVALSIVQARVVGLAHFTVGYIVTYAAFLIASTAGKFG"
FT   gene            complement(570985..573243)
FT                   /locus_tag="Aazo_0547"
FT   CDS_pept        complement(570985..573243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0547"
FT                   /product="photosystem I core protein PsaA"
FT                   /note="KEGG: ava:Ava_2405 photosystem I P700 chlorophyll a
FT                   apoprotein A1; TIGRFAM: photosystem I core protein PsaA;
FT                   PFAM: photosystem I psaA and psaB"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63050"
FT                   /db_xref="GOA:D7E0E1"
FT                   /db_xref="InterPro:IPR001280"
FT                   /db_xref="InterPro:IPR006243"
FT                   /db_xref="InterPro:IPR020586"
FT                   /db_xref="InterPro:IPR036408"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0E1"
FT                   /inference="protein motif:TFAM:TIGR01335"
FT                   /protein_id="ADI63050.1"
FT                   /translation="MTISPPEREEKKARVIVDKDPVPTSFERWAQPGHFDRSLAKGPKT
FT                   TTWIWNLHALAHDFDTHTSDLEDISRKIFSAHFGHLAVVTIWLSGMLFHGAKFSNYEAW
FT                   LTDPLGVKPSAQVVWPIVGQDILNGDVGGGFHGIQITSGLFQVWRGWGITNSFQLYCTA
FT                   IGGLVLAGLFLFAGWFHYHKRAPKLEWFQNVESMLNHHLQVLLGCGSLGWAGHLIHVSA
FT                   PTNKLLDAGVALKDIPLPHEFILNKDLLTELYPSFANGLTPFFTLNWGTYADILTFKGG
FT                   LNPVTGGLWMTDISHHHLAIAVLFIIAGHMYRTNWGIGHSIKDILENHKGPFTGEGHKG
FT                   LYENMTTSWHAQLATNLAFLGSLTIIIAHHMYAMPPYPYLATDYATQLCIFTHHIWIGG
FT                   FLIVGGAAHAAIFMVRDYDPVLNQNNVLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIH
FT                   NDTMRALGRPQDMFSDAAIQLQPVFAQWVQNLHTLAPGGTAPNALEPVSYAFGGGVLAV
FT                   GGKVAMMPITLGTADFLIHHIHAFTIHVTVLILLKGVLYARSSRLIPDKANLGFRFPCD
FT                   GPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVDADGVVEHITGGN
FT                   FAQGAITINGWLRDFLWAQATQVINSYGSELSAYGLMFLGAHFVWAFSLMFLFSGRGYW
FT                   QELIESIVWAHNKLKVAPTIQPRALSITQGRAVGVAHYLLGGIATTWAFFHAHILSVG"
FT   gene            complement(573645..573770)
FT                   /locus_tag="Aazo_0548"
FT   CDS_pept        complement(573645..573770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63051"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0E2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63051.1"
FT                   /translation="MPVATLREIVKVWGIGEEKRQQVAKRKTLSSTPRSLPPECL"
FT   gene            573840..575345
FT                   /locus_tag="Aazo_0549"
FT   CDS_pept        573840..575345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R3817 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63052"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0E3"
FT                   /inference="similar to AA sequence:KEGG:Npun_R3817"
FT                   /protein_id="ADI63052.1"
FT                   /translation="MKSRQKTALEKLLSQSFPIFKWVMTLLLILSLTSCTEKAGSQEVS
FT                   IDNQKTASQISQVCRQFSETAPPEVIQELRPILELYQPLVTIMTPTADEVIEDNTITVR
FT                   FQVTDLPIFKDPQWQLGPHVHVIIDNEPYIAVYDLNQPLVLSDLSVGTHTLRVFASRPW
FT                   HESFKNEGAYTQIRFHIFTKTDDNNPASNLPLLTYSSPNASYGAEPIMLDFYLTNAPLH
FT                   IAAEDNPDDTISDWRIRCTINGESFILDRWQSVYLKGFTPGKNWVKLEFLDNQGNPVKN
FT                   VFNSTARLINYEPKGKDSLSRIVRGELTANEVRGIVDPNYTTKIPVTKPTPTVTPKLEV
FT                   SPTPQPQVGKPPTPEIEVSPTPQAQVEKPPTPEVEVSPTPQPQVEKPPTPEVEVSPTPQ
FT                   PQVEKPPTPEIEVSPTPQAQVEKPPTPEIEVSPTPQAQVEKPPTPEIEVSPTPQAQVEK
FT                   PPTPEIEVSPTPQIQPAPEPQETPSPIESIQKDQSKLEKTGLR"
FT   gene            complement(575396..576336)
FT                   /pseudo
FT                   /locus_tag="Aazo_0550"
FT                   /product="hypothetical protein"
FT   gene            576355..577189
FT                   /pseudo
FT                   /locus_tag="Aazo_0551"
FT                   /product="hypothetical protein"
FT   gene            577257..577514
FT                   /locus_tag="Aazo_0552"
FT   CDS_pept        577257..577514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0552"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: DCDC5; doublecortin domain containing 5"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63053"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0E4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63053.1"
FT                   /translation="MKKKHIFSNSDDGMLSLPKDFFKISRFRDLLLWEIRERLMQRIRN
FT                   NQQQSQGAIIKSLAHMEIAEEMTEINSINLSFSKIVCYSG"
FT   gene            577871..578230
FT                   /pseudo
FT                   /locus_tag="Aazo_0553"
FT                   /product="hypothetical protein"
FT   gene            578383..578571
FT                   /locus_tag="Aazo_0554"
FT   CDS_pept        578383..578571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F2488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63054"
FT                   /db_xref="InterPro:IPR025148"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0E5"
FT                   /inference="similar to AA sequence:KEGG:Npun_F2488"
FT                   /protein_id="ADI63054.1"
FT                   /translation="MNNQEIDIDEYIEQISLLLNLEIKDEYRNEMIADFEKLISIAKIV
FT                   NNCPLPEEIEIAPVFEP"
FT   gene            578579..578833
FT                   /locus_tag="Aazo_0555"
FT   CDS_pept        578579..578833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0555"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: ana:alr1018 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63055"
FT                   /db_xref="GOA:D7E0E6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR014087"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0E6"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ADI63055.1"
FT                   /translation="MNDAVSVAKNILSGKVSAVEVTQAALSKIPTKDNELNCFTDIAVE
FT                   TALQDAAHIDQNIAKGKSPRVLAGVPFAVKNSFNKYNRT"
FT   gene            complement(579342..580195)
FT                   /pseudo
FT                   /locus_tag="Aazo_0556"
FT                   /product="hypothetical protein"
FT   gene            580436..581185
FT                   /pseudo
FT                   /locus_tag="Aazo_0557"
FT                   /product="hypothetical protein"
FT   gene            complement(581289..581951)
FT                   /locus_tag="Aazo_0558"
FT   CDS_pept        complement(581289..581951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R1092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63056"
FT                   /db_xref="InterPro:IPR025297"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0E7"
FT                   /inference="similar to AA sequence:KEGG:Npun_R1092"
FT                   /protein_id="ADI63056.1"
FT                   /translation="MLFPDLNELDLRYRSQAKARPQVVVSIATAFNMSDHNYQKISDFI
FT                   QSVERLYPTLQGTAPVGQIDLQINPIEYHLVHLIGWQLLNLEQQQLDTCNEYLQTGGVI
FT                   LIEVPTNGSILTEDIKNLIAYHFEIPLQSWQELSRNHPLRTKPFLFAGLPHIDEELLRI
FT                   SNAGGIILVEGELSAAWGLDDNLTLDRNDIRTAQELGIDFLHFALQRRQMTQLIIHN"
FT   gene            582650..583017
FT                   /pseudo
FT                   /locus_tag="Aazo_0559"
FT                   /product="hypothetical protein"
FT   gene            complement(583146..583835)
FT                   /locus_tag="Aazo_0560"
FT   CDS_pept        complement(583146..583835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0560"
FT                   /product="N-acylglucosamine-6-phosphate 2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /note="KEGG: cyn:Cyan7425_1322
FT                   N-acylglucosamine-6-phosphate 2-epimerase; PFAM: putative
FT                   N-acetylmannosamine-6-phosphate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63057"
FT                   /db_xref="GOA:D7E0E8"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0E8"
FT                   /inference="protein motif:PRIAM:5.1.3.9"
FT                   /protein_id="ADI63057.1"
FT                   /translation="MTHLPKGLIVSCQAPINSPLDDPYIIAAMAEAAVNNGAVSVRINT
FT                   PNHIKAVRAKVQVPIIGLWKQVITGSHVYITPQFHHAVAVAEAGADIIAIDATTRNRPG
FT                   DEKLPDIINNIHQQLGKPVMADVDTYEAAKLAVEAGVDIVGTTLLGYTSETKSFAPPGW
FT                   ELLTQIIENLNIFVICEGGISSPEMAKKALELGSDAVVVGTAITGIDLLVRAYNHNIAN
FT                   FYGKSTI"
FT   gene            complement(583941..585863)
FT                   /locus_tag="Aazo_0561"
FT   CDS_pept        complement(583941..585863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0561"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="KEGG: npu:Npun_F1000 GAF sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; GAF domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63058"
FT                   /db_xref="GOA:D7E0E9"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0E9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADI63058.1"
FT                   /translation="MLSSPDLSFSRTLPLSVFNRLGELLQQMAQAVGTAALMLTEAVLQ
FT                   RMPIPAEWERQRFTLVISEQFSALLLGNIEAGEQETRGLEKPENPSINTSLTFNPDEIA
FT                   SFISEVINLFDCNSCIYQNIARYQQVIAPNDAKLQSKLTLLLLEYMLPIISNEVTVSST
FT                   ITPGEAYSYQGVEDALNKQIAQERLLNEVTSQIRKSLDLPIIMKTAITQIREFMVLDRL
FT                   VIYKFASAQVKSQYSSFNDQYLPNSQHLPQNYQNYQGCIVYESLSTDDIPSVLNYQEET
FT                   CLMRTSLCWEKYRQGFVLAVDDIEKTYPLEECLLNFLRRSKVHAKLVAPIIFEEKLWGL
FT                   LIAHQCNAPREWTESEKSLLTSVTKQLAITIHQTELMASLTKQKQTLEQRVIERTMALQ
FT                   EALLAAEAANRLRSEFLATISHELLTPLTYVIGMSSTLLLWPLGELSKRQRDYLQTIHD
FT                   SGEHLLEMINDILDLSQVEAGRTVLNITDFSLVKSAQNTLDSLLEKARSEKVTLKLDLQ
FT                   INPSHDSFTGDSTRVEQILWNLLTNAIKFTPEGGNVTLRLWVEDATAIFQVEDTGIGIP
FT                   EEQLPLLFEKFQQLDTPYRRRYEGTGVGLALTKQLVELHRGRIEVESTVGIGSIFTVWI
FT                   PNQLK"
FT   gene            586013..589885
FT                   /locus_tag="Aazo_0562"
FT   CDS_pept        586013..589885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0562"
FT                   /product="cobaltochelatase, CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="TIGRFAM: cobaltochelatase, CobN subunit; KEGG:
FT                   ava:Ava_1167 cobaltochelatase subunit CobN; PFAM:
FT                   CobN/magnesium chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63059"
FT                   /db_xref="GOA:D7E0F0"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0F0"
FT                   /inference="protein motif:TFAM:TIGR02257"
FT                   /protein_id="ADI63059.1"
FT                   /translation="MHRINATPGEWNQSEGLIFLEQTPAPFVFITAADTDVQTLAAAVP
FT                   KLPTQFPALRVANLLQLQQQISIDTYGEQVLELAQVIVLRLLGGHSYWAYGLEVVQEIV
FT                   QRQSTTLIVMPGDDALDPDLISHSTISIEIVNQVWQYFKEGGIENFLNALQFIADKCLD
FT                   TKFNPPLPQTIPRVGLYEGLGTGDWGLGTRETSSKGEIVSIPNHQLPISNYPLPKVGIL
FT                   FYRAHYLAGNTKVIDALCTALVQRNLQPVAVFVSSLREPGVCEGLYDLFQPQDSQYIDL
FT                   LLNTTSFSLARLETETPEIELWQKLDVPVFQVILSGGFREQWDVGLQGLTPRDMAMNVA
FT                   LPEVDGRIITRAVSFKTLQTRNNDLETDVVVYEPVSDRIEFVAQLAANWVKLRQKPPQQ
FT                   RRICLILANYPNTNGRLANGVGLDTPASCLEILKALKLASYKVDNIPADGDELIQRLTY
FT                   GVTNDPEGRDWKPIQQSLSVEEYQEYFSTLPETVQQGITKRWGLGNSQSPIPILGIKFG
FT                   NVFVGIQPSRGYDIDPSLNYHAPDLEPTHDYLAFYYWVRESFGSDAIIHVGKHGNLEWL
FT                   PGKSVALSDTCYPEVAFGAMPHLYPFIVNDPGEGSQAKRRAQAVIIDHLTPPMTRADLY
FT                   GGLQQVENLIDEYYEAESLDPNRMPAIRNRIQELVIKENLYKDLGITDEKDIFNFETLI
FT                   LNSLDGYLCELKEAQIRDGLHIFGQTPQGTQLRDLIVAIARIPNRHSIGITRAIAQEWG
FT                   LDIDPLSTDLSTPFTPSPTLSAPLHLSVRLKSCRTHGDIVELLEEQAADLVEQIINSQS
FT                   PIPSPQSPVLKWITLQLLPALEKTKEEITNLLRALDGKYVPSAASGAPTRGRPEVLPTG
FT                   KNFYAVDIRAIPTETAWDIGRKAAETLIETYTQEHGEYPKTLGLSVWGTATMRTGGDDI
FT                   AEALALLGVRPVWDGAARRVVDFEILPVSILGRPRVDVTLRISGFFRDAFPNLIDLFSQ
FT                   AVAAVANLDEPAENNPLAVAVQKETELWTDQGLSLETAKERSLYRVFGSQPGAYGAGLQ
FT                   GLIASQNWQTDQDLAQAYINWSSYAYSSKQGTGNKEPGTESNNTVTCHLSPVTSPEVFQ
FT                   QRLKEMQIVLQNQDNREHDILDSDDYYQFQGGLTAAVRSLQGKNPETYFGDNSNTSKPK
FT                   VRHLKEEITRVYRSRVVNPKWISGVMRHGYKGAFEMAATVDFLFAYDATAQCVEDHIYQ
FT                   GVVQAYLEDPVVCEFIQAKNPWALRDIAERLLEAHQRGLWQDANSKTLDNLRNLVHQAE
FT                   AAVEEQ"
FT   gene            589984..590992
FT                   /pseudo
FT                   /locus_tag="Aazo_0563"
FT                   /product="hypothetical protein"
FT   gene            complement(591022..591477)
FT                   /locus_tag="Aazo_0564"
FT   CDS_pept        complement(591022..591477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0564"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: npu:Npun_F0997
FT                   ferric uptake regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63060"
FT                   /db_xref="GOA:D7E0F1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0F1"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADI63060.1"
FT                   /translation="MTVYTTGSLKAELNDRGWRLTPQRETILHIFQELPQGEHLSAEDL
FT                   YLRLESDGEGISLSTIYRTLKLMARMGILRELELGEGHKHYEINQPYPHHHHHLICVRC
FT                   NTTIEFKNESILKIGVKTAQKEGFHLLDCQLTIHAVCPKCQRALMPV"
FT   gene            complement(591624..592877)
FT                   /locus_tag="Aazo_0565"
FT   CDS_pept        complement(591624..592877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0565"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD subfamily"
FT                   /note="KEGG: ava:Ava_1164 RNA polymerase sigma factor SigC;
FT                   TIGRFAM: RNA polymerase sigma factor; RNA polymerase sigma
FT                   factor, sigma-70 family; PFAM: sigma-70 region 3 domain
FT                   protein; sigma-70 region 2 domain protein; sigma-70 region
FT                   4 domain protein; sigma-70 region 1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63061"
FT                   /db_xref="GOA:D7E0F2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0F2"
FT                   /inference="protein motif:TFAM:TIGR02997"
FT                   /protein_id="ADI63061.1"
FT                   /translation="MPATSFHTDTAYDSPRSNPKLEPDLGIDDGDFSLDDLQDLDIAAA
FT                   VDSHNLAANTNRRSTDLVRLYLQEIGRVRLLGRDEEVSEAQKVQRYLRLRIVLANAAKQ
FT                   GDTVIVPYQRLIEVQERLSSELGHRPSLERWAKTAGIDLADLKPTLLEGKRRWAEIAKL
FT                   KVEELENVQSQGLQAKEHMIKANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVEKF
FT                   DPTKGYRFSTYAYWWIRQGITRAIATSSRTIRLPVHITEKLNKIKKAQRKISQEKGRTP
FT                   TLEDLAIELDMTPTQVREVLLRVPRSVSLETKVGKDKDTELGELLETDSITPEEMLMRE
FT                   SLQKDLHHLLADLTSRERDVILMRFGLSDGHPYSLAEIGRALDLSRERVRQIESKALQK
FT                   LRQPKRRNLIRDYLESLS"
FT   gene            complement(593557..594510)
FT                   /locus_tag="Aazo_0566"
FT   CDS_pept        complement(593557..594510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0566"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="KEGG: ava:Ava_1163 NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase-like; PFAM:
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63062"
FT                   /db_xref="GOA:D7E0F3"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0F3"
FT                   /inference="protein motif:PRIAM:1.1.1.94"
FT                   /protein_id="ADI63062.1"
FT                   /translation="MTYRKSKIENRKTVVILGAGAWGTALANLAWVNGHEVRLWSRNSS
FT                   QTLAAVLQDAADIVLSAISMKGVRDVALLVKSCPLSPEIIFVTATKGLDPQTTYTPSQT
FT                   WQTEFPHHSVVVLSGPNLSQEIEQELPAACVVASKNFAAAHQVQLVFSSSRFRVYTSPD
FT                   PIGVELGGTVKNVMAIAAGVCDGLHLGTNAKAALVTRALTEMVRIGQVLGSKTETFYGL
FT                   SGLGDLLATCNSPLSRNYQVGYQLASGKRLTEILNTLPGTAEGVNTCRVLMQISQQQNI
FT                   TIPITEQVYRLLESEVTPQQALDELMLRDMKPEYNQ"
FT   gene            complement(594646..595515)
FT                   /locus_tag="Aazo_0567"
FT   CDS_pept        complement(594646..595515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0567"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.8"
FT                   /note="SMART: Elongator protein 3/MiaB/NifB; TIGRFAM:
FT                   lipoic acid synthetase; KEGG: npu:Npun_F0994 lipoic acid
FT                   synthetase; PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63063"
FT                   /db_xref="GOA:D7E0F4"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0F4"
FT                   /inference="protein motif:TFAM:TIGR00510"
FT                   /protein_id="ADI63063.1"
FT                   /translation="MTLKPDWLRVKAPHWERVGNVKEILRDLSLNTVCEEASCPNIGEC
FT                   FNAGTATFLIMGPACTRACPYCDIDFEKKPQPLDSTEPTRLAEAVRRMWLNHVVITSVN
FT                   RDDLPDGGASQFVHCINAVRSVSPHTTIEVLIPDLCGNWNALEIILEAAPEVLNHNTET
FT                   ISRLYWRVRPQGNYERTMELLQRSRQISPSTYTKSGIMVGLGETDAEIRQVMQDLRAVD
FT                   CDILTIGQYLQPSQKHLQVAEFISREQFAAWKVFGEKLGFLQIISSPLTRSSYHAEQVR
FT                   ELITRHPR"
FT   gene            595643..595716
FT                   /locus_tag="Aazo_R0006"
FT                   /note="tRNA-Pro1"
FT   tRNA            595643..595716
FT                   /locus_tag="Aazo_R0006"
FT                   /product="tRNA-Pro"
FT   gene            complement(595736..596320)
FT                   /locus_tag="Aazo_0568"
FT   CDS_pept        complement(595736..596320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F5801 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63064"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0F5"
FT                   /inference="similar to AA sequence:KEGG:Npun_F5801"
FT                   /protein_id="ADI63064.1"
FT                   /translation="MRISSSMEMTEFCLEGRFLDFVIKDGYKLKGLLLATSEGQCYVKL
FT                   AKHLRVAFDLGLPHGTWLQVVGTKKYDSKKDELTLKAERVMATSVDMGLKPKPEAAKKQ
FT                   TILFCQKSGCMKSGGKAVCQMLEKELSDRGLDNKVNIKGTGCMKNCKAGPNLVMPDKTR
FT                   YSRIQARQVPAVIDKHLGKNMETEVPQFVKV"
FT   gene            complement(596361..596597)
FT                   /locus_tag="Aazo_0569"
FT   CDS_pept        complement(596361..596597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F5800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63065"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0F6"
FT                   /inference="similar to AA sequence:KEGG:Npun_F5800"
FT                   /protein_id="ADI63065.1"
FT                   /translation="MEEKKVIDINWADRWQVYQRLRQLDIPCTCEVNQPLRVEIATPIS
FT                   ALQAWSVMRQITASRQDRIRSLERCWCMRHNNF"
FT   gene            596912..597466
FT                   /locus_tag="Aazo_0570"
FT   CDS_pept        596912..597466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0570"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   ava:Ava_1894 ferritin and Dps"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63066"
FT                   /db_xref="GOA:D7E0F7"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0F7"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ADI63066.1"
FT                   /translation="MSDTQAILHNFGQVYDNPILLDNSVTAPVVEGFNVTLASFQALYL
FT                   QYQKHHFVVEGAEFTSLHDFFNDSYREVQDHIHEIGERLNGLGGVPAASFSKLAELCCF
FT                   EPEADGVYSSQKMVENDLAAEQVMIGVIRRQATQAESLGDRGTRYLYEKILLKTEERAY
FT                   HLAHLLAKESLTLGFLQPAHK"
FT   gene            598054..601338
FT                   /locus_tag="Aazo_0571"
FT   CDS_pept        598054..601338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0571"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: Carbamoyl-phosphate synthetase large chain
FT                   oligomerisation; MGS domain protein; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; Carbamoyl-phosphate
FT                   synthase L chain ATP-binding; KEGG: ana:alr3809 carbamoyl
FT                   phosphate synthase large subunit; SMART: MGS domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63067"
FT                   /db_xref="GOA:D7E0F8"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0F8"
FT                   /inference="protein motif:TFAM:TIGR01369"
FT                   /protein_id="ADI63067.1"
FT                   /translation="MPRRQDIRKILLLGSGPIVIGQACEFDYSGTQACKALREEGYEVV
FT                   LVNSNPATIMTDPETADRTYIEPLTPELVAKVIEKERPDALLPTMGGQTALNLAVALSK
FT                   NGVLDKYNVELIGAKLPAIEKAENRKLFNEAMGKIGVPVCPSGTASSLEESKEIAHHIG
FT                   TYPLIIRPAFTMGGTGGGIAYNQEEFELMAQVGIDASPVSQILIDQSLLGWKEYELEVM
FT                   RDLADNVVIICSIENFDPMGIHTGDSITVAPAQTLTDKEYQRLRDMAIKIIREIGVETG
FT                   GSNIQFAVNPVNGDVVVIEMNPRVSRSSALASKATGFPIAGIAAKLAVGYTLDEIKNDI
FT                   TKQTPASFEPTIDYVVIKIPRFAFEKFPGSDSVLTTQMKSVGEAMAIGRTFNESFQKAL
FT                   RSLETGRAGWGCDKSEKLPSAEQIRAQLRTPNPERVYALRHAMQLGITNEEIYELTAID
FT                   PWFLDKLQQILEVEKFLKRTPLQQLTKEKMYEVKRNGFSDRQIAYATKTKEDEVRAYRQ
FT                   KLGIKPVYKTVDTCAAEFEAFTPYYYSTYEEETEVLPTDKPKVMILGGGPNRIGQGIEF
FT                   DYCCCHAAYSLKAAGYETIMVNSNPETVSTDYDTSDRLYFEPLTKEDVINIIEAENPVG
FT                   IIVQFGGQTPLKLAIPLQQYLQGRSCQSPVSSSQSPVPQIWGTSPDSIDMAENRERFEN
FT                   ILQELNIAQPPNGIARSYEDALIVAKRIGYPVVVRPSYVLGGRGMEIVYSDAELERYMT
FT                   FAVQVEPEHPILIDKFLENAIEVDVDAIADYTGKVVIGGIMEHIEQAGIHSGDSACSLP
FT                   SISLSPAVLNQIRTWTVQLAQALSVVGLMNIQFAVVGANGYSPQVYILEANPRASRTVP
FT                   FVSKATGIPLAKLASLIMSGKTLEELNFTQEVIPSHIAVKEAVLPFNKFPGTDTLLGPE
FT                   MRSTGEVMGIDADFGRAFAKAELGAGEKLPRKGSVFVSMSDRDKGAAIEVVKEFISLGF
FT                   TIIATQGTRQVLQQNGVKVDLILKLHEGRPHVLDAIKNEKIQLIINTPSGEEAQTDARL
FT                   IRRTGLAYKIPIITTIAGARATVAAIRSLQNTTLDVKVIQEYCPMG"
FT   gene            601971..602969
FT                   /locus_tag="Aazo_0572"
FT   CDS_pept        601971..602969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0572"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD subfamily"
FT                   /note="KEGG: npu:Npun_R5797 RpoD family RNA polymerase
FT                   sigma factor; TIGRFAM: RNA polymerase sigma factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 3 domain protein; sigma-70 region 2 domain protein;
FT                   sigma-70 region 1.2; sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63068"
FT                   /db_xref="GOA:D7E0T9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0T9"
FT                   /inference="protein motif:TFAM:TIGR02997"
FT                   /protein_id="ADI63068.1"
FT                   /translation="MTLPANPSSPKSIAMKTAQTATDLVRTYLREIGRVPLLTHEEEIH
FT                   YGKQVQRCTTLYEVRENLATQLGYQPTLEEWAASAQVEPVELNTAIAEGEIAKRRMVEA
FT                   NLRLVVSVAKKYIKRNIDLLDLIQEGSIGMQRGVEKFDPTKGYRFSTYAYWWIRQAITR
FT                   AIAEKARTIRLPIHITEKLNKIKKAQRQLSQKLGRAPTAIELADELELTPRQVRECLEK
FT                   ARLPLSLDLRLGDNYDTELGEMLEDTGATPEDFVIQSSLSSDIERLMKELTPQQKEVIK
FT                   LRFGLIDGQALTLSKIGEILNISRERVRQIEREALTKLRKSKANINEYLAS"
FT   gene            603221..603565
FT                   /locus_tag="Aazo_0573"
FT   CDS_pept        603221..603565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R5796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63069"
FT                   /db_xref="InterPro:IPR008479"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0U0"
FT                   /inference="similar to AA sequence:KEGG:Npun_R5796"
FT                   /protein_id="ADI63069.1"
FT                   /translation="MSNQPNRVSEFFDSESETSNLWHYVKSLSPETVTQLSKPNSPEVF
FT                   HVMERNITGLLGNLPSEHFGVTITTNRENLGRLLASAMISGYFLRNAEQRMSFNMSLQE
FT                   TEANSSDVAE"
FT   gene            603757..604176
FT                   /locus_tag="Aazo_0574"
FT   CDS_pept        603757..604176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0574"
FT                   /product="mutator MutT protein"
FT                   /note="KEGG: ava:Ava_1890 mutator MutT; TIGRFAM: mutator
FT                   MutT protein; PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63070"
FT                   /db_xref="GOA:D7E0U1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0U1"
FT                   /inference="protein motif:TFAM:TIGR00586"
FT                   /protein_id="ADI63070.1"
FT                   /translation="MNKISTIPHKIIGVAVIWNDQKQILIDRRLPKGTMAGLWEFPGGK
FT                   IESRETIEECIGREILEELGIKIEVGIHLITINHTYSHLQVTLTVYHCRHLAGIPQAIE
FT                   CAEIRWVSLDELDDFSFPEANLAIITALRKGQNDN"
FT   gene            complement(604299..604598)
FT                   /locus_tag="Aazo_0575"
FT   CDS_pept        complement(604299..604598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0575"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: emi:Emin_1193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63071"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0U2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63071.1"
FT                   /translation="MFALNSTELRAAGFDLSSLSQQGSETFAFKSAKSLVPIGKYLATL
FT                   ILECNHDNDDAVVLKGETTHIKRLEPSTIFGLMTTALIFAASNFDKLRKFQLSK"
FT   gene            605030..605488
FT                   /locus_tag="Aazo_0576"
FT   CDS_pept        605030..605488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0576"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="KEGG: npu:Npun_R5794 signal transduction protein;
FT                   PFAM: CBS domain containing protein; SMART: CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63072"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0U3"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADI63072.1"
FT                   /translation="MPKTVADVMSSNPILVRPETPLKEAIQILAEKRISGLPVIDDAGK
FT                   VVGIISETDLMWQETGVTPPAYIMFLDSVIYLQNPGAYERDLHKALGQTVGEVMSKSPI
FT                   TITPDKPLKEAAKIIQEYKVHRLPVLDSTGQVIGILTRGDIIRAMATE"
FT   gene            605596..606252
FT                   /locus_tag="Aazo_0577"
FT   CDS_pept        605596..606252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0577"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: PBS lyase HEAT domain protein
FT                   repeat-containing protein; HEAT domain containing protein;
FT                   KEGG: ana:alr3814 phycocyanin alpha phycocyanobilin lyase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63073"
FT                   /db_xref="GOA:D7E0U4"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0U4"
FT                   /inference="protein motif:PFAM:PF03130"
FT                   /protein_id="ADI63073.1"
FT                   /translation="MSASAESVRELLSSENLGDRLRAVNQIRELEPNTGFELVQIAIGD
FT                   KNSRVRYSAVSQLDTLGEQDFDLSLRILRELLNDPEADVQAAAADCLGALKLHAAFEDL
FT                   EQLYHTTSEWLVQFSIIATLGAFGDPRSLELLKQALNSDNSLIQTAAISSLGELGDVQA
FT                   VSLLIPYSTNPDWQVRYIVVQALSNLGGAEAQSILETLVNDEVDAIRQEAKQALE"
FT   gene            complement(606390..607064)
FT                   /locus_tag="Aazo_0578"
FT   CDS_pept        complement(606390..607064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0578"
FT                   /product="protein of unknown function DUF1555"
FT                   /note="PFAM: protein of unknown function DUF1555; KEGG:
FT                   npu:Npun_F5792 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63074"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0U5"
FT                   /inference="protein motif:PFAM:PF07589"
FT                   /protein_id="ADI63074.1"
FT                   /translation="MFNFKSELLGAAAVLPIAAAGFLGSAGSAQALTLNGSIGINGTAI
FT                   VPSDGVNPATTSVTFVDVDGVDLTGDFANFTPNSDSNTLAITGISITTLNLTRTAIISA
FT                   IRATYLTGTYTPFIDFGERTLDGVTAFLTFDLDYTEVTITQLASNNISDVTLDGLTGRF
FT                   NFDGVTVATGFLNASLSGISSTYQLTIVTDLTPIPEPTTMLGLGLFAAGMTVARRRQLV
FT                   KA"
FT   gene            complement(607600..608118)
FT                   /locus_tag="Aazo_0579"
FT   CDS_pept        complement(607600..608118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0579"
FT                   /product="protein of unknown function DUF456"
FT                   /note="PFAM: protein of unknown function DUF456; KEGG:
FT                   npu:Npun_F5791 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63075"
FT                   /db_xref="GOA:D7E0U6"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0U6"
FT                   /inference="protein motif:PFAM:PF04306"
FT                   /protein_id="ADI63075.1"
FT                   /translation="MQIIYWLLIAVMLVGVVGAVVPAIPGSSLILVAIILWGIVSSSFT
FT                   AIKIPLIVTIIVLFSSMGVDFLGGYLGAKQAGASKWGQIGALVGLFLGFFGLLPTLPFG
FT                   GPLLGILLGPLLGSIIGDYTCRRDLGKAVKAGIGITVGTVVGNLLQGIIAVSAVVIFIW
FT                   TTWSQVYGG"
FT   gene            complement(608223..608861)
FT                   /locus_tag="Aazo_0580"
FT   CDS_pept        complement(608223..608861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all3821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63076"
FT                   /db_xref="GOA:D7E0U7"
FT                   /db_xref="InterPro:IPR021325"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0U7"
FT                   /inference="similar to AA sequence:KEGG:all3821"
FT                   /protein_id="ADI63076.1"
FT                   /translation="MTKSDPNVVLRRLPLVVGGLSAVLLLVNRLLTPELTNSQARGDVL
FT                   GVILSAVLILTGLIWQQVQPRSPDTVQLIGEEGFILAPDLPEAVKTELAWASHLLLTNT
FT                   VTRSLIVYYQGKVLLRRGILASKSEVIPGTILQRVLETQKPVYLVALKVYPGRIEFDYL
FT                   PENTQGVICQPIGKEGVLILGANAPRSYTKQDEKWIAGIADKLAVTIPE"
FT   gene            complement(608945..609673)
FT                   /locus_tag="Aazo_0581"
FT   CDS_pept        complement(608945..609673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0581"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: ava:Ava_1878 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63077"
FT                   /db_xref="GOA:D7E0U8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0U8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADI63077.1"
FT                   /translation="MDSHKEKILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALETF
FT                   RKAEPDLVVLDVMMPKLDGYGVCQELRKESDVPIIMLTALGDVADRITGLELGADDYVV
FT                   KPFSPKELEARIRSVLRRVDKTGATGIPSSGVIHVGNIRIDTNKRQVYKGDERIRLTGM
FT                   EFSLLELLVSRSGEAFSRSEILQEVWGYTPERHVDTRVVDVHISRLRAKLEDDPSNPEL
FT                   ILTARGTGYLFQRILESGEE"
FT   gene            609950..610289
FT                   /pseudo
FT                   /locus_tag="Aazo_0582"
FT                   /product="hypothetical protein"
FT   gene            610393..611049
FT                   /locus_tag="Aazo_0583"
FT   CDS_pept        610393..611049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0583"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: cyh:Cyan8802_4630 transposase, IS605 OrfB
FT                   family; TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63078"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0U9"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADI63078.1"
FT                   /translation="MDAPPIKSINQWFNKRNAQLQYIKDTLLIKGITNQQVKLTAKRNN
FT                   QVRDYLNKTGRFMVNHCIQNSIANLIVGYNPSIKQEINIGGCNNQNFVQIPFHTLPYKL
FT                   KAMCERYGLNYQEQDESYTSKASAPDGDEIPVYNAENPKEYQFSDKRIQRGFYRTKTAH
FT                   LVNADLNGSLNIGRKSKHEGFNRVSRGSLTAPRRINLLKLERKTPSKQYGFSLVV"
FT   gene            611247..612803
FT                   /locus_tag="Aazo_0584"
FT   CDS_pept        611247..612803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0584"
FT                   /product="DNA repair protein RadA"
FT                   /note="KEGG: npu:Npun_R5787 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63079"
FT                   /db_xref="GOA:D7E0V0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0V0"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADI63079.1"
FT                   /translation="MAKPKTIFICSKCGAEFSQWFGKCSNCDTYDSLVEQNARPFRVDI
FT                   LSHGGVGNWHAAQTNGKSTTKPAKPRASLTFEQISDRQIARWESGYRELDRVLGGGVVP
FT                   GSMVLIGGDPGIGKSTLLLQVSNQLAQKYRILYVTGEESGQQVKLRASRLGMSKPINIV
FT                   VTDETESKETDAAGTMDIQNSTEEPINPLSIGADLYVLPETDLEEILREIDSLKPNLAV
FT                   IDSIQTVFFPALTSAPGSVAQVRECTAALMKVAKHEDITMLIVGHVTKEGTIAGPRVLE
FT                   HLVDTVLYFEGDRFASHRLLRTVKNRFGATHEIGIFEMVSQGLREVNNPSELFLGNRDD
FT                   PAPGTAIVVACEGTRPIVVELQALVSPTSYPSPRRAGTGIDYNRLVQILAVLEKGVGIP
FT                   MSKLDSYVASAGGLNVEEPAVDLGIAIAIVASFRDRIVDPGTVLIGEVGLGGQVRSVSQ
FT                   MELRLKEAAKLGFKRAIVPKGQKFPDLNIEIVQVSKVIDAIIAAIPHQELTEEDLEPDE
FT                   E"
FT   gene            complement(612809..613640)
FT                   /pseudo
FT                   /locus_tag="Aazo_0585"
FT                   /product="hypothetical protein"
FT   gene            complement(613910..614242)
FT                   /locus_tag="Aazo_0586"
FT   CDS_pept        complement(613910..614242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0586"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: cyc:PCC7424_1486 dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; PFAM: dTDP-4-dehydrorhamnose 35-epimerase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63080"
FT                   /db_xref="GOA:D7E0V1"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0V1"
FT                   /inference="protein motif:PRIAM:5.1.3.13"
FT                   /protein_id="ADI63080.1"
FT                   /translation="MNVVFTEISDVLLIEPQILGDKRGFFYESYNERVFLEKVGILSHF
FT                   VQDNHSRSIKDVLRGLHYQIEKPQGKLVRVVVGSVFDVAVDLRKISATFGQSVGVCLSA
FT                   ENKDQL"
FT   gene            complement(614356..617993)
FT                   /pseudo
FT                   /locus_tag="Aazo_0587"
FT                   /product="hypothetical protein"
FT   gene            614990..616003
FT                   /pseudo
FT                   /locus_tag="Aazo_0588"
FT                   /product="hypothetical protein"
FT   gene            616194..617278
FT                   /pseudo
FT                   /locus_tag="Aazo_0589"
FT                   /product="hypothetical protein"
FT   gene            complement(618233..619321)
FT                   /locus_tag="Aazo_0590"
FT   CDS_pept        complement(618233..619321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0590"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="KEGG: nmu:Nmul_A0264 dTDP-glucose 4,6-dehydratase;
FT                   TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63081"
FT                   /db_xref="GOA:D7E0V2"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0V2"
FT                   /inference="protein motif:TFAM:TIGR01181"
FT                   /protein_id="ADI63081.1"
FT                   /translation="MSNLNKNDLPTLLVTGGAGFIGANFVLQVRKFKWANIVNLDKLTY
FT                   ASNLQNLAELQDDTNYYFIQGDVNNSELLSYLLEKYQPDAIINFAAETHVDRSIISPHN
FT                   FIQTNIVGTFELLEASKAYWQKLTSPKKEKFRFLHISTDEVYGSLSSTDPAFREDTPYA
FT                   PNSPYSASKAAADHLVRSYYHTYNLPTLTTNCSNNYGPLQFPEKLIPLTILNALNGKSL
FT                   PIYGDGQNIRDWLYVRDHCDAIYLVLIEGCIGETYNICGMNEQTNLVVVEKICAILDKL
FT                   APKDNFQYSSLISFIKDRPGHDRRYGIDCSKISKNLGWKPKENFDVGLLKTVQWYLNNS
FT                   AWVDSVCTGTYQGWIKQNYETR"
FT   gene            complement(619567..620519)
FT                   /pseudo
FT                   /locus_tag="Aazo_0591"
FT                   /product="hypothetical protein"
FT   gene            complement(620967..621644)
FT                   /locus_tag="Aazo_0592"
FT   CDS_pept        complement(620967..621644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0592"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   npu:Npun_F5778 PT repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63082"
FT                   /db_xref="GOA:D7E0V3"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0V3"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ADI63082.1"
FT                   /translation="MWCDLGKLRTTVALVCLVTVSAGISDIGFAVRQRNYKPQEFRAVL
FT                   HGLGYSVKVTNDALTDEEIKKAISEFQKGYKLTVDGKAGQKTQAFAANIVKILQGNLNA
FT                   ALKPNPPLPRDQFYSPRMEKLVKEYQKKNQLTETGIADLVLRQKLDENAKKAIGQTMKP
FT                   TAKPTVKPTTKPTVKPTTKPTVKPTTKPKATPTVKPTATPSTTTSTTPSAESTTTPSTK
FT                   AIP"
FT   gene            complement(621771..622215)
FT                   /pseudo
FT                   /locus_tag="Aazo_0593"
FT                   /product="hypothetical protein"
FT   gene            complement(622185..622568)
FT                   /pseudo
FT                   /locus_tag="Aazo_0594"
FT                   /product="hypothetical protein"
FT   gene            622822..624237
FT                   /locus_tag="Aazo_0595"
FT   CDS_pept        622822..624237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R5777 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63083"
FT                   /db_xref="GOA:D7E0V4"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0V4"
FT                   /inference="similar to AA sequence:KEGG:Npun_R5777"
FT                   /protein_id="ADI63083.1"
FT                   /translation="MSNPKSRKHHKLWFEKLIAITSTVNLGLVFFDLSYLPWRDFYFRK
FT                   VPQMTQIYDPIKGIEPHRDTNSYLQTVAALEEEVSQMGLKSPQVQIKLEEIGRLSTEMI
FT                   ETNPFAGVGKSGSLEKIKNRMREHIGQKSAKNAFLTFWSREYLSKRGWIQEINFFTQKI
FT                   RPAIATNYYRKIGENGELLDNFWLIDLPFVVIFGLELLARTFYIKRQNSHLSCLEAILW
FT                   RWYDLFLLIPFWRWLRILPVMVRLDKAQLISLHLIRRQIHQGIVANFAEEITGIVVVRV
FT                   INQMQGWIQVGDITPWLLQPEKERSDIDINNINEVEAIAGLLVQTIVNQVLPKIQPEIN
FT                   AILRHNIDTAFQQIPVYRNLLMLPVVGKAQTQVSEQLSNQITTNLYFTLVSAIQDPVAA
FT                   ELSNHLVEKFTTVIGSEIQQKHVIVEIKNLLNDFLEEVKINYIQRLSKEDIEQVIEQTR
FT                   QMRSQASVPKNSQ"
FT   gene            624489..624950
FT                   /locus_tag="Aazo_0596"
FT   CDS_pept        624489..624950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0596"
FT                   /product="protein of unknown function DUF150"
FT                   /note="PFAM: protein of unknown function DUF150; KEGG:
FT                   npu:Npun_R5776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63084"
FT                   /db_xref="GOA:D7E0V5"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0V5"
FT                   /inference="protein motif:PFAM:PF02576"
FT                   /protein_id="ADI63084.1"
FT                   /translation="MTHPLVPQIIDLAIPVAEQLGLEVVGIVLHTNQRPPVLRVDIRNT
FT                   QQDTSLDDCERMSRVLEASLDAAEIIPDAYVLEVSSPGISRQLITDREFISFKGFPVVI
FT                   STSQPYDGQQEWTGQLIRRGETKIYLNQKGRVVEIPRPLVTRVQLDERR"
FT   gene            625068..626345
FT                   /locus_tag="Aazo_0597"
FT   CDS_pept        625068..626345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0597"
FT                   /product="NusA antitermination factor"
FT                   /note="KEGG: npu:Npun_R5775 NusA antitermination factor;
FT                   TIGRFAM: transcription termination factor NusA; PFAM: NusA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63085"
FT                   /db_xref="GOA:D7E0V6"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0V6"
FT                   /inference="protein motif:TFAM:TIGR01953"
FT                   /protein_id="ADI63085.1"
FT                   /translation="MSMVTLPGLKELIESISRERNLPRLAVQSSIREALLKGYERYRRA
FT                   QNLERKQFDEDYFDNFEVELDIDGEGFRVLSTKTIVEQVNNSDHQISLEEVQQVAPEAQ
FT                   SGDSVVLDVTPDQGEFGRMAAMQTKQVLAQKLRDQQRQMVQEEFQDLESTVLQARVLRF
FT                   ERQSVILAVTSGFGQPEVEAELPKREQLPNDNYRANATFKVYLKKVSQGQQRGPQLLVS
FT                   RADAGLVVYLFANEVPEIEDEVVRIVAVAREANPPSRYVGPRTKIAVDTLDRDVDPVGA
FT                   CIGARGSRIQVVVNELRGEKIDVIRWSPDPATYIANALSPARVDEVRLMDPESRQTHVL
FT                   VAEDQLSLAIGKEGQNVRLAARLTGWKIDIKDKAKYDHGAEDTKFVAVRAKYQPEDDEN
FT                   EMEELEYENQEELELEHDRFGTGDED"
FT   gene            626498..626770
FT                   /locus_tag="Aazo_0598"
FT   CDS_pept        626498..626770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0598"
FT                   /product="protein of unknown function DUF448"
FT                   /note="PFAM: protein of unknown function DUF448; KEGG:
FT                   npu:Npun_R5774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63086"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0V7"
FT                   /inference="protein motif:PFAM:PF04296"
FT                   /protein_id="ADI63086.1"
FT                   /translation="MKPNYRRCISCRRLGLREEFWRIVRLFPSGKVQLDEGMGRSAYIC
FT                   PQTSCLQAAQKKNRLGRSLHGAVPETVYQTLWQRLTVSNTQENQI"
FT   gene            627259..630387
FT                   /locus_tag="Aazo_0599"
FT   CDS_pept        627259..630387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0599"
FT                   /product="translation initiation factor IF-2"
FT                   /note="KEGG: npu:Npun_R5773 translation initiation factor
FT                   IF-2; TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; translation initiation factor IF-2 domain
FT                   protein; elongation factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63087"
FT                   /db_xref="GOA:D7E0V8"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0V8"
FT                   /inference="protein motif:TFAM:TIGR00487"
FT                   /protein_id="ADI63087.1"
FT                   /translation="MNNGKVRIYELSKELNLDNKELLAICDQLNIAVKSHSSTISESDA
FT                   EEIRTAAQKLAATSVTPKKELGTNNHKPNSLQTGGRNRPAATHKQQILEIRKPKILRNT
FT                   TSRPDSDSITTNNQVPSSDSLQDGALVNSPSPPRPFATQVSPMKPTAPTRPVPRNQSET
FT                   PQKPKIPETDKTTNPNPPESEKIAAEKPEKTVSPRPKPEKTPKPQLVDPPSRPAEETEP
FT                   VSEQLSQAVKPILKRERLKRGDEEREQGKPKVGKPSTEQRARSTPSSPTRPEPRGNRPS
FT                   PLGTSSIDVQRPRPSRHSEPPAAPVATPPRQIAGVGAKKEGLDDTPITPDLLDLKRPLP
FT                   PRIAKGGKKWQEEEIIDEIKEKAKVGPKGKRAKPILDDDFEEDDLLDEDGLAIPATVQV
FT                   SLSIARPSKPKVTRSPQQPTLAAYAPTTKNKKSGSYRDQNRRQQEVEVKRERPEKLIVT
FT                   GPLTVQELAEGLVMADTEIVKILFMKGMAVSITQNLDIPTITLVAKELEVEVETAEPEA
FT                   EARKVTEMIDIADLEHLIRRPPVVTIMGHVDHGKTTLLDSIRKTKVAAGEAGGITQHIG
FT                   AYHVDLENEGKQQQIVFLDTPGHEAFTAMRARGARVTDIAILVVAADDGVRPQTVEAIS
FT                   HAQAAGVPIVVAINKIDKEGAQPERVKQELTNYGLTAEDWGGETIMVPVSAIKGENLDT
FT                   LLEMVLLVAEVGELSANPNRVAKGTVIEAHLDKAKGAVATLLIQNGTLHVGDMLVAGSA
FT                   FGKVRAMVDDRGKRVEAASPSFAVEVLGLSDVPAAGDDFEVFANEKEARSLASDRADKQ
FT                   RQSRLLQGRVTLTTLSAQAQEGELKELNLILKGDVQGSVEAIISSLKQIPQNEVQIRML
FT                   LATAGEITETDIDLAAASNAVIIGFNTTYASGARQAADEAGVDVREYNIIYKLLEDIQG
FT                   ALEGLLEPELVEEPLGQTEVRAVFPVGRGAVAGCYVQSGKLLRNCKVRVRRGNKVVYEG
FT                   VLDSLKRMKEDVREVNSGYECGIGIDKFHDWAEGDIIESYQMVTKRRTLTLTK"
FT   gene            631042..631239
FT                   /locus_tag="Aazo_0600"
FT   CDS_pept        631042..631239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1865 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63088"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0V9"
FT                   /inference="similar to AA sequence:KEGG:Ava_1865"
FT                   /protein_id="ADI63088.1"
FT                   /translation="MAQISATSPGQLSRDNRIWQNLKYAISASSGFQSWQLECNTQLQG
FT                   LHLEQQLQRYLRETLETLAY"
FT   gene            631731..633371
FT                   /locus_tag="Aazo_0601"
FT   CDS_pept        631731..633371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0601"
FT                   /product="protein of unknown function DUF1565"
FT                   /note="KEGG: npu:Npun_R5769 hypothetical protein; PFAM:
FT                   protein of unknown function DUF1565; S-layer domain
FT                   protein; SMART: Carbohydrate-binding and sugar hydrolysis;
FT                   Parallel beta-helix repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63089"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011459"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0W0"
FT                   /inference="protein motif:PFAM:PF07602"
FT                   /protein_id="ADI63089.1"
FT                   /translation="MKYSGFHISTLSLGASLTALLVIASSSMLLTSQVNAGSPPTVIAQ
FT                   IPASATVIYVNPVIGQDSSSAGITPEAPYKTITFALSQAKSNTVIKLAPGTYTKDTGET
FT                   FPLLLKLGVILVGNESIKGQGTVIIGGGHYISRTFARQDITILAENTTIAGITVTNPNQ
FT                   RGTAVWVESSSPTIKNNTFTDSIRDGVFVTGTGNPKIENNLFIKNRGNGISITKYAQGE
FT                   IRNNSFEDTGFGLAIGGSSTPLVEGNQILQNQDGIFISESAKPILRKNVIQNNRRDGIV
FT                   ATIDALPNLGTNDNPGSNLIRNNTRYDLNNSTKVNRIVAIGNDFDQKRIFGAVDFVAAT
FT                   VNPPTGGGTTGSTGFQDVPTGYWAKAYIEALASQNIIAGFPDGTFKPNDPVTRAQFATI
FT                   ITKALAPPSRRTAIRFNDVNSNFWAYGAIQSAYQSQFVAGYPDGTFKPQQQIPRVQALV
FT                   ALANGLNLTANNESILSFYTDAAQIPNYAMGSVAAATVRQLVVNYPTVKLLDPNREATR
FT                   AEIAAFVYQALVTIGRAQPTPSPYVVTAQ"
FT   gene            complement(633468..633737)
FT                   /locus_tag="Aazo_0602"
FT   CDS_pept        complement(633468..633737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63090"
FT                   /db_xref="GOA:D7E0W1"
FT                   /db_xref="InterPro:IPR021883"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0W1"
FT                   /inference="similar to AA sequence:KEGG:Ava_3179"
FT                   /protein_id="ADI63090.1"
FT                   /translation="MVEPNPKNRLNSKQYAQLKAEITAPYRGLRQFIYVGIGASGFIGA
FT                   FVFSFQILAGRNIDSALPNFTLEAGIVGLMVFLYRWEQRRQKGS"
FT   gene            633774..633845
FT                   /locus_tag="Aazo_R0007"
FT                   /note="tRNA-Thr2"
FT   tRNA            633774..633845
FT                   /locus_tag="Aazo_R0007"
FT                   /product="tRNA-Thr"
FT   gene            633937..634104
FT                   /locus_tag="Aazo_0603"
FT   CDS_pept        633937..634104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0603"
FT                   /product="MerR family transcriptional regulator"
FT                   /note="KEGG: ava:Ava_1160 MerR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63091"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0W2"
FT                   /inference="similar to AA sequence:KEGG:Ava_1160"
FT                   /protein_id="ADI63091.1"
FT                   /translation="MDLVAIVYWLCVGISFDIACETLKRLKAKESEWFTSGQVKQLILL
FT                   SPQDAPLSLI"
FT   gene            634150..635164
FT                   /pseudo
FT                   /locus_tag="Aazo_0604"
FT                   /product="hypothetical protein"
FT   gene            complement(635184..635850)
FT                   /pseudo
FT                   /locus_tag="Aazo_0605"
FT                   /product="hypothetical protein"
FT   gene            635988..636813
FT                   /pseudo
FT                   /locus_tag="Aazo_0606"
FT                   /product="hypothetical protein"
FT   gene            complement(637050..638435)
FT                   /locus_tag="Aazo_0607"
FT   CDS_pept        complement(637050..638435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0607"
FT                   /product="S-layer domain-containing protein"
FT                   /note="KEGG: npu:Npun_F5765 S-layer domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63092"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0W3"
FT                   /inference="similar to AA sequence:KEGG:Npun_F5765"
FT                   /protein_id="ADI63092.1"
FT                   /translation="MSSKRPAIFLSMAVLLSSLTACSNSPASKNLEQSLAADPLLQNNP
FT                   TVFGQAKNKEISTTPTVQLPTDFPQEVPIYPNATLQEVKPANNSENSEPKTITRWQSSD
FT                   PTNFITSFYRSQFQNQNWQILQQPKDDTEGIFEVKQNNLLLKVTIRPKSVTNVTPNQAQ
FT                   TTTELLIEYLANEIAINQPTINQPDLNQNSNPNSSEVAQPPNPQFIGPIIPNANVVQQP
FT                   VIPKNTSEPQEFSDLNQAPAEWRKQIQDLATLGVLSIEPEQTQPNSNSRNNQFQPNKII
FT                   TRREYARWLVAANNTMYANNPGKQIRLASGNDQPAFRDVLPKDPDFLTVQGLAEAGLIP
FT                   SSLSGDTTAVLFRPDAPLTREQLLLWKVPLDTRQALPAANLEAVKQTWGFQDTEKIDPK
FT                   ALRAILADFQGAQQSNIRRVFGYTTLFQPKKAVTRAEAGAALSYFGIQSEGISATEALK
FT                   LKV"
FT   gene            complement(638550..639980)
FT                   /pseudo
FT                   /locus_tag="Aazo_0608"
FT                   /product="hypothetical protein"
FT   gene            640278..641465
FT                   /locus_tag="Aazo_0609"
FT   CDS_pept        640278..641465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0609"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: KaiB domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; KEGG:
FT                   npu:Npun_R5764 histidine kinase; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63093"
FT                   /db_xref="GOA:D7E0W4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011649"
FT                   /db_xref="InterPro:IPR023527"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0W4"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ADI63093.1"
FT                   /translation="MKVSQDQPIYSEAPLQLLLFVDGRPKSRQQVQRIRAYLKELEAQY
FT                   SFELQMIDVGQQPYLAEHFKLIATPALIKIHPEPQQTLAGSNIIAELKNWWPRWQTAVD
FT                   AFLKLQEDLQERIEEDGRGTSPQSTIRSVAVSAELIRLSDEIFHLKQEKEKLQEQLQFK
FT                   DRVMSMLAHDLRNPLTATAIAIETLQSNYNVEVGEFQRLKPAMTAQLLKQARNQTRIID
FT                   RMIADLLQVGRGHDTEFPIVPQKLELGKLSLEVLEELRDRYIAKSQKIETDIPNDLPRV
FT                   YADPERIRQVLVNLLDNAIKYTPGDGIISLAALHRTTQKVQFTIGDTGPGIPQENRDRI
FT                   FENHFRLQRDEGTDGYGIGLALCQRIVRAHYGQIWVDSGPHGGAWFHFTLPVYPS"
FT   gene            641564..641824
FT                   /locus_tag="Aazo_0610"
FT   CDS_pept        641564..641824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0610"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R5762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63094"
FT                   /db_xref="InterPro:IPR021954"
FT                   /db_xref="InterPro:IPR038150"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0W5"
FT                   /inference="similar to AA sequence:KEGG:Npun_R5762"
FT                   /protein_id="ADI63094.1"
FT                   /translation="MPNLLMYQQDHFLVLETNQTEQFLTLSELLEKLENVLQQLPFDDL
FT                   PPDVQKLKLVSEQAQYLVDSSCDLDVGPGKYLQWYAVRLEK"
FT   gene            complement(641905..642450)
FT                   /locus_tag="Aazo_0611"
FT   CDS_pept        complement(641905..642450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0611"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63095"
FT                   /db_xref="GOA:D7E0W6"
FT                   /db_xref="InterPro:IPR021275"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0W6"
FT                   /inference="similar to AA sequence:KEGG:Ava_3168"
FT                   /protein_id="ADI63095.1"
FT                   /translation="MLGKISLGTLGLTVGGILIIVGFIAYAVENATLNLVGFFYGFPLF
FT                   LGGLALKANELKPIPFSQRTTPSILDLRKQQATVTQNKIRTDITRFCYGQEAHLDRALA
FT                   YLGLSPSDEKRPIVTGLRETELNGAYSLILEFDSPLIPIDIWQQKHAKMTKYFAPNVEV
FT                   KITQPAENRIELELIKTQ"
FT   gene            642581..642775
FT                   /locus_tag="Aazo_0612"
FT   CDS_pept        642581..642775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0612"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R5760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63096"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0W7"
FT                   /inference="similar to AA sequence:KEGG:Npun_R5760"
FT                   /protein_id="ADI63096.1"
FT                   /translation="MELQTIKERISSVQTKRDYLLSLLEQPNLGTLRVDVNQALEELDD
FT                   LIDEFKRIIPQADSKPFKL"
FT   gene            complement(642975..643385)
FT                   /locus_tag="Aazo_0613"
FT   CDS_pept        complement(642975..643385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0613"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: npu:Npun_F5759 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63097"
FT                   /db_xref="GOA:D7E0W8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0W8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADI63097.1"
FT                   /translation="MLSCESFSLRVLLVDDHELTRLSLQLVFSCQENIQVVGLASNGQE
FT                   AIEMVKSSQPDVIVLDLHMPVMDGWCASRYIKSISPNTQILAYSSIEDHYLQQTKAMHN
FT                   FDDVCKKDAPTNELIALVRQLGQRAANNSSVG"
FT   gene            643649..646142
FT                   /pseudo
FT                   /locus_tag="Aazo_0614"
FT                   /product="hypothetical protein"
FT   gene            644280..645356
FT                   /pseudo
FT                   /locus_tag="Aazo_0615"
FT                   /product="hypothetical protein"
FT   gene            complement(646367..648532)
FT                   /locus_tag="Aazo_0616"
FT   CDS_pept        complement(646367..648532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0616"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="KEGG: npu:Npun_F5758 polyphosphate kinase; PFAM:
FT                   Polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63098"
FT                   /db_xref="GOA:D7E0W9"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0W9"
FT                   /inference="protein motif:PRIAM:2.7.4.1"
FT                   /protein_id="ADI63098.1"
FT                   /translation="MPKSKKTNPAINLSDAQYYINRELSWLQFNSRVLHEACDERTPLL
FT                   ERLKFLAIFSSNLDEFFMVRVAALKQQVEAKVNLLTPDGRTPQQQLDDIRSYLNPVVTK
FT                   HNEQFERVLQPLLLNQGIYILDYIELNSKQRSYLDHYFKEQIFPVLTPLAVDPSHPFPY
FT                   ISNLSLNLAVVVKNPETEEEFFARVKVPSVLPRFLPLPSELGLQNNGKPVYWTGIPLEQ
FT                   AIAHNLEYLFPGMNIQECHPFRITRDADLELEEDEADDLLLAIEQELRKRRMGGTPVRL
FT                   EIKSQTPEVLRCRLLQDLELTENDIYQVDGLLGLRDLMYFMALPLSALKELPRQSVVPY
FT                   RLQRLREPNIDPDLLELEEGKDFFSIIREKDLLVHHPYQSFSGTVERFITHAAWDPNVL
FT                   AIKMTLYRTSGDSPIVNALIAAAENGKQVSVLVELKARFDEENNIYWARRLEKVGVHVV
FT                   YGLVGLKTHSKIVLVVRREKDRIRRYVHIGTGNYNPKTARLYTDLGLLSCREELGADLT
FT                   DLFNFLTGYSLQKSYREILVAPVNMRDCFLGLIKREIENVKNGFSGRIVAKMNALVDPE
FT                   IIAALYDASRTGVQIDLIIRGICCLRPGLKDISENIRVISIIGRFLEHSRIFYFYNNTQ
FT                   EEIYIGSADWMRRNLDRRVEVTTPIKDQDIAKDLQEILGIMLADNRQAWELQSDGSYIQ
FT                   RRPCDNCPEANSQKTFMSMALRSTNMT"
FT   gene            648674..649623
FT                   /pseudo
FT                   /locus_tag="Aazo_0617"
FT                   /product="hypothetical protein"
FT   gene            649845..651209
FT                   /locus_tag="Aazo_0618"
FT   CDS_pept        649845..651209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0618"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: ava:Ava_3159 periplasmic sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63099"
FT                   /db_xref="GOA:D7E0X0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0X0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADI63099.1"
FT                   /translation="MFQATRRRLALWYTAVTAILLLLFATGVYLYVRNTLIERVDDTLN
FT                   HVVEVVERSLVIEPVNFQPDKLRVNVEASFRNNSHTAEDDRIDLEWFSPTGELWWSTFS
FT                   EPINIPIHGNTGETVRVVRLGGWGDSELLLRQVTHRVEMGRQVLGYLRVSHPWFEVTKP
FT                   SRQLIFDLALGIWLMVLSVAASGWFLSGKAMEPVGESYERLKQFTADASHELRSPIALI
FT                   QTNVQVALADLDLETSSVAHYQQQLKLVERLTKRLGKLVNDLLFLARQDSEIGQEVFST
FT                   CPLDALLMEVVEEQQLVAKEKEITLTLNLVDPSLELDPELQDNWFTLMGNWDQLVRLCT
FT                   NLIGNALHYTPTQGKVQVELARVSGVRYGVACLEVKISDTGVGIPPESLPRLFDRFYRV
FT                   DPARTHQSRETTTSSGLGLAIAQAIVEHHQGQIQVESIFSKGTTFTVILPITLEY"
FT   gene            651551..652366
FT                   /pseudo
FT                   /locus_tag="Aazo_0619"
FT                   /product="hypothetical protein"
FT   gene            652464..653219
FT                   /locus_tag="Aazo_0620"
FT   CDS_pept        652464..653219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0620"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63100"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0X1"
FT                   /inference="similar to AA sequence:KEGG:Ava_3157"
FT                   /protein_id="ADI63100.1"
FT                   /translation="MDFPKYMKLFGTVCSGLLMNLPIIPQAVLAKETTSKLNPCPGILY
FT                   EEPYNIRVIVPAVCPPNDLTLILMQLGLLPVPTTPPPYQVRLGVGGEAPAPSALNPNPG
FT                   IFSEQPYNRSQRGFRSGDNVQTVPTLPPSNSLQLPASEQRQDPSARMTLADSKVNIKLI
FT                   NNSGANVTYQVIGDTAPRKLQGKSGVTLRSLSTPVTVTFQREDGGFLMVTPKPGQEKGT
FT                   LEVTLQETSDFNQDRSAMNIQSNGSVFLN"
FT   gene            complement(653314..654420)
FT                   /locus_tag="Aazo_0621"
FT   CDS_pept        complement(653314..654420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0621"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: ana:alr3584 hypothetical protein; PFAM: TPR
FT                   repeat-containing protein; SMART: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63101"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0X2"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADI63101.1"
FT                   /translation="MKKLHFLSNSTIFSLHDSLILQQVHKLPAIIIYTLLFTASSIPTG
FT                   ANAIDITNQIYSPLNHPIGKRLNVRQFREEADRLLCLGRQQYASGSVNKTIEYGLKALE
FT                   IYHSLGDMNAQGSTYDLLAGAYLKLGNLKDAEGAIRRRLGIARDNKDFKNQIFGLNNLA
FT                   TLLLQKGEPKAAGETIQDALVIARNLDDIEGKGLSLSNLSLVYIRLGDYNQAVKLAETA
FT                   LFFRRQTGNVIGEINTLNNLGDSYLMVGDYGNTIGAYGTAMRLAKMNSYRRDQLRAIDG
FT                   LVTAHSAVGRYERCLELLEQRLAIAKFLNSPNEELKYFVSSGQLYEQIRDYPKARNFYE
FT                   QALSLARKLDDIKQEAKLMHSLNQLKGS"
FT   gene            complement(654522..655145)
FT                   /locus_tag="Aazo_0622"
FT   CDS_pept        complement(654522..655145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0622"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R5196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63102"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0X3"
FT                   /inference="similar to AA sequence:KEGG:Npun_R5196"
FT                   /protein_id="ADI63102.1"
FT                   /translation="MQIPSFPEANHPLVKSLFHHTDQELLTLFRRYPDDGKYFTVIFCR
FT                   YSPIVYTLIQHSARSPVQADYLFALTWRHIYYELGALYLTNPETGEDILTLQNWLINIT
FT                   AFCINEIKLPPTEAIHYSLKDTSPPLWCYIEQSLDQLPSILRLIVLMAQTLHWSETRIA
FT                   AYLQAEGEKTSPDEVANFLQEGYRILEDKLPADIRAIYLGENAA"
FT   gene            655360..655956
FT                   /locus_tag="Aazo_0623"
FT   CDS_pept        655360..655956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0623"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F5197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63103"
FT                   /db_xref="GOA:D7E0X4"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0X4"
FT                   /inference="similar to AA sequence:KEGG:Npun_F5197"
FT                   /protein_id="ADI63103.1"
FT                   /translation="MVIAANLIPFLLSPFTLGSFLPSLPLDSLFSTQGIMIMLLAGYAG
FT                   AMWMFLTSAPKVYTVMVSDLEIARQLYEGLLDLPAAEVPLHYYYNYEQTIGATGIDPLY
FT                   LSTSPSWSNKMMNNANDGLWYQLKKNTQLHIITGASIGTKNQQRHVCFDHECLELILMR
FT                   VETRGLKFKIRNQKPLNFLVKDYEGRVIELAEVKG"
FT   gene            complement(656481..660623)
FT                   /pseudo
FT                   /locus_tag="Aazo_0624"
FT                   /product="hypothetical protein"
FT   gene            complement(656936..657326)
FT                   /pseudo
FT                   /locus_tag="Aazo_0625"
FT                   /product="hypothetical protein"
FT   gene            complement(657296..657679)
FT                   /locus_tag="Aazo_0626"
FT   CDS_pept        complement(657296..657679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:657521..657523,aa:Sec)
FT                   /locus_tag="Aazo_0626"
FT                   /product="transposase"
FT                   /note="Contains selenocysteine; KEGG: ava:Ava_B0073
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63104"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0X5"
FT                   /inference="similar to AA sequence:KEGG:Ava_B0073"
FT                   /protein_id="ADI63104.1"
FT                   /translation="MERKSYPTDLADMDWEILAPLIPPAKEGGHPPTTDMGEICNAIYY
FT                   HLKAGCQUNILPGDFPPRSTVYSYYRKWQVQGIWEKFNHTLGGQVRSKLGKSTQPTAFA
FT                   ADSQSVNTDQKKGMCMVLTDVKR"
FT   gene            complement(658300..659565)
FT                   /pseudo
FT                   /locus_tag="Aazo_0627"
FT                   /product="hypothetical protein"
FT   gene            complement(660774..661141)
FT                   /pseudo
FT                   /locus_tag="Aazo_0628"
FT                   /product="hypothetical protein"
FT   gene            complement(661389..661843)
FT                   /pseudo
FT                   /locus_tag="Aazo_0629"
FT                   /product="hypothetical protein"
FT   gene            661827..661970
FT                   /locus_tag="Aazo_0630"
FT   CDS_pept        661827..661970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0630"
FT                   /product="thioredoxin"
FT                   /note="KEGG: bte:BTH_II1256 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63105"
FT                   /db_xref="GOA:D7E0X6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0X6"
FT                   /inference="similar to AA sequence:KEGG:BTH_II1256"
FT                   /protein_id="ADI63105.1"
FT                   /translation="MPESLRKTFQALSGKEDRNISEVVTEVVEGYVQKHDPDYKVKSPI
FT                   AI"
FT   gene            662037..662656
FT                   /pseudo
FT                   /locus_tag="Aazo_0631"
FT                   /product="hypothetical protein"
FT   gene            complement(663009..664126)
FT                   /pseudo
FT                   /locus_tag="Aazo_0632"
FT                   /product="hypothetical protein"
FT   gene            664255..665800
FT                   /pseudo
FT                   /locus_tag="Aazo_0633"
FT                   /product="hypothetical protein"
FT   gene            665916..666077
FT                   /locus_tag="Aazo_0634"
FT   CDS_pept        665916..666077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63106"
FT                   /db_xref="GOA:D7E0X7"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0X7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63106.1"
FT                   /translation="MIYLLNIFIYLLTPLGGVLSYCSLLRIAFDAIFGALLFLQCLLLL
FT                   HMFVVMLP"
FT   gene            complement(666445..666873)
FT                   /locus_tag="Aazo_0635"
FT   CDS_pept        complement(666445..666873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0635"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R5205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63107"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0X8"
FT                   /inference="similar to AA sequence:KEGG:Npun_R5205"
FT                   /protein_id="ADI63107.1"
FT                   /translation="MIIKLKKRLFALLLIVYVAFLLPEITVASANNFFNSSQVIFTSYS
FT                   EDTKDTITFSEGDLTPQEHQKLQAVRQRRNKEIIAVLNSAQRKQIAHYLHTGNDLNHAL
FT                   EALDLTSEQQELINAAIEFTNLKLKGIFSNHALLSTDK"
FT   gene            667266..668204
FT                   /locus_tag="Aazo_0636"
FT   CDS_pept        667266..668204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0636"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: nmu:Nmul_A0684 AAA ATPase, central region;
FT                   PFAM: AAA ATPase central domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63108"
FT                   /db_xref="GOA:D7E0X9"
FT                   /db_xref="InterPro:IPR000470"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0X9"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADI63108.1"
FT                   /translation="MSEQVLNKETISPVTQDSEIDLEAAFSESHIQDILDKLDQELVGL
FT                   KSVKNKIKEMAALLLVDRIRKSLGLTAGAPSLHMTFLGNPGMGKTTVAMRMAEILYRLE
FT                   YIRKENVMLVTRDDLVGQGIGQTAPKTREVLNNAMGGVLLVDEAYTLYRPDHPGDFGLE
FT                   AIEILMQVMENQRDDLVVILAGYKTQMEHFFHSNPGMNSRIGIHIEFNDYSVDNLLIIA
FT                   QSIVRTQNYCFSPDAEQAFREYLIRRKTMPHFANARSVRNAIDRARLRQASRLLNSGKK
FT                   INKQDLITIEAVDILASRVFREGVPDCEPES"
FT   gene            complement(668344..669306)
FT                   /locus_tag="Aazo_0637"
FT   CDS_pept        complement(668344..669306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0637"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: ana:all4074
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63109"
FT                   /db_xref="GOA:D7E0Y0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Y0"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADI63109.1"
FT                   /translation="MPTYTGISSEAFRHPLDRQAEQALRSLSGFDLIARKFVEFVYERP
FT                   QLVYLMGNTIQVGPRQYSTIYQIFRECVRDLDIYPEPTLFISHNPQANSYALGQENPYI
FT                   VLNTGILDLLNEAEIRAVLAHELGHIKCGHTILIQIAMWAMSAASVIGELTFALGDFVS
FT                   QALIYAFFEWRRKAELSGDRAALLVMDDLDPVMSSMMKISGGSNKYANECSLQEFIQQS
FT                   EKYQALDDDGLNQVYKFLMYNGAQGMMLTHPLPVERLHYLRSWAVSEEYQQVRQGNYQQ
FT                   TPTTRAVNVKVETQENEAEKLRKQIEELQKEINRMKNSD"
FT   gene            669470..671032
FT                   /locus_tag="Aazo_0638"
FT   CDS_pept        669470..671032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0638"
FT                   /product="putative ATP-dependent DNA helicase DinG"
FT                   /note="KEGG: npu:Npun_F5207 putative ATP-dependent DNA
FT                   helicase DinG"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63110"
FT                   /db_xref="GOA:D7E0Y1"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Y1"
FT                   /inference="similar to AA sequence:KEGG:Npun_F5207"
FT                   /protein_id="ADI63110.1"
FT                   /translation="MIEAEVHLSLHNFLRSQAGFPSWPHHLTMARLVARALRLGRSALI
FT                   QVGAVCGYQGRYRTSFIASSLMWHGPVIIVASEVVQQRLLKIEIPRLQQWLQANKPIRT
FT                   GEVWPGTDFQGLLLTSPEAWLKGQLADNDSFPPNIPTIIDGVDDLEDWVRHQLTQEIQS
FT                   HDWDQLMLACPYEANVIREARVQLTHELFQHPENPYHCYLLSQPETEILQNLFLALDSD
FT                   SFPDIWKHLRQQFQSLVDNPSSSASPPLFWATIARRQGLFSLHYAPLELAKALTPIWQR
FT                   QPVVLIGSALEPETEAPLFRQRLGFKDVTCLKFSTDSQGEAIQLYAPYKLPLPNTPEFQ
FT                   GAFIHQVRTLVCLSATAPGMTLVLVGDVPLKSRVAAILASEFGSRVQVEKTCLDENGIL
FT                   VTGWEYWRAHQTVLPAPRLLIIATLPLPSLENPLVAGRVAHYKRAHQDWFRLYLLPTAL
FT                   NELQRAIAPLRENQGIVALLDSRVVNRSYGVQILTALSPLARLNYLDPSLFSPPNDENS
FT                   NRE"
FT   gene            671226..671441
FT                   /locus_tag="Aazo_0639"
FT   CDS_pept        671226..671441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0639"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63111"
FT                   /db_xref="GOA:D7E0Y2"
FT                   /db_xref="InterPro:IPR021262"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Y2"
FT                   /inference="similar to AA sequence:KEGG:Ava_3144"
FT                   /protein_id="ADI63111.1"
FT                   /translation="MGEAKRRKSTLGEQYGEDTRILPWVPITKSQAELFVSLTTRGAWI
FT                   GIGLMFAAWVTIRFIGPAFGWWQVVD"
FT   gene            672204..672548
FT                   /locus_tag="Aazo_0640"
FT   CDS_pept        672204..672548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0640"
FT                   /product="Domain of unknown function DUF1815"
FT                   /note="PFAM: Domain of unknown function DUF1815; KEGG:
FT                   npu:Npun_F5965 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63112"
FT                   /db_xref="InterPro:IPR014943"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Y3"
FT                   /inference="protein motif:PFAM:PF08844"
FT                   /protein_id="ADI63112.1"
FT                   /translation="MFLRLAHQHRQFVQDLVMNLQALAIVLERNGYPASCYTCGDQMNS
FT                   ASFMVSLGDNHLIRFLVSDYGITWTEMRDERELMKLEGAEAIHQLQELANLVKQSIQSP
FT                   TGHKTLIKKC"
FT   gene            672751..673248
FT                   /locus_tag="Aazo_0641"
FT   CDS_pept        672751..673248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0641"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   npu:Npun_F5967 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63113"
FT                   /db_xref="GOA:D7E0Y4"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Y4"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADI63113.1"
FT                   /translation="MTQAKVNQPKLPPTSAINKVTTAEFDNWFEYPMRVQPHHTDYAGI
FT                   AWHGTYLTWLEEARVEYLRSIGIEFADLVALGCDLPVVELLVRYHRSLKLGMIALIKTR
FT                   MLEVTGVHINWDYKIVSTDEQELYVTAQITLVALDRERGKIMPQLPPAVKDALAKTSTS
FT                   YK"
FT   gene            complement(673299..673496)
FT                   /locus_tag="Aazo_0642"
FT   CDS_pept        complement(673299..673496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0642"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R5968 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63114"
FT                   /db_xref="GOA:D7E0Y5"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Y5"
FT                   /inference="similar to AA sequence:KEGG:Npun_R5968"
FT                   /protein_id="ADI63114.1"
FT                   /translation="MIITLIVAWIIFLILWKLVKTTIKTAVTFAAIVVLLYFGFGITPQ
FT                   DILHKISEITQKFSQTPVRN"
FT   gene            complement(673913..674836)
FT                   /pseudo
FT                   /locus_tag="Aazo_0643"
FT                   /product="hypothetical protein"
FT   gene            complement(674852..675277)
FT                   /pseudo
FT                   /locus_tag="Aazo_0644"
FT                   /product="hypothetical protein"
FT   gene            675286..675813
FT                   /locus_tag="Aazo_0645"
FT   CDS_pept        675286..675813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0645"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mei:Msip34_2832 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63115"
FT                   /db_xref="GOA:D7E0Y6"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Y6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63115.1"
FT                   /translation="MISLLLKFFASCLIFYNALCPTLNFFLFFSYPYLLRRYLFTEADR
FT                   STISEKRAEAFEKIEFNLKNKPFKTLRGNYQLEIIVRKVCIETWFLGNRNLLPRNRQVN
FT                   KILSKYIEYFHLRLSDTEDLANGLEQNEGNTKEILGYKTKALFHEGYLREIFKERNLSY
FT                   SKSRQKEVPEES"
FT   gene            complement(675972..677168)
FT                   /locus_tag="Aazo_0646"
FT   CDS_pept        complement(675972..677168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0646"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="TIGRFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; KEGG: ana:alr4351 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase; PFAM: 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63116"
FT                   /db_xref="GOA:D7E0Y7"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Y7"
FT                   /inference="protein motif:TFAM:TIGR00243"
FT                   /protein_id="ADI63116.1"
FT                   /translation="MKAITLLGSTGSIGTQTLDIVSEHPDKFRIVGLAAGRNVELFAAQ
FT                   IRQFRPQIVAISAADKLPELREAIKHVNPQPILLAGEEGVIEVARYGDVETVVTGIVGC
FT                   AGLLPTIAAIEAGKDIALANKETLIAGAPVVLPLVEKYGVKLLPADSEHSAIFQCLQGV
FT                   PKGGLRKILLTASGGAFRDWPVEKLPEVKVADALKHPNWSMGRKITVDSATLMNKGLEV
FT                   IEAHYLFGVDYDDIEIVIHPQSIIHSLIELQDTSILAQLGWPDMRLPLLYALSWPERVY
FT                   TNWERLNLVKSGDLTFHEPDHQKYPCMGLAYAAGRAGGSMPGVLNAANEQAVALFLEEK
FT                   ISYLDIARCIELVCDHHQRDNTRNPSLSDILAADQWARQEVFTATEKLVIQPQIISLG"
FT   gene            complement(677303..678793)
FT                   /locus_tag="Aazo_0647"
FT   CDS_pept        complement(677303..678793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0647"
FT                   /product="Alg9 family protein mannosyltransferase"
FT                   /note="PFAM: Alg9 family protein mannosyltransferase; KEGG:
FT                   mar:MAE_41950 Alg9 family protein mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63117"
FT                   /db_xref="GOA:D7E0Y8"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Y8"
FT                   /inference="protein motif:PFAM:PF03901"
FT                   /protein_id="ADI63117.1"
FT                   /translation="MNRLFKPDHLLLGILIIIALILRVGMALKFPNIFWADEIFQSLEP
FT                   AHRLVFGNGIVTWEFRDGIRSWVLPGILAGVMHLTASMGEGSTGYLIGVNIFLSLLSLS
FT                   NILVAYVWGKKIGGTITALICAAICTIWFELIYFSPKAFTEVVATHVLLPGIYLGVQKD
FT                   SITRNRLFLSGSLLGISLALRIHLIPAIIFAVVYICKRGWQQKWLPMIAGIIAPVLLFG
FT                   TVDAFTWSYPFQSFWLNIWVNIVEGRSKLYGVSPWYEYFIFLFKSWSWLSIPIIILTII
FT                   GFRRIPILGWLALIIILSHSFLAHKEYRFIYPALPMLFILAGIGTGELVLRSSGRWSSL
FT                   HIRIIAILLSIYLWSSTSIALLSRFNIYAPLSFSTFGTNWEMTHLYATANNLVVLQSLS
FT                   TEENVCGLGLWGVNWALSGGYTYFHRDVPIYQVDTQIDFAVANSGFNYVVGNSPLPSTY
FT                   PNYSLQQCRLGTCVYKRPGSCSKIKEREINYVLKMSGN"
FT   gene            complement(679021..680568)
FT                   /locus_tag="Aazo_0648"
FT   CDS_pept        complement(679021..680568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0648"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   npu:Npun_R5974 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63118"
FT                   /db_xref="GOA:D7E0Y9"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Y9"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ADI63118.1"
FT                   /translation="MNNKYCSLGLLITSLFLWLIFLGNSPLRDWDEGTVAQVAREIWRN
FT                   PVDKMVWLYPTLGGEPYHNKPPLIHWLIAFTYSLGGVNEWTTRLPSAVLTALGVPLLYS
FT                   VGNLVFNQSLPALFTGLVYMTMLPIVRHGRLAMLDGAVITFFLLLLFCILKSRQQSIYA
FT                   LGIGFSLGLITLTKGMIVLLLGGITGLFILVNRQFYLLNNLYLWIGILLGNALPIAWYI
FT                   AQWEHYRENFLQINLQAQTLARLVESVEGHSEPAWFYLIEILKYGFPWLLFLPGGLYLA
FT                   WKRRHTTWGCLILISTVIYFGTISFMNTKLPWYVMPIYPFLALAIGVNLSEIWQERKFK
FT                   VRLWGGFLAILTVAGLGICIYFIVTDPQPVLITLSIILAISMGIAAWLVIEENRNFIPV
FT                   LFAGIYLVLSLLMSSKYWIWELNEAFPVKPVAALIRQKIPAGMKIYTSFTYSRPSLDFY
FT                   SDCRVIAVPISALQEMLSNKYYLLVDNEAWEKINLNQSKIIGESNGFKLISPDDGSL"
FT   gene            complement(680565..683024)
FT                   /pseudo
FT                   /locus_tag="Aazo_0649"
FT                   /product="hypothetical protein"
FT   gene            683276..684220
FT                   /pseudo
FT                   /locus_tag="Aazo_0650"
FT                   /product="hypothetical protein"
FT   gene            684695..684988
FT                   /locus_tag="Aazo_0651"
FT   CDS_pept        684695..684988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0651"
FT                   /product="transporter protein"
FT                   /note="KEGG: cyc:PCC7424_4515 transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63119"
FT                   /db_xref="GOA:D7E0Z0"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Z0"
FT                   /inference="similar to AA sequence:KEGG:PCC7424_4515"
FT                   /protein_id="ADI63119.1"
FT                   /translation="MSPREFSLLLISLLISVAGQFLLKIGALKLGKVHARNFWSLIFNI
FT                   ITIPELLLGLTSYGIGVLAYILILTRVNLSVTAPAVLVGYIFPILLSYFILK"
FT   gene            685656..686564
FT                   /locus_tag="Aazo_0652"
FT   CDS_pept        685656..686564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0652"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: ana:all4345
FT                   polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63120"
FT                   /db_xref="GOA:D7E0Z1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Z1"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADI63120.1"
FT                   /translation="MEHNKSFFWPQGILITLLCLTGTVGIGFMMLVKPNISDAQSRHDI
FT                   SSNDIAANVGTQQRIEAFKATILTSWQQEAQEKGITTDVPSRFQGETIKAATLPPDQKV
FT                   IALTFDDGPWPKSTALILDILKRNNIKGTFFVLGQNVQNYPDLTKRIVAEGNTIANHTW
FT                   YHLYHKMNPQTAAYEVANTSDIIFKTTGIKTGLFRPPGGIMNNGVAAYARSNKYAIIMW
FT                   SSDSTDYSRPGVPRLINNIFRSAKPGGIVLMHDGGGDRSHTVKALPEVINKFRKQGYEF
FT                   VTIPEMLEMQDKHQQLLAKKK"
FT   gene            complement(686625..691340)
FT                   /locus_tag="Aazo_0653"
FT   CDS_pept        complement(686625..691340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0653"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="KEGG: ava:Ava_1294 glutamate synthase (ferredoxin);
FT                   PFAM: ferredoxin-dependent glutamate synthase; glutamine
FT                   amidotransferase class-II; glutamate synthase; glutamate
FT                   synthase alpha subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63121"
FT                   /db_xref="GOA:D7E0Z2"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Z2"
FT                   /inference="protein motif:PRIAM:1.4.7.1"
FT                   /protein_id="ADI63121.1"
FT                   /translation="MNHQSLNQGQNITLSDMEITDTYSGQRWLSEERDACGVGFIAHRQ
FT                   NLANHEILTKALTALTCLEHRGGCSADQDSGDGAGILTAIPWELFQQEGINVSDSGNMA
FT                   AGMIFLPQNQESAKKVKAIFEQVAAEEKLTVLGWRVVPVRSEVLGMQAKENQPQIEQVF
FT                   LASADKSGDELERELYIARRRIVKAAKNISEEFYVCSLSTCTIVYKGMVRSAVLGEFYP
FT                   DLKNPAFKIAFAVYHRRFSTNTMPKWPLAQPMRLLGHNGEINTLLGNINWMMAREATLD
FT                   HPVWNGRAEEFKPLVNTDSSDSASLDNVLELLVRSGRSPLEALMMMVPEAYKNQPSLQN
FT                   YPEIVDFYEYYSGLQEPWDGPALLVFSDGKRVGATLDRNGLRPARYLITKDDYIVVGSE
FT                   AGVVEFPEANILEKGRLGPGQMIAVDLTSNEILKNWEIKQRIAKLHPYGDWLQQYRQEL
FT                   KHLVKPSAVNANGNGHHRTDNGHLTTDIPEKQTLLQQQIAFGYTTEDVEMVIQPMANTG
FT                   AEPTFCMGDDIPLAVLSEKPHLLYDYFKQRFAQVTNPPIDPLREKLVMSLTLELGERGN
FT                   LLEPKPEHARKLKLDSPVLTETELAAIKLSGFATAELSTLFSIAAGPEGLKEAVEALQR
FT                   QAVESVRAGAKILILSDKIPPTPLEKGGEEGISGISADFTYIPPLLAIGAVHHYLIREG
FT                   VRMKTSLVVHTAQCWSTHHFACLLGYGAGVVCPYMALDTVQDWWSDPKTQQFMERGKIN
FT                   TLTLEQAIANYRQAVESGLLKILSKMGISLLSSYQAAQIFEAIGIGGDLLALGFRGTTS
FT                   RIGGLSCKELAQEVLSFHSKAFPELTAKKLENLGFVQYRPGGEYHGNCPELVKALHKAV
FT                   DGKKYEHYEVYKQYLQGRPTTALRDLLDFASECPSIPIEEVESVSEIAKRFCTGGMSLG
FT                   ALSREAHETLAIAMNRIGGKSNSGEGGEDPVRYKVLNDVDSTGHSSNFPHLSGLRNGDI
FT                   ASSAIKQVASGRFGVTPGYLASAKQIEIKIAQGAKPGEGGQLPGPKVSPYIAMLRRSKP
FT                   GVTLISPPPHHDIYSIEDLAQLIFDLHQINPKAQVSVKLVAEIGIGTIAAGVAKANADI
FT                   IQISGHDGGTGASPLSSIKHAGSPWELGLSEVHRVLMENGLRDRVILRVDGGLKSGWDI
FT                   LVASLMGAEEFGFGSIAMIAEGCIMARVCHLNSCPKGVATQKEELRQRFTGIPDHVVNF
FT                   FYFVAEEVRSLLAKLGYRSLTELTGRADLLTVHSDVNLAKTQSINLGCLTKLPDAKQNR
FT                   SWLVHEEVHSNGSVLDDQILADRDIQAAISNQSTISKTFTVVNTDRTVGSRLAGAIASQ
FT                   YGDSGFEGQINLNFQGSAGQSFGAFNLPGLTLALTGEANDYVGKGMHGGEIIIKPPADA
FT                   NYDPSQNVIVGNTCLYGATGGVLFANGLAGERFAVRNSKGTAVIEGAGDHCCEYMTGGA
FT                   VVVLGKVGRNVGAGMTGGLGYFLDEDGAFPELVNKALVKIQRVVTEAGAKQLYDLIKAH
FT                   GDRTSSPKAQLILQNWSEYLPKFWQVVPPSEADSPEANGETEKVSKQLSSV"
FT   gene            691892..692026
FT                   /locus_tag="Aazo_0654"
FT   CDS_pept        691892..692026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63122"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Z3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63122.1"
FT                   /translation="MMEYLNFWFKYQDYYYSVFVKMCYLEQLALVVLAGKLLASFYWI"
FT   gene            692217..694145
FT                   /locus_tag="Aazo_0655"
FT   CDS_pept        692217..694145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0655"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F3878 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63123"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Z4"
FT                   /inference="similar to AA sequence:KEGG:Npun_F3878"
FT                   /protein_id="ADI63123.1"
FT                   /translation="MPMLVINNQRFFRYSVSSILSTALCLIATYTTSAQQSPRNSQLLA
FT                   SLISELPTPSSGNEITLNGRTLSAAWLQQRQTDGKVITHLSDGALRHLMGVDLLNTSNP
FT                   ELQPVEWFSSGTPTLNAKLLGGYRYLDISNFAHIAGWQIEANGNTLVISTTQAKINNIR
FT                   QGKRPTGERLVVDLDHPTPWQVTQGQLIKRPVDSHTRISQPPKPLNRENREWIITLDST
FT                   ADNSLIQRYTPQSRLLPKQLKKLPSPVSPQQIIQKVEIVNNRTIISLSVPFGFAPQVSA
FT                   ITNPNRLVIDIQPDGLVAKDITWAKGLRWQQKFINSGTDSFPVVWLEINPTVVGLSLKP
FT                   IWANPETQTGIAPLIQTAQRYLAVAGINGGYFNRNNKLPLGAIRRDNQWVSGPILNRGA
FT                   IGWNDSGEYYFGRLTLNETLITSNNQPLSILFLNSGYVQNGIARYTPIWGSTYTPLTDN
FT                   EIILVVQKDQIINQLPGSKVGVTPIPIPQDGYLLSLRGTAATNTSKLPIGTKVSLTSTT
FT                   TPGDFSRYPHIIGAGPLLVQNRQIVLNAKAETFSDAFIAEKAVRSAICTTTTGNLMIAA
FT                   VHNRAGGNGPTLAEHAQLMQFMGCVNALNLDGGSSTTLYLGGQLLDRSPNTAARVHNGI
FT                   GIFINPR"
FT   gene            694498..694917
FT                   /locus_tag="Aazo_0656"
FT   CDS_pept        694498..694917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0656"
FT                   /product="Mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /note="KEGG: npu:Npun_F3879 mannose-6-phosphate isomerase,
FT                   type II; PFAM: mannose-6-phosphate isomerase type II"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63124"
FT                   /db_xref="GOA:D7E0Z5"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Z5"
FT                   /inference="protein motif:PRIAM:5.3.1.8"
FT                   /protein_id="ADI63124.1"
FT                   /translation="MAQFTETLRNNTLTLNATLNSRGVAAGELRPWGSFTVLEEGRGYK
FT                   IKRIEVKSGHRLSLQMHHHRSEHWIVVSGTAKVVCGENEVLLSNNQSTYVPQCTVHRLE
FT                   NPGVIPLVLIEVQNGEYLGEDDIIRYQDDYARSDK"
FT   gene            694892..695005
FT                   /locus_tag="Aazo_0657"
FT   CDS_pept        694892..695005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63125"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Z6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63125.1"
FT                   /translation="MIMLAVTNSVWDLGAWGKSIVSSDSVPYRKQATLSVP"
FT   gene            695087..695419
FT                   /locus_tag="Aazo_0658"
FT   CDS_pept        695087..695419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0658"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="KEGG: npu:Npun_F3880 HesB/YadR/YfhF-family protein;
FT                   TIGRFAM: iron-sulfur cluster assembly accessory protein;
FT                   PFAM: HesB/YadR/YfhF-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63126"
FT                   /db_xref="GOA:D7E0Z7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Z7"
FT                   /inference="protein motif:TFAM:TIGR00049"
FT                   /protein_id="ADI63126.1"
FT                   /translation="MINFSRAAINEIRRLKSKQQPNILFRLRVKPGGCSGWLYNISFDE
FT                   AVKCEDQIFDVHNIQLVIDKESIKYINGLTLDYSEDLMGGGFRFYNPIATSTCSCGNSF
FT                   SMNPSS"
FT   gene            695609..695992
FT                   /locus_tag="Aazo_0659"
FT   CDS_pept        695609..695992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0659"
FT                   /product="ribosomal protein S12"
FT                   /note="KEGG: ava:Ava_1290 30S ribosomal protein S12;
FT                   TIGRFAM: ribosomal protein S12; PFAM: ribosomal protein
FT                   S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63127"
FT                   /db_xref="GOA:D7E0Z8"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Z8"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ADI63127.1"
FT                   /translation="MPTIQQLIRSERELARQKTKSPALKQCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDT
FT                   AGVKDRKQGRSKYGTKRPKETKK"
FT   gene            696356..696826
FT                   /locus_tag="Aazo_0660"
FT   CDS_pept        696356..696826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0660"
FT                   /product="ribosomal protein S7"
FT                   /note="KEGG: npu:Npun_F3882 ribosomal protein S7; TIGRFAM:
FT                   ribosomal protein S7; PFAM: ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63128"
FT                   /db_xref="GOA:D7E0Z9"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Z9"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ADI63128.1"
FT                   /translation="MSRRGVSQRRPVPSDSVYNSRLVSMIIRRIMRHGKKSLAARIVYD
FT                   ALRSIEERTGNSALETFERAVRNATPLVEVKARRVGGATYQVPMEVRSDRGTTLALRWL
FT                   VQFSRSRPGRTMASRLANELMDAANETGSAIRKREETHRMAEANKAFAHYRY"
FT   gene            696966..699044
FT                   /locus_tag="Aazo_0661"
FT   CDS_pept        696966..699044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0661"
FT                   /product="translation elongation factor G"
FT                   /note="KEGG: npu:Npun_F3883 protein synthesis factor,
FT                   GTP-binding; TIGRFAM: translation elongation factor G;
FT                   small GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   elongation factor G domain IV; elongation factor G domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63129"
FT                   /db_xref="GOA:D7E100"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D7E100"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADI63129.1"
FT                   /translation="MARTNPLEKVRNIGIAAHIDAGKTTTTERILFYSGIIHKIGEVHE
FT                   GTAVTDWMDQERERGITITAAAISTSWNDHQINIIDTPGHVDFTIEVERSMRVLDGVIA
FT                   VFCSVGGVQPQSETVWRQADRYKVPRIAFINKMDRTGANFYKVHDQMRDRLRANAIAIQ
FT                   LPIGSETEFKGIVDLVRMCAYMYTNDQGTDIQETEIPAELQGQVTEYRTKLVEAVAETS
FT                   DALMSKYFDGEELTEAEIRTALRKGTIAGTIVPVLCGSAFKNKGVQLMLDAVVNYLPAP
FT                   TEVPPIQGLLPNGDTVERRADDNEPLSALAFKIMADPYGRLTFVRVYSGVLKKGSYVLN
FT                   ASKDKKERISRLVLMKADDRQDVDELRAGDLGAALGLKDTLTGDTLCDEGSPVILESLF
FT                   IPEPVISVAVEPKTKNDMDKLSKALQSLSEEDPTFRVRVDPETNQTVIAGMGELHLEIL
FT                   VDRMLREFKVEANVGAPQVAYRETIRKTVTRIEGKFIRQSGGKGQYGHVVIDLAPGEPG
FT                   TGFEFVSKIVGGSVPKEYINPAEQGMKECCESGVLAGYPLIDVKATLVDGSYHDVDSSE
FT                   MAFKIAGSMAMKEAVAKASPVLLEPMMKVEVEVPENFLGDVMGDLNSRRGQIEGMGSEQ
FT                   GLAKVTAKVPLAEMFGYATDIRSKTQGRGIFSMEFSNYEEVPRNVAEAIIAKSKGNA"
FT   gene            699067..700296
FT                   /locus_tag="Aazo_0662"
FT   CDS_pept        699067..700296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0662"
FT                   /product="translation elongation factor Tu"
FT                   /note="KEGG: npu:Npun_F3884 protein synthesis factor,
FT                   GTP-binding; TIGRFAM: translation elongation factor Tu;
FT                   small GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63130"
FT                   /db_xref="GOA:D7E101"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D7E101"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADI63130.1"
FT                   /translation="MARAKFERNKPHVNIGTVGHVDHGKTTLTAAITMTLAAMGQAVAK
FT                   GYDQIDNAPEEKARGITINTAHVEYETAGRHYAHVDCPGHADYVKNMITGAAQMDGGIL
FT                   VVAATDGPMPQTREHILLAKQVGVPSLVVFLNKEDLMDDEELLELVELELRELLSSYDF
FT                   PGDDIPIIKGSGLQALEAMTKNPKTQRGENPWVDKIYQLMDAVDSYIPNPERDVDKPFL
FT                   MAVEDVFTITGRGTVATGRIERGKVKVNDTVELIGLKDTRTTTVTGIEMFKKSLDEGMA
FT                   GDNAGVLLRGLKKEDIERGMVIAKPGSITPHTEFEGEVYVLTEKEGGRKTPFFAGYRPQ
FT                   FYVRTTDVTGTIKSYTADDGSAVEMVMPGDRIKMTVELINAIAIEQGMRFAIREGGRTI
FT                   GAGVVSKILK"
FT   gene            700496..700813
FT                   /locus_tag="Aazo_0663"
FT   CDS_pept        700496..700813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0663"
FT                   /product="ribosomal protein S10"
FT                   /note="KEGG: ava:Ava_1286 30S ribosomal protein S10;
FT                   TIGRFAM: ribosomal protein S10; PFAM: ribosomal protein
FT                   S10"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63131"
FT                   /db_xref="GOA:D7E102"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D7E102"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ADI63131.1"
FT                   /translation="MATLQQQKIRIRLQAFDRRLLDTSCEKIVDTANRTNATAIGPIPL
FT                   PTKRKIYCVLRSPHVDKDSREHFETRTHRRIIDIYQPSSKTIDALMKLDLPSGVDIEVK
FT                   L"
FT   gene            701011..701661
FT                   /locus_tag="Aazo_0664"
FT   CDS_pept        701011..701661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0664"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="KEGG: ava:Ava_1285 peptidase S16, lon; PFAM:
FT                   peptidase S16 lon domain protein; SMART: peptidase S16 lon
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63132"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D7E103"
FT                   /inference="protein motif:PFAM:PF02190"
FT                   /protein_id="ADI63132.1"
FT                   /translation="MTSSSRIAVRELPLFPLAEVVLFPSRPLPLHIFEFRYRIMMNTIL
FT                   AADRRFGVLMIDPVKGTIAKVGCCAEIIHYQRMPDDRMEMLTLGQQRFRVLEYVREKPY
FT                   RVGLVQWIEDQPPSKDLRPLATEVEQLLRDVIRLSVKLTEKNVELPEDLPDLPTELSYW
FT                   VASNLYGVAPEQQALLELQDTYARLQREAEILTSTRNHLAARSVLKDTFNNMS"
FT   gene            complement(701774..702655)
FT                   /locus_tag="Aazo_0665"
FT   CDS_pept        complement(701774..702655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0665"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="KEGG: ava:Ava_1284 prephenate dehydratase; PFAM:
FT                   prephenate dehydratase; amino acid-binding ACT domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63133"
FT                   /db_xref="GOA:D7E104"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:D7E104"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ADI63133.1"
FT                   /translation="MTVATAKRAPSVIAHLGPAGTYSEQAAFFYLNWLKSNQNIEANLS
FT                   PYPTIAKSLQAVTTQQANIAVIPVENSIEGSVSMTMDSLWQLDTLQIKLALVLPINHAL
FT                   ISCANSLDKIETVYSHPQALAQCQGWLAKFLPNANLIASNSTTEALQRLPGVPIIAAIS
FT                   SSRAAQLYNLPILVSGINDYPENCTRFWVVDQADSAEQSFAPTHTSLAFSLPANMPGAL
FT                   VKALEVFAHLGINLSRIESRPTKRSLGEYLFFIDAEAGINSPLLRSALSELSTFSEVLK
FT                   VFGSYNILAINS"
FT   gene            702982..703569
FT                   /locus_tag="Aazo_0666"
FT   CDS_pept        702982..703569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0666"
FT                   /product="Protein of unknown function DUF1997"
FT                   /note="PFAM: Protein of unknown function DUF1997; KEGG:
FT                   ana:all4333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63134"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniProtKB/TrEMBL:D7E105"
FT                   /inference="protein motif:PFAM:PF09366"
FT                   /protein_id="ADI63134.1"
FT                   /translation="MATKFTASQSVEIAVPKQPIPIHHYLRQPQRLVNTLTDNNRIHQL
FT                   SEEVFRLKMRPLTFISLSIQPTVDMRVWSDSQGTIYLRSVGCEILGLEYINQRFTLNLK
FT                   GYLSPQQVNNETHLQGKADLEVVVDIPQPFSLTPRAILEATGNGLLKSVLMTIKQRLLH
FT                   HLLTDYRHWVISQTQTKVIGAENTDLAILNFD"
FT   gene            complement(703684..704349)
FT                   /locus_tag="Aazo_0667"
FT   CDS_pept        complement(703684..704349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0667"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="KEGG: npu:Npun_R3889 ribonuclease HII/HIII; PFAM:
FT                   ribonuclease HII/HIII"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63135"
FT                   /db_xref="GOA:D7E106"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7E106"
FT                   /inference="protein motif:PRIAM:3.1.26.4"
FT                   /protein_id="ADI63135.1"
FT                   /translation="MVETEPKPVSLLSTAPLPESSWWELSTCANIHGLVAGVDEVGRGA
FT                   LFGPVVAAAVMLSADALPKLMAAKIKDSKKLSASRRTQLAQQINGLVLDWKIGYATTAE
FT                   IDQFNILQATLLAMKRAVLKLKVPPALCLVDGNQLVKDLLIPQETMIKGDERSLNIASA
FT                   SIMAKVWRDDLLLRLASKYPMYELERNKGYGSQRHLLALRKYGASPLHRRSFRPCQIQ"
FT   gene            complement(704358..706499)
FT                   /locus_tag="Aazo_0668"
FT   CDS_pept        complement(704358..706499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0668"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; KEGG:
FT                   npu:Npun_R3890 RNA-binding S1 domain-containing protein;
FT                   PFAM: RNA-binding protein AU-1/Ribonuclease E/G; RNA
FT                   binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63136"
FT                   /db_xref="GOA:D7E107"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D7E107"
FT                   /inference="protein motif:TFAM:TIGR00757"
FT                   /protein_id="ADI63136.1"
FT                   /translation="MPKQIIIAEQHQIAAVFSEDQIQELVVATGHHQIGDIYLGVVENV
FT                   LPGIDAAFVNIGDPERNGFIHVTDLGPLKLKRSSAAITELLTPQQKVLVQVMKEPTGTK
FT                   GPRLTGNITLPGRYVVLMPYGRGVNLSRRIKSESERNRLRALAILIKPAGMGVLVRTEA
FT                   EGKPEEAIIEDLELLQKQWEVIQQEAQSTRAPALLNRDDDFIQRVLRDMYGADVNRIVV
FT                   DSSTGLRRVKQYLQNWSGGQTPQGVLIDHHRDRSPILEYFRINAAIREALRPRVDLPSG
FT                   GYIIIEPTEALTVIDVNSGSFTRSATARETVLWTNCEAATEIARQLRLRNIAGVIVVDF
FT                   IDMESRRDQLQVLEHFNKSLKADKARPQIAQLTELGLVELTRKRQGQNIYELFGETCPT
FT                   CGGLGHTVRLPGEIENRMPIPAADIQERFTTPISQREPRMPSTRMSEPRESYDAFGEGL
FT                   EGDAELTPMHLINHPSYQEMGDNKRRTRTRRSRIGINGANGKDENRLGTPLAFVNDSDL
FT                   DLDADSDIAPTPEIPSLLSDTRRERDVMRTPTLGKAGWTERTERTKVKIDPIKPVVEPP
FT                   QIVSVEMTVQEQDMFALMGISPSVKLEQEVKNPKSVIFNIVQPGQTSTSTTESTSTSES
FT                   ISELTVSERTNSELTKVKIPIPKVEVEELSLEPLIIDPPVQESSTIGFESFTDEEELSS
FT                   TSSTPNRRRRRRSSAIEEN"
FT   gene            complement(706555..706746)
FT                   /locus_tag="Aazo_0669"
FT   CDS_pept        complement(706555..706746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0669"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: phe:Phep_0634 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63137"
FT                   /db_xref="UniProtKB/TrEMBL:D7E108"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63137.1"
FT                   /translation="MVKVLHQKSTTDGWFNYLKHMQPLWNNQACERNYSINSFQLWKAL
FT                   SDLEFLLPVAPCRAASRG"
FT   gene            complement(707067..709763)
FT                   /locus_tag="Aazo_0670"
FT   CDS_pept        complement(707067..709763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0670"
FT                   /product="Protein of unknown function DUF2344"
FT                   /note="KEGG: npu:Npun_R3891 radical SAM domain-containing
FT                   protein; PFAM: Protein of unknown function DUF2344; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63138"
FT                   /db_xref="GOA:D7E109"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:D7E109"
FT                   /inference="protein motif:PFAM:PF10105"
FT                   /protein_id="ADI63138.1"
FT                   /translation="MAVLVEQLITPDILKPARYLGNERLAVHKPWDEATIRWVLTYPEV
FT                   YEVGASNLGHIILYNILNAQPNQLCDRAYLPGPDLGAKLRTTQTPLFAVESKRFLTEFD
FT                   ILGFSLSYELGATNILEMLDLAGIPLTWRERQEAEGKGQEKDKSSYPSSQSPMPLIFAG
FT                   GQTATSNPEPYADFFDFIVLGDGEELLPEIGLVLAEGKQALLSREGLLLDLAQIPGVYV
FT                   PQFYHMGEGGAVHPLRADVPRRILRRVATPIPAYSIGLVPYVETVHDRLTIEIRRGCTR
FT                   GCRFCQPGMLTRPARDVKPDQVVEAIEAGMQATGYNEFSLLSLSCSDYLSLPAVGMEIK
FT                   NRLKNENITLSLPSQRVDRFDENIANILGGTRQGSLTFAPEAGTQRMRDIINKGLTNKE
FT                   LLRGVKTAWEQGWDKIKLYFMIGLPGETDADVLGIAETVNWLQQECRVRGRKLLSLNLT
FT                   ISNFTPKPHTPFQWHSVSTSEFKRKQNLLRQEFRPIRNVKVNFTDIRLSAMEDFIGRGD
FT                   RSLGKVLRRAWELGAGMDSWYDNVEQAFSAWGTAIAEAGLDWKYRQVENGELNLFSVGN
FT                   GEQETENREQDIVSPITIPLSPLDIALPWDHIDTGIDKQWLYEDLKRALEAAIVPDCSF
FT                   EGCSHCGVCGTDFGHNILIKPPAIPKFAGDFIPNTTKLQRLRVRFGKHGDMALVSHLDL
FT                   MRLFDRVIRRAGLPVAFTGGFNPHPRISLASALSLGSTSSGEIVDFELTQPMDLGSFHE
FT                   QLISQLPSDIPIYQVEEIDLKAPAANQAMQAAEYLLTLSTVGNVTTKQWQEWIEAIKIT
FT                   EEFLVEHITKSGKHQMINLRARLFDLELIEAYNSPTKSKAVLRYLGSCCHNGVILRPEQ
FT                   LLSFLEKVAKAEFHLLHIHRNRLLLEI"
FT   gene            710329..710526
FT                   /locus_tag="Aazo_0671"
FT   CDS_pept        710329..710526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0671"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F3893 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63139"
FT                   /db_xref="UniProtKB/TrEMBL:D7E110"
FT                   /inference="similar to AA sequence:KEGG:Npun_F3893"
FT                   /protein_id="ADI63139.1"
FT                   /translation="MITQYAIRQLVEKALHIKKLTPEIENEINSELTQLGYISDVDYEA
FT                   LELLMAEMDAGRVQLVPRWS"
FT   gene            complement(710582..710938)
FT                   /locus_tag="Aazo_0672"
FT   CDS_pept        complement(710582..710938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0672"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63140"
FT                   /db_xref="UniProtKB/TrEMBL:D7E111"
FT                   /inference="similar to AA sequence:KEGG:Ava_1276"
FT                   /protein_id="ADI63140.1"
FT                   /translation="MDINSNFQPGQILSLDYGHRNLYAEVIQVVISRDLCWVRPLMLVN
FT                   FTQDIPLITDMRDASDLLWPVNLFRPALDTEVISFLGDLLPKEPKADNDLAAQQQLHQF
FT                   IYQFWQASQDGQQL"
FT   gene            711272..711550
FT                   /locus_tag="Aazo_0673"
FT   CDS_pept        711272..711550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0673"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /note="PFAM: ATP-dependent Clp protease adaptor protein
FT                   ClpS; KEGG: ava:Ava_1275 ATP-dependent Clp protease adaptor
FT                   protein ClpS"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63141"
FT                   /db_xref="GOA:D7E112"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:D7E112"
FT                   /inference="protein motif:PFAM:PF02617"
FT                   /protein_id="ADI63141.1"
FT                   /translation="MSVETIEKRSTTRKLAPQYRVLLHNDDYNSMEYVVQVLMTSVPSI
FT                   TQPQAVNIMMEAHNSGLALVITCAQEHAEFYCETLKGHGLSSTIEPD"
FT   gene            711608..712441
FT                   /locus_tag="Aazo_0674"
FT   CDS_pept        711608..712441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0674"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   npu:Npun_F3898 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63142"
FT                   /db_xref="GOA:D7E113"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D7E113"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADI63142.1"
FT                   /translation="MIKINLYQIAQRPAPLRLGCFILVLLLLWLPLAVPIYLLVPYSNL
FT                   ESILTIVILYVQFIFLLKLWGKQVYQQPKILTHYGLEFSSLNGVNFVQGLAIGLISILI
FT                   VFSLQGLLGWLVWEQPKVFLLKIILEGLLVGFGVGFAEELSFRGWLLDELERDYGFSLA
FT                   TWIDCILFAVTHFIKPLESIIHTLPQFPALVLLGLTQVWGKRLCRGRLGLPIGLHGGLV
FT                   SGYYIINVGKLTKYSGVVPDWLTGVNNNPLQGILGVLFMGGLAWWMRGKALKLYD"
FT   gene            712434..712646
FT                   /locus_tag="Aazo_0675"
FT   CDS_pept        712434..712646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0675"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63143"
FT                   /db_xref="UniProtKB/TrEMBL:D7E114"
FT                   /inference="similar to AA sequence:KEGG:Ava_1224"
FT                   /protein_id="ADI63143.1"
FT                   /translation="MIKYLVILLSLIFSLSFTSPAFALVCHNYDGYEVCILNIKRSAKK
FT                   YREHRAAITVDGVKESTCRSSQFSY"
FT   gene            complement(712820..712921)
FT                   /locus_tag="Aazo_0676"
FT   CDS_pept        complement(712820..712921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0676"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyp:PCC8801_0635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63144"
FT                   /db_xref="GOA:D7E115"
FT                   /db_xref="UniProtKB/TrEMBL:D7E115"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63144.1"
FT                   /translation="MNDISRWQEWLTVLAYLVITTFIMWRIFATGNK"
FT   gene            complement(712931..713575)
FT                   /locus_tag="Aazo_0677"
FT   CDS_pept        complement(712931..713575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0677"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   npu:Npun_R3900 pentapeptide repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63145"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D7E116"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ADI63145.1"
FT                   /translation="MNIEAIRSGKIKQLPGADLEEEELSQIDLSCVNLAGATLVGANFT
FT                   GSKLEGAHLEGANLIGANLQETDLRANLMGANLMQANLTSADLRGSNLRGANLMGATVR
FT                   DASFAGAFLSGANLMSVNLQGVDFRAADLRGANLTGANLKGADLSQADLQGTLLSKANL
FT                   EEADLRGANLAGANLSGANLLCAELETANFSGVNLDRACLVGTVLEAVSYS"
FT   gene            complement(713572..714954)
FT                   /locus_tag="Aazo_0678"
FT   CDS_pept        complement(713572..714954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0678"
FT                   /product="putative sensor protein"
FT                   /note="PFAM: Protein of unknown function DUF2308, sensory;
FT                   KEGG: npu:Npun_R3901 putative sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63146"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR019278"
FT                   /db_xref="InterPro:IPR033415"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D7E117"
FT                   /inference="protein motif:PFAM:PF10069"
FT                   /protein_id="ADI63146.1"
FT                   /translation="MLQGSILQQLEIAHRHSTRPIHFRVYYKNTLVALCHALEDHILTE
FT                   EGQPLVITAFQRGKWYLQEANRYADIAQKSREIVIIATADAVFAEHPTSQLPNVNLVGL
FT                   EADDPVGQEWHLIILSPQYTAMVICQELSESDYGSCGLPTSDLERKFYGLWTFEPELVR
FT                   QTADFVIAHIEKYNPELTTKLNTHKQAVQAAIISPKDVSKVVTRVVDYLQTRQNNLTIP
FT                   PVLDSNLVSNEIQAFLRMAQLVDLAEINNPMAASEVVAIVETMGQLLDLPAWQIKRLRL
FT                   AALLHRIDPLQRVENLLTPSASTSYEKDAPSCPLSCSLVPGAQTLRTMPRLRAVAEIIT
FT                   HQTEWWNGTGQPAGLAGDEIPLESRILALAASFQWQVSKQLYSETSEKDVFTQALNECR
FT                   QQQSTRFDPKLIDILTLLVMGLQQGLDLPLMRTKISRGMWLLDSPWDSHSKSNEKINRY
FT                   PQ"
FT   gene            complement(715019..716617)
FT                   /locus_tag="Aazo_0679"
FT   CDS_pept        complement(715019..716617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0679"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: ava:Ava_1258 radical SAM family protein; PFAM:
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63147"
FT                   /db_xref="GOA:D7E118"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D7E118"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI63147.1"
FT                   /translation="MAGKTTMIDNRILYVRLPCNPIFPIGVIYLSDHVHKLFPNIKQRI
FT                   FDLGTVPPLDYAAALDSYIDEFKPTLLVFSWRDIQIYAPVGGRGGNPLQNAFEFYYAKN
FT                   PFIKLRGALGGLRIFIAYYIELWRNIGLIKRGLKRAQKYHSQGRVLVGGGAVSVFYEQL
FT                   GKSLPAGTIISVGEGETLLAKFLGGQEFRDERCYVVGENEPRERLIHEQPTPLEKTACN
FT                   YDYIETIWPEFNYYLQDQDFYIGIQTKRGCPHNCCYCVYTVVEGKQVRINPADEVVAEM
FT                   RQLYNRGIRNFWFTDAQFIPARRYIDDAVELLQKIVDSGMTDINWAAYIRADNLTPELC
FT                   DLMAKTGMNYFEIGITSGSQELVRKMRMGYNLRTVLQNCRDLKSAGFNDMVSVNYSFNV
FT                   IDERPDTIRQTIAYHRELERIFGGDKVEPAIFFIGLQPHTHLEEYAFKEGILKPGYDPI
FT                   SLMPWTAKKLLWNPEPLGSFFGEICLQAWRRNPNDFGREVMNILEEKLGCAELETALSA
FT                   PIEAKEKQRAGIMKS"
FT   gene            complement(717061..718464)
FT                   /locus_tag="Aazo_0680"
FT   CDS_pept        complement(717061..718464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0680"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="KEGG: npu:Npun_F1592 NAD(P) transhydrogenase, beta
FT                   subunit; PFAM: NAD(P) transhydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63148"
FT                   /db_xref="GOA:D7E119"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:D7E119"
FT                   /inference="protein motif:PRIAM:1.6.1.2"
FT                   /protein_id="ADI63148.1"
FT                   /translation="MSDFLPTGIQLTYLVAASLFILGLKKLGSPATARNGNLVAAVGML
FT                   LAIIATMLDQQVLNYEMILVGLSIGSVIGAVVAYKVQMTEMPQMVGLLNGLGGASSALI
FT                   AVAEFSRLLGSSQPIPLHVNISMLLDVLIGGVTLTGSFLAFAKLQGLVSGTPITFPLQQ
FT                   PFNLFLLGTYIAGSAYLIMSPDSLPIFLAVVAVSLVLGVMFVLPIGGGDMPVVISLLNS
FT                   LSGVAAAAAGFVVMNNMLIIAGALVGASGLILTEIMCKAMNRSLFSVLFSAFGSVSTAT
FT                   GDAVAGASNQTVRSIDPEEGAMMLGYARSVVIVPGYGMAVAQAQHSVRELADQLERMGV
FT                   DIKYAIHPVAGRMPGHMNVLLAEANVAYTQLYDMDDINPQFQQADVALVIGANDVVNPA
FT                   ARNDTNSPIYGMPILEVDRAKQTIVIKRGMSAGFAGVDNELFYKDNTTMLFGSAKDMVA
FT                   KLVSEVKQL"
FT   gene            complement(718461..718754)
FT                   /locus_tag="Aazo_0681"
FT   CDS_pept        complement(718461..718754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0681"
FT                   /product="nicotinamide nucleotide transhydrogenase, subunit
FT                   alpha"
FT                   /note="KEGG: ava:Ava_3429 nicotinamide nucleotide
FT                   transhydrogenase, subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63149"
FT                   /db_xref="GOA:D7E120"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:D7E120"
FT                   /inference="similar to AA sequence:KEGG:Ava_3429"
FT                   /protein_id="ADI63149.1"
FT                   /translation="MTEALLAALFVLVLASFIGFEVINKVPPTLHTPLMSGSNAISGIS
FT                   VIGAILAAGEKNTDLSVILGLVALILAMVNVVGGFLVTDRMLQMFKRKEVKA"
FT   gene            complement(718927..720081)
FT                   /locus_tag="Aazo_0682"
FT   CDS_pept        complement(718927..720081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0682"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="KEGG: npu:Npun_F1590 NAD(P) transhydrogenase subunit
FT                   alpha; PFAM: alanine dehydrogenase/PNT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63150"
FT                   /db_xref="GOA:D7E121"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7E121"
FT                   /inference="protein motif:PRIAM:1.6.1.2"
FT                   /protein_id="ADI63150.1"
FT                   /translation="MKIAVAKEIEVCERRVSLIPDIVAKLVKQGLEIYVESGAGDKTYF
FT                   TNADYEAAGAKIISDVATLWSEADILLKVSPPQDREDGRSEIDLLKPGSVLISFLNPLG
FT                   NPVIAQKLANRQITALSMELIPRTTRAQSMDALSSQASLAGYKTVLLAAAALPKYFPML
FT                   TTAAGTIAPAKVFIMGAGVAGLQAIATARRLGAVVEAFDIRPAVKEEVQSLGAKFIEVK
FT                   LEEDTVAAGGYAKEISEDSKKRTQQLVATHVKNSDVVITTAQVPGRKAPILVTEEMVRA
FT                   MKPGSVIVDLAAEQGGNCACTAPGKDIVWNGVTIIGPINLPSSMPVHASQLYAKNITSL
FT                   MQLLIKDKALQINFGDDIVDAACITHGVEIRNQRIKEALQTATV"
FT   gene            721156..721668
FT                   /locus_tag="Aazo_0683"
FT   CDS_pept        721156..721668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0683"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63151"
FT                   /db_xref="InterPro:IPR021256"
FT                   /db_xref="UniProtKB/TrEMBL:D7E122"
FT                   /inference="similar to AA sequence:KEGG:Ava_3431"
FT                   /protein_id="ADI63151.1"
FT                   /translation="MRHLLSALAVTGYLLTSLTATSVAQSLPGLTLLSGVKSENQLPFR
FT                   LDFGGQTASTDRYILRLPAKKMKLAVAQFAITYPKYYKGTFDTKKVEVRVKDKSVPLSE
FT                   VKWDKEGRVIEILPQKLVPAGTNVELVLSNVQNPTFGGIFYFNCQVLSPGDVPLLRYLG
FT                   SWIISIS"
FT   gene            721824..721958
FT                   /locus_tag="Aazo_0684"
FT   CDS_pept        721824..721958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0684"
FT                   /product="ribosomal protein L34"
FT                   /note="KEGG: npu:Npun_R1588 ribosomal protein L34; TIGRFAM:
FT                   ribosomal protein L34; PFAM: ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63152"
FT                   /db_xref="GOA:D7E123"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:D7E123"
FT                   /inference="protein motif:TFAM:TIGR01030"
FT                   /protein_id="ADI63152.1"
FT                   /translation="MQRTLGGTCRKRKRTSGFRARMRTPEGRNVISARRRKGRHRLSV"
FT   gene            721985..722407
FT                   /locus_tag="Aazo_0685"
FT   CDS_pept        721985..722407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0685"
FT                   /product="ribonuclease P protein component"
FT                   /note="KEGG: npu:Npun_R1587 ribonuclease P protein
FT                   component; TIGRFAM: ribonuclease P protein component; PFAM:
FT                   ribonuclease P protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63153"
FT                   /db_xref="GOA:D7E124"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D7E124"
FT                   /inference="protein motif:TFAM:TIGR00188"
FT                   /protein_id="ADI63153.1"
FT                   /translation="MPLPKAYRLKSLRDFQAVFREGIRCHSSHFTLRALKPLGVKRPSM
FT                   DAADVTTKPTSCENLATTKIGISISTKVSKRAVVRNRIKRQIAKDLYQLIPNLVPGWRL
FT                   VIIVKPKAAESECVSQQFLQELEQLLAKAEVINGYS"
FT   gene            722394..722783
FT                   /locus_tag="Aazo_0686"
FT   CDS_pept        722394..722783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0686"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr3414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63154"
FT                   /db_xref="GOA:D7E125"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:D7E125"
FT                   /inference="similar to AA sequence:KEGG:alr3414"
FT                   /protein_id="ADI63154.1"
FT                   /translation="MGIREEIYYEGGPHIGDLILNLLIGLTLVGLPLTIGAIVRALWLR
FT                   FRITDRRIAVMGGWMGRDRTDVIYSEIVKLVKIPRGVGLWGDMVVTLRNGTRLEMRAVP
FT                   NFREVYEYINEKVAAKNPQYSAAKQ"
FT   gene            723019..724170
FT                   /locus_tag="Aazo_0687"
FT   CDS_pept        723019..724170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0687"
FT                   /product="membrane protein insertase, YidC/Oxa1 family"
FT                   /note="KEGG: ana:alr3415 putative inner membrane protein
FT                   translocase component YidC; TIGRFAM: membrane protein
FT                   insertase, YidC/Oxa1 family; PFAM: 60 kDa inner membrane
FT                   insertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63155"
FT                   /db_xref="GOA:D7E126"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:D7E126"
FT                   /inference="protein motif:TFAM:TIGR03592"
FT                   /protein_id="ADI63155.1"
FT                   /translation="MDFGIGFLSNNVMLPIIDFFYGFFPSYGLAIVALTLIIRFALYPL
FT                   SAGSIRSMRRMRVVQPVMQRRMAEIKERYKDDPQKQQEEMVNVQKEFGNPLAGCLPLLL
FT                   QMPVLLALFATLRGSPFAGVNYSVNLQILPAEQIERIQPQAFATAPQNIYIADGEHTKI
FT                   TAILPSGNKLAVGEKTKVQYQTMEGKPFDLLLAEHPETKLTPEWKIMKGEDRVKIDAEG
FT                   NIEALQPGDVTIQGSIPGLAADRGFLFIDALGRVGAQDPDGTIHWDIVAMIVFFGISLY
FT                   VSQMLSGQNSSGGNPQQDTVNKITPVIFSGMFLFFPLPAGVLMYMVIGNIFQTLQTYIL
FT                   SREPLPEELQKLVVLQDKEKEAATAEAKTLPFEPKSSKKKATG"
FT   gene            724173..724706
FT                   /locus_tag="Aazo_0688"
FT   CDS_pept        724173..724706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0688"
FT                   /product="single-stranded nucleic acid binding R3H domain
FT                   protein"
FT                   /note="KEGG: npu:Npun_R1584 single-stranded nucleic acid
FT                   binding R3H domain-containing protein; PFAM:
FT                   single-stranded nucleic acid binding R3H domain protein;
FT                   SMART: single-stranded nucleic acid binding R3H domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63156"
FT                   /db_xref="GOA:D7E127"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:D7E127"
FT                   /inference="protein motif:PFAM:PF01424"
FT                   /protein_id="ADI63156.1"
FT                   /translation="MSYISMQHVEEWLTQLLQLTGISTNVRGNLDATPAIGVGSQEPDS
FT                   YWLTIDETNLMPEQIRMLTGAGGTVLDAMQYLANSVLNLHQPEHAHTSYTIELNSYRVK
FT                   RQAEISALAKTAVQEVRFSGREVEIRSLSSAERRQVHNFLKEFPDLETFSRGKEPHRNL
FT                   VVRPATEPPTDPGY"
FT   gene            724785..725291
FT                   /locus_tag="Aazo_0689"
FT   CDS_pept        724785..725291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0689"
FT                   /product="protein of unknown function DUF177"
FT                   /note="PFAM: protein of unknown function DUF177; KEGG:
FT                   ana:alr3417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63157"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:D7E128"
FT                   /inference="protein motif:PFAM:PF02620"
FT                   /protein_id="ADI63157.1"
FT                   /translation="MDAIFIPQLTKAPERTEEIQVNESLPGLETLTPVRGVIHVQHQGN
FT                   YLEVSAQAESIITCTCNRCLQQYNQRLAVNTKEIIWLDPNANQAEDLPLEREVAIEDLV
FT                   EAVSHDGYFYPSEWLYEQMCLAIPQRQLCDRKCPGILDAVASISEEIIDNRWSALESLK
FT                   KQLPE"
FT   gene            725322..725568
FT                   /pseudo
FT                   /locus_tag="Aazo_0690"
FT                   /product="hypothetical protein"
FT   gene            726164..727324
FT                   /pseudo
FT                   /locus_tag="Aazo_0691"
FT                   /product="hypothetical protein"
FT   gene            complement(727299..728125)
FT                   /pseudo
FT                   /locus_tag="Aazo_0692"
FT                   /product="hypothetical protein"
FT   gene            728552..730063
FT                   /locus_tag="Aazo_0693"
FT   CDS_pept        728552..730063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0693"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: npu:Npun_R1580 ATPase central
FT                   domain-containing protein; PFAM: AAA ATPase central domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63158"
FT                   /db_xref="GOA:D7E129"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E129"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADI63158.1"
FT                   /translation="MNFRDEFKLLLRARYSLIYVPTYEEERVEAAIREEATNQGNRPVY
FT                   TWDFVDGYQGNPNDAGFGRRNPLQALEFIEKLPATAPAVLILRDYHRFLDDVAISRKLR
FT                   NLARLLKSQPKNIVLLSPRIAIPDDLMEVLTVVEFPLPAAPEIKTEVERLLQTTGNSPS
FT                   GKFLDDLVHSCQGLSMERIRRVLARAIASHGELQLEDVDLVLEEKRQTIRQTQILDFYP
FT                   AIEQISDIGGLDNLKDWLIRRGGSLTERARQYGLPHPRGLMLVGIQGTGKSLTAKAIAH
FT                   HWHLPLLRLDVGRLFGGLVGESESRTRQMIQVAEALAPCVLWIDEIDKAFSGLGSKGDA
FT                   GTTSRVFGTFITWLAEKTSPVFVVATANDIQALPPEMLRKGRFDEIFFVGLPTQEERKA
FT                   IFKVHLSRLRPHNLNSYEIDRLAYETPDFSGAEIEQTLTEAMHIGFSQNRDFTTDDILE
FT                   AASQIIPLARTAVEQIQKLQEWAAAGRARLASKHSPLSERIQRQM"
FT   gene            730214..730690
FT                   /locus_tag="Aazo_0694"
FT   CDS_pept        730214..730690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0694"
FT                   /product="SH3 domain protein"
FT                   /note="SMART: SH3 domain protein; KEGG: npu:Npun_R1579 SH3
FT                   type 3 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63159"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:D7E130"
FT                   /inference="protein motif:SMART:SM00287"
FT                   /protein_id="ADI63159.1"
FT                   /translation="MLSSLLKLILGFLLATAVLLGSGLTIALYFVNRTAIAPARPTFAN
FT                   DNPQTKPDKPKVTQVKATSIPKPTPSSTPSPTPTLSESPDSLPPGAYQGIVTWSQGLSM
FT                   RDQPTLDAQSVGGVAANQKVIILEESPDKNWQKIRIEGTDKEGWVKAGNSKRVD"
FT   gene            complement(730792..732705)
FT                   /locus_tag="Aazo_0695"
FT   CDS_pept        complement(730792..732705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0695"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   cyn:Cyan7425_2332 diguanylate cyclase/phosphodiesterase
FT                   with FHA and GAF sensor; SMART: EAL domain protein; GGDEF
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63160"
FT                   /db_xref="GOA:D7E131"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D7E131"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADI63160.1"
FT                   /translation="MIIFMIGVITGVGIQLISLSLFNFFVTKFSENQPKKQQNNNLNFT
FT                   ESEGYLSIKLDKEISECQRIQPELQKLLLLQKATLESATDAILIVDSLDKIVGFNKKFL
FT                   EMWDIPALMITSGNYKQALRTAIKKLDNPRHYLSILRELDENPDIHIGENILFKDGRIF
FT                   NPFYQQQYKYKKNIGQVWIFRDITAEKLASNIINYESLHDILTNLPNRLLLKNLLIDAL
FT                   TKVSHNHSLGVCFLDLDRFKKINDSLGHGIGDKLLQMVAQCIKKSLRSDDIVARWGGDE
FT                   FIILLPEISEMYNIDLIQERIFAAFKQGFKIDNYHLNISPSIGIALYPQHGEDGETLIK
FT                   NAEAALSFVKLQGRNNYKVYQAAINSQATELFILENSLYNALERQEFKVYYQPQVNSST
FT                   GEITKMEALLRWQHPELGLIPPATFIPIAEETGLILPISEWVLKTACLQNKAWQQTLNL
FT                   SSLSVAVNFSGRQFQQPNLVGIVEQVLCETKLAHRYLELEITETVAMQDVELTQKILRQ
FT                   LDEMGVTISIDDFGTGYSSLSYLKDFSIHALKIDQSFVQDLANKDHQTAITTAIISLAH
FT                   GLNLSVVAEGVETQEQLNALRILQCEIMQGYFFSHPLSAEEATRMLTAYQPHRLKDSYL
FT                   LA"
FT   gene            complement(733119..736142)
FT                   /locus_tag="Aazo_0696"
FT   CDS_pept        complement(733119..736142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0696"
FT                   /product="exonuclease SbcC"
FT                   /note="KEGG: npu:Npun_F1577 exonuclease SbcC; TIGRFAM:
FT                   exonuclease SbcC; PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63161"
FT                   /db_xref="GOA:D7E132"
FT                   /db_xref="InterPro:IPR004592"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:D7E132"
FT                   /inference="protein motif:TFAM:TIGR00618"
FT                   /protein_id="ADI63161.1"
FT                   /translation="MIPVQLILKNFLSYRDATLDFGGLHTACICGSNGAGKSSLLEAIT
FT                   WSIWGQSRATVEDDVIYSGAKEVRVDFTFYNNQQTYRVIRTRARGATSILEFQIETPAG
FT                   FRPLTRKGMRATQDVIIQHIKLDYETFINSAYLRQGRADEFMLKRPTERKEILAELLKL
FT                   DQYDVLEERAKDSSKLYKGRAEELERSLDNIKVQLQQQETTKAQRVELESQLNSLQQQQ
FT                   ALDNIQLQSLQVVEHKRQNWEQQLNFVWQQYQNLSQDCDRLHEEQLAVKSQLADLKVIL
FT                   NQAAEIIAGYAQYQSLQSQEEAFAVKSEQHTRATSFRQQQQQELTKQVQTIEYRFQQAQ
FT                   AQLEGLEQQEQEIQQTLTKSSEVETALAQLASARKHLNYFDQLQMQVNPLLQQRLSLQN
FT                   QLDRTRASLVARLEQLQATETQLQSQYRRQPQLQQAALDVGIQIEELEKKRVYLQRVQE
FT                   KGQERRHFIERLQVHQRDYEKLLGELEQKLQVLQSPNALCPLCERHLDEHHWSRVIQKT
FT                   QLEYEDTQGQFWVVREQMAVSDREIQVLRQEYREISQQLAGYDALREQRGQLAAKLQAT
FT                   TDVQEQLQQIALEREHLESSLQGDYAPDKQVELQQLEQYLQQLNYNEQDHTLARSEVER
FT                   WRWAEIKQAQIKDATKKQAQLAARKPKLQATIDEFKLKIQLEQTDSDTAKQIEALTQEI
FT                   KELNYSSEQHNKLRQAVRESQSWQLRYQQFLSAQQKYPQLETRLEDLASSYKSRLADQQ
FT                   RFATQIDSIVEQLKATANPTEQINALEQQIAIRRRELDEKIANLGRVEQLLHQLQTLQT
FT                   QYVQEQEQLKYCQQQHRVYHELTQAFGKNGIQALMIENVLPQLEAETNQLLSRLSANQL
FT                   HVQFVTVKAGRSGKSTRKHTKLIDTLDILIADGRGTRAYETYSGGEAFRINFAIRLALA
FT                   KLLAQRAGAALQLLIVDEGFGTQDNEGCDRLIAAINAIASDFACILTVTHIPHLKEAFQ
FT                   ARIEVNKTQQGSHIYLSI"
FT   gene            736422..737677
FT                   /pseudo
FT                   /locus_tag="Aazo_0697"
FT                   /product="hypothetical protein"
FT   gene            738012..738637
FT                   /pseudo
FT                   /locus_tag="Aazo_0698"
FT                   /product="hypothetical protein"
FT   gene            complement(738634..738885)
FT                   /locus_tag="Aazo_0699"
FT   CDS_pept        complement(738634..738885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0699"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_2120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63162"
FT                   /db_xref="UniProtKB/TrEMBL:D7E133"
FT                   /inference="similar to AA sequence:KEGG:Ava_2120"
FT                   /protein_id="ADI63162.1"
FT                   /translation="MKAVEVTGTTDEKEQFLLDQAINVEIPGRVRVILLFDRSTDELEN
FT                   DPDDTPIKSVKASLKILLQQAKAGEHILLAQMWEGIGF"
FT   gene            complement(739324..739905)
FT                   /locus_tag="Aazo_0700"
FT   CDS_pept        complement(739324..739905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0700"
FT                   /product="PAP fibrillin family protein"
FT                   /note="PFAM: PAP fibrillin family protein; KEGG:
FT                   npu:Npun_R3938 PAP fibrillin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63163"
FT                   /db_xref="InterPro:IPR006843"
FT                   /db_xref="InterPro:IPR039633"
FT                   /db_xref="UniProtKB/TrEMBL:D7E134"
FT                   /inference="protein motif:PFAM:PF04755"
FT                   /protein_id="ADI63163.1"
FT                   /translation="MMTKSALLEAIAGTNRGLLATETQKQAILAVIAGLEDFKPTPRLL
FT                   EATHLLEGDWRLLYTTSKALLNLDRFPFYKLGQIYQCIRVETTSVYNIAEIYGLPSLEA
FT                   LVSVAAKFEPVSDRRVQVKFQRSIIGLQKLVGYKSPAYFIQQIESGQKFTAIDFPINSD
FT                   QQGWLDITYIDSDLRIGRGNEGSVFVLSKA"
FT   gene            740146..740385
FT                   /locus_tag="Aazo_0701"
FT   CDS_pept        740146..740385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0701"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1268 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63164"
FT                   /db_xref="InterPro:IPR021481"
FT                   /db_xref="UniProtKB/TrEMBL:D7E135"
FT                   /inference="similar to AA sequence:KEGG:Ava_1268"
FT                   /protein_id="ADI63164.1"
FT                   /translation="MLNSPLREQPRNQRATVIPLKQESSMLDWLQSSSRLIAREPYESA
FT                   FSEQEEEISDFLGGEDAIGDLDYDDDNDIAIDED"
FT   gene            740452..741579
FT                   /locus_tag="Aazo_0702"
FT   CDS_pept        740452..741579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0702"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; KEGG:
FT                   ava:Ava_1267
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   Glycosyl transferase, family 4, conserved region;
FT                   Phospho-N-acetylmuramoyl-pentapeptide transferase,
FT                   conserved site"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63165"
FT                   /db_xref="GOA:D7E136"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D7E136"
FT                   /inference="protein motif:TFAM:TIGR00445"
FT                   /protein_id="ADI63165.1"
FT                   /translation="MWSEGKFFVDAKLSPNQGLNISGIGLACLLALSLTATALILDWLG
FT                   HRLPWHPSSLTMPFLLCSVGAAAAGNFVIPLLQALKTGQVIREDGPQAHLKKAGTPTMG
FT                   GVFFIPVAIMVACVLSNFAQDVVAVSVLTLSYGLIGWIDDWQILRRKSNKGISPKMKLV
FT                   LQILFATGFCLWMMLNRDFSISNIALPWVSFSLPLGLLFWPLAGFVLLAESNATNLTDG
FT                   IDGLAGGTVAIAIFALGAFITPTSPDLMIFCAAISGSCLGFLAHNRNPARVFMGDTGSL
FT                   ALGGALAAVALLTNSLVVLFILSGIFFVETLSVMAQVSYYKATKGADGKGKRLFKMAPL
FT                   HHHLELTGWSELQVVSVFYIIAAILATICLTMITF"
FT   gene            complement(741873..742350)
FT                   /pseudo
FT                   /locus_tag="Aazo_0703"
FT                   /product="hypothetical protein"
FT   gene            complement(742516..742799)
FT                   /pseudo
FT                   /locus_tag="Aazo_0704"
FT                   /product="hypothetical protein"
FT   gene            complement(742928..743263)
FT                   /locus_tag="Aazo_0705"
FT   CDS_pept        complement(742928..743263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0705"
FT                   /product="photosystem II reaction center protein Psb28"
FT                   /note="KEGG: npu:Npun_R3943 photosystem II protein PsbW,
FT                   class I; TIGRFAM: photosystem II reaction center protein
FT                   Psb28; PFAM: photosystem II protein PsbW class I"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63166"
FT                   /db_xref="GOA:D7E137"
FT                   /db_xref="InterPro:IPR005610"
FT                   /db_xref="InterPro:IPR038676"
FT                   /db_xref="UniProtKB/TrEMBL:D7E137"
FT                   /inference="protein motif:TFAM:TIGR03047"
FT                   /protein_id="ADI63166.1"
FT                   /translation="MAKIQFSRGVDEVVVPDVRLTRSRSGDQGTATFIFTNPQILGQGS
FT                   TDEITGMYMIDEEGEILTREVKGKFVNGKPEALEAVYLMKTPEEWTRFMRFMERYAQEN
FT                   GLGLTKS"
FT   gene            743483..743728
FT                   /locus_tag="Aazo_0706"
FT   CDS_pept        743483..743728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0706"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical LOC100060282; K10408 dynein heavy
FT                   chain, axonemal"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63167"
FT                   /db_xref="UniProtKB/TrEMBL:D7E138"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63167.1"
FT                   /translation="MLSLPEASAITRVSIASITMIVNIIDLDDDSELFDVHITDSNREI
FT                   TDSPGQPVLSFGYVAPGVSSTPISYWWTVASRSSFP"
FT   gene            complement(744213..744665)
FT                   /locus_tag="Aazo_0707"
FT   CDS_pept        complement(744213..744665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0707"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="KEGG: npu:Npun_R3944 D-tyrosyl-tRNA(Tyr) deacylase;
FT                   TIGRFAM: D-tyrosyl-tRNA(Tyr) deacylase; PFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63168"
FT                   /db_xref="GOA:D7E139"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D7E139"
FT                   /inference="protein motif:TFAM:TIGR00256"
FT                   /protein_id="ADI63168.1"
FT                   /translation="MRVIVQRVKSSQVSVNGEIIGKIGRGLNLLVGISQTDTDAEVDWM
FT                   VRKCLELRLFPDYEGSDRWQKSVQEINGELLVISQFTLYGDSTKGRRPSFDRSAKPILA
FT                   VDLYNSFVDKLRTSGLKVEIGEFGAMMSVGIENDGPVTLILEREAK"
FT   gene            complement(744873..745961)
FT                   /locus_tag="Aazo_0708"
FT   CDS_pept        complement(744873..745961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0708"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="KEGG: ana:alr1093 hypothetical protein; PFAM:
FT                   cobalamin synthesis protein P47K; cobalamin synthesis CobW
FT                   domain protein; SMART: cobalamin synthesis CobW domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63169"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:D7E140"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ADI63169.1"
FT                   /translation="MTMPSPVISESQAMEAPKQGLPVTIITGFLGSGKTTLLNHILTNQ
FT                   QGVKTAVLVNEFGEIGIDNELIVATENNMLELSNGCICCTINNDLVDAVYKVLEREEKL
FT                   DYLVVETTGLADPLPVAMTFLSSELRILTRLDSIVTVVDATNYSLDLFNSQAAFNQISY
FT                   GDVILLNKADLVDSSTLEELEGKINKVKEGARIIRTKNSQVPLPLILSVGLFESDKYFE
FT                   SEAHKHNHHDDDHANCGHDHHTHEHHHHHHSDHLENDGFTSISFQSDKPFSIRKFQYFL
FT                   DNQLPNDVFRAKGIMWFDESPQRHIFHLCGKRFTIDDDEWKGERKNQIVLIGQNLNEET
FT                   LLKQLENCLCIPSASRGKGFGK"
FT   gene            complement(746034..746658)
FT                   /pseudo
FT                   /locus_tag="Aazo_0709"
FT                   /product="hypothetical protein"
FT   gene            746828..748288
FT                   /locus_tag="Aazo_0710"
FT   CDS_pept        746828..748288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0710"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="SMART: Cysteinyl-tRNA synthetase class Ia DALR;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; KEGG: npu:Npun_F3946
FT                   cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA synthetase
FT                   class Ia; Cysteinyl-tRNA synthetase class Ia DALR"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63170"
FT                   /db_xref="GOA:D7E141"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D7E141"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADI63170.1"
FT                   /translation="MTLSIYNTLTRRQEPFTTVEPGKVKMYCCGVTVYDYCHLGHARAC
FT                   IIWDVVRRYLQLIGYDVRYIQNFTDIDDKILNRARQEKSTMEAVAERYIQAYFEDMSRL
FT                   GIKEANEYPRATHTMNGIQRLIHDLEHKGFAYPANGDVYYAVQKFDEYGKLSGRKLEDL
FT                   QLGASERVNIEDAEYQKKQYPFDFALWKAVKQGEPAWESPWGKGRPGWHIECSAMVRER
FT                   LGDTIDIHTGGADLIFPHHENEIAQSEAVTGKPLANYWLHNGMVKVDGEKMSKSLGNFT
FT                   TIRNLLDRGVDPMALRLFVLMAQYRKPIDFTDEAILAATNGWYTLRQGLLFGYQYGKKL
FT                   GTGEWGLGIRNNLTSNTYIERFKEVVNDDFNFPGGLAVIFELAKELIREKNIIVHQGKT
FT                   ETPPDKLLQEWQTLVTLADVLGLTAQLEIETISEDALTDAEIEDLIQKRQEARKGKNFA
FT                   ESDCIRDDLLSKGITLIDNCEGTRWHRG"
FT   gene            748313..748489
FT                   /pseudo
FT                   /locus_tag="Aazo_0711"
FT                   /product="hypothetical protein"
FT   gene            748461..748625
FT                   /locus_tag="Aazo_0712"
FT   CDS_pept        748461..748625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0712"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all1091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63171"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:D7E142"
FT                   /inference="similar to AA sequence:KEGG:all1091"
FT                   /protein_id="ADI63171.1"
FT                   /translation="MKNLNLDKQSTDDFVHKLEIALKERRETRYWLRLLIATELMPEEL
FT                   LLPISGEVN"
FT   gene            748705..749858
FT                   /pseudo
FT                   /locus_tag="Aazo_0713"
FT                   /product="hypothetical protein"
FT   gene            complement(750241..751368)
FT                   /pseudo
FT                   /locus_tag="Aazo_0714"
FT                   /product="hypothetical protein"
FT   gene            complement(751487..752073)
FT                   /pseudo
FT                   /locus_tag="Aazo_0715"
FT                   /product="hypothetical protein"
FT   gene            complement(752074..752644)
FT                   /pseudo
FT                   /locus_tag="Aazo_0716"
FT                   /product="hypothetical protein"
FT   gene            753006..753196
FT                   /pseudo
FT                   /locus_tag="Aazo_0717"
FT                   /product="hypothetical protein"
FT   gene            753231..754403
FT                   /locus_tag="Aazo_0718"
FT   CDS_pept        753231..754403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0718"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="KEGG: npu:Npun_F2020 UBA/ThiF-type NAD/FAD binding
FT                   protein; PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; Rhodanese domain protein; SMART:
FT                   Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63172"
FT                   /db_xref="GOA:D7E143"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D7E143"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADI63172.1"
FT                   /translation="MLNPNLDEIQLTKDDYERYSRHLILPEVGLEGQKRLKASSVLCIG
FT                   TGGLGSPLLLYLAAAGIGRIGIVDFDVVDTSNLQRQVIHGTSWVGKPKIESAKNRIHEI
FT                   NPHCQVDLYETRISSENALDIIHPYDIVVDGTDNFPTRYLVNDACVLLEKPNVYGSIFR
FT                   FEGQATLFNYEGGPNYRDLYPEPPPPGMVPSCAEGGVLGILPGIIGVIQATETVKVIIG
FT                   QGNTLSGRLMLYNALDMKFRELKLRPNPIRPVIQKLIDYEEFCGIPQAKAEEAKQQMEI
FT                   QEMTVKELKALLDSGAKDFVLLDVRNPHEYEIAKIPGSVLVPLPDIENGNGVTQVKELL
FT                   KGHRLIAHCKMGGRSAKALAILTDAGIVGTNVKGGINAWSQEVDPSVPQY"
FT   gene            754436..754645
FT                   /locus_tag="Aazo_0719"
FT   CDS_pept        754436..754645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0719"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63173"
FT                   /db_xref="UniProtKB/TrEMBL:D7E144"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63173.1"
FT                   /translation="MFEKSCCTLLPIGYLAQRSEALRVIAQTLDSSPHFVPHGYSLRDY
FT                   VGVIRQAWRSLSVPKGYKRQIILF"
FT   gene            754754..755914
FT                   /pseudo
FT                   /locus_tag="Aazo_0720"
FT                   /product="hypothetical protein"
FT   gene            756110..757189
FT                   /locus_tag="Aazo_0721"
FT   CDS_pept        756110..757189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0721"
FT                   /product="recA protein"
FT                   /note="TIGRFAM: recA protein; PFAM: RecA domain protein;
FT                   KEGG: ava:Ava_4925 recombinase A; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63174"
FT                   /db_xref="GOA:D7E1E7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1E7"
FT                   /inference="protein motif:TFAM:TIGR02012"
FT                   /protein_id="ADI63174.1"
FT                   /translation="MATNTADTSGKQKALTMVLNQIERSFGKGAIMRLGDATRMRVETI
FT                   STGALTLDLALGGGLPKGRVIEIYGPESSGKTTVALHAIAEVQKNGGIAAFVDAEHALD
FT                   PTYAGALGVDIENLLVSQPDTGEAGLEIVDQLVRSAAVDIVVIDSVAALVPRAEIEGDM
FT                   GDTHVGLQARLMSQALRKITGNIGKSGCTVIFINQLRQKIGVTYGSPETTTGGNALKFY
FT                   ASVRLDIRRIQTLKKGSDEFGNRVKVKVAKNKVAPPFRIAEFDIIFGKGVSTLGCLVDL
FT                   AEETGVLLRKGAWYSYNGENISQGRDNAIRYLEEKTEFADKIRELVCEKLDKGAVVSAN
FT                   SVSKVNGEEEEEEIELDEE"
FT   gene            757362..759782
FT                   /locus_tag="Aazo_0722"
FT   CDS_pept        757362..759782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0722"
FT                   /product="Glucosylceramidase"
FT                   /EC_number="3.2.1.45"
FT                   /note="KEGG: ava:Ava_1096 hypothetical protein; PFAM:
FT                   protein of unknown function DUF608"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63175"
FT                   /db_xref="GOA:D7E1E8"
FT                   /db_xref="InterPro:IPR006775"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014551"
FT                   /db_xref="InterPro:IPR024462"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1E8"
FT                   /inference="protein motif:PRIAM:3.2.1.45"
FT                   /protein_id="ADI63175.1"
FT                   /translation="MTTSPFPEIPSCSWQRPIGLGWDKPYTVRYVSNIDDGPWHGMPLG
FT                   GFGAGCIGRSSRGDFNLWHIDGGEHLFKSFPSCQFSVFESTGSSSKAYALSTEIPEDGT
FT                   LQSWQWYPPSTTTQATGTYHALYPRSWFVYENVLQTQLTCEQFSPIWANNYQETSYPVA
FT                   VFVWKAHNPTNAPITLSIMLTWENIVGWFTNALKSPDLQIRDDGSPVYEYQPRLGESKG
FT                   NYNHIVENTEFFGCFLGRVPTGLPIQEGDGSWCIATPKNPRMEVFYHTHFNPVGSGADL
FT                   WESFSTDGYLPNYLNATPADADTRLGAALAVRCTLQPGETLEIPFTLAWDFPVTEFAEG
FT                   INYYRRYTDFFSRYGDNAFAITSRGLEQYQVWRAQIQNWQKPILDREDLPEWFKMALFN
FT                   ELYDLTSGGTLWSAASEIDPIGQFAVLECLDYRWYESLDVRLYGSFALLILFPELEKSV
FT                   IRAFARAIPHSDDHLRVIGYYYTIGAETKKAIRKVAKATPHDLGAPNEWVWEKTNYTCY
FT                   QDCNLWKDLSSDFVLQVYRDFLFTGSHDVQFLVDCWDAIVQTLDYLKTFDLDGDGIPEN
FT                   SGAPDQTFDDWLLNGVSAYCGGLWLAALESAIAIADILTNHRGTENTEKTDKLRSQKSI
FT                   YQSWLQQSRPIYEQKLWNGQYYRLDSESGSDVVMADQLCGQFYTRLLGLPDIVPSNHAH
FT                   SALQTVYEACFVKFYDGKFGAANGVLPDGSPENPKATHPLEVWTGINFGLAAFLVQMGM
FT                   KNEAMQLTQAVVEQIYDNGLQFRTPEAITPVGTFRASTYLRPMAIWAIYMMFI"
FT   gene            761657..762247
FT                   /locus_tag="Aazo_0723"
FT   CDS_pept        761657..762247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0723"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cti:RALTA_A1698 chromosome segregation protein
FT                   SMC"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63176"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1E9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63176.1"
FT                   /translation="MKQIIRSNAVETSSQRGLVGVKLSELHPRQASIHESLVLLPKLNL
FT                   SVLRTSSDIAIKNISNRSASFETEVFSNLLYLVWGSKLDFYPIVVVWVWIGKIVKVSHT
FT                   QGTKIIDGMAHSSLKTQTLGEIIARAEQATRRALALKINLLKLLLDIQKTTQTATNTVE
FT                   TKTWLKSIHTHTKQQSSFRKSLFHWELQQPLRT"
FT   gene            762542..762925
FT                   /locus_tag="Aazo_0724"
FT   CDS_pept        762542..762925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0724"
FT                   /product="heterocyst differentiation protein"
FT                   /note="KEGG: ana:alr2818 heterocyst differentiation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63177"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1F0"
FT                   /inference="similar to AA sequence:KEGG:alr2818"
FT                   /protein_id="ADI63177.1"
FT                   /translation="MNQDISGKSSNLEKKINPEQFDQVIEAILAGKYSWACVLMLRFVG
FT                   YNPLHYIPYRTYNRLLKENSRISRSNTQQNESLKLAKPATEKRCDTHLASACLSKIKDI
FT                   AYLEVGGKQKAEVRGSHREKKSA"
FT   gene            763689..764072
FT                   /locus_tag="Aazo_0725"
FT   CDS_pept        763689..764072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0725"
FT                   /product="transposase"
FT                   /note="KEGG: ava:Ava_B0073 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63178"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1F1"
FT                   /inference="similar to AA sequence:KEGG:Ava_B0073"
FT                   /protein_id="ADI63178.1"
FT                   /translation="MARKSYPTDLTDMEWEILAPLIPPAKEGGHPPTTDMGEICNAIYY
FT                   HLKTGCQWNMLPGDFLPRSTVYSYYRKWQLQGIWEKFNHTLGGQVRSKLGKSTQPTALA
FT                   ADSQSVNTDQKKGMCMVLTDVKR"
FT   gene            764042..764482
FT                   /locus_tag="Aazo_0726"
FT   CDS_pept        764042..764482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0726"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ava:Ava_1441 transposase IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63179"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1F2"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADI63179.1"
FT                   /translation="MYGFDGCKKVKGRKGQTLVDSLGLVLKVVVSEANAPERILAAYAL
FT                   MELLEEPTELLEKVQVLWVDSGYDGDKFALAVWFLTQAHVEVIGPTEQEFKVLPQPWVV
FT                   ERTFGWFNQYPRLSKDYERLTQMREGAIYALMTRIMLLPLVS"
FT   gene            766113..766712
FT                   /locus_tag="Aazo_0727"
FT   CDS_pept        766113..766712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0727"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63180"
FT                   /db_xref="GOA:D7E1F3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1F3"
FT                   /inference="similar to AA sequence:KEGG:Ava_4384"
FT                   /protein_id="ADI63180.1"
FT                   /translation="MSSSSNQNTVSEIYDAHESKFLTPFQRKVLLKNLQSDLQPEYRRR
FT                   IEIMLLADMGRSQSHICEIIGCSQEMARYWIGIAEAGIAHKWNERRIGRPKTVNSQYIE
FT                   RLKELVSHSPREYGYAFGYWTAQWLSKHLANELGIEISDRHINRLLKQMGLSTKRKISQ
FT                   PSTNAPNQDSSITICDLQSSSEPSFSWSFNLIQTNN"
FT   gene            766734..769775
FT                   /locus_tag="Aazo_0728"
FT   CDS_pept        766734..769775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0728"
FT                   /product="cyclic nucleotide-regulated ABC
FT                   bacteriocin/lantibiotic exporters"
FT                   /note="KEGG: ana:alr1927 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; peptidase C39
FT                   bacteriocin processing; cyclic nucleotide-binding; ABC
FT                   transporter transmembrane region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63181"
FT                   /db_xref="GOA:D7E1F4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1F4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI63181.1"
FT                   /translation="MPSAFSQSYLATQITKIVGDSLSDQELENCVQALDIIEPPIAKQF
FT                   WISTTAPPGIYLVLSGKVRLLDGGNNLISTLTSGSSFGELTLFPEQNFSAYVARASVNL
FT                   KVGYLPQEVINRFVGVSDRLFIKAELWDILVLLSQNSATPRHESVEEILTALSLFAKQN
FT                   LEIGSLNPQVTENTKLLLVCQGELQHCQGKKLTPGNIYVNPHKEKWQATQPSRVYILHD
FT                   ADLQTALQYWPQLSRLIDVENEPITEPIKREVKARSRNVIQFPQTTIQEQSQPKQSQKY
FT                   FPSPTVTAGNWWRKVSKRYPFCEQQSASDCGAACLVMISRYWGKNFTINRLRELANINR
FT                   AGASMRSLTAAAESIGFATRPVKASLDKLAQQTLPAIAHWEGKHYIVVYEITEKWVIVA
FT                   DPAIGQLNLSIREFKAGWTGYALLLQPTNSLQTIPEANTPFWQLFELVKPHYQVLLEVF
FT                   VASVLIQVFGLVTPLFTQLLLDRVIVQGSTITLNTVGFGLLIFSLFRVVINGLRQYLLD
FT                   HTANRISVALMVGFIKHTFRLPLSFFESRYVGDIVSRVQENQKIQRFLTGEALSIVLDF
FT                   LTVFIYISLMFWYSPSMALLVLAIVPPFVLLALFATPFLRRTSREVFTAVTKENSYLIQ
FT                   SLTGISSIRSMAIEQTVRWRWEELLNNLTKKNFSVQVIGNQLEIISSTIQAIASTGLLW
FT                   FGAWLVIQNQLTIGQLVAFNMLLGNVIQPFQRLISLWNQLQEVIVSTERINDVLEASPE
FT                   EDLAVHSRQILPRLRGHLHFDNVTFRYHAESDINILENLSFEILPEQTVAVVGRSGSGK
FT                   TTLSKLILGLYPATDGRVLIDNQDVASISLHSLRSQIGVVDQDTFLFGGTIRENISIAH
FT                   PEATLEEIIEAAQLAGADEFIKRMAMGYETQIGEGGGMLSGGQRQRLAIARALLGSPRL
FT                   LILDEATSHLDAESERIIQNNLKTILKGRTSFIIAHRLSTVRHADLILVLDRGILVESG
FT                   THEELILKRGHYYYLNQQQLASTG"
FT   gene            770026..771552
FT                   /locus_tag="Aazo_0729"
FT   CDS_pept        770026..771552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0729"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   npu:Npun_F3521 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63182"
FT                   /db_xref="GOA:D7E1F5"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1F5"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ADI63182.1"
FT                   /translation="MPQSTYNSSSTLFISGQVKSSSSLHETQTAGKTNDWFYGTEELLD
FT                   ALPKAWTRSMLYLLISFTVVALPWVMFTKVDETGNASGRIEPKGSTQKLDSVVTGSVIA
FT                   VNVKEGTNVKAGQVLVEIESEVLRTEIQQSQAKLEGLVNRQGQLELLKNQVLLVINIQE
FT                   RQNQSQTLEKLAQLNQARQNLDAKQSAYHLQKLEKLAQIDKVEQNINSTQISHRLAKRR
FT                   LSRDLLEVKRYRLLLQEGAIPETRVVEVEKTAEDSERLQEEAKANIQQSELHLQEELSR
FT                   YNSIMSQAQSDIEQAKFRLQEEENSYGSVVQAGKLTLLKSQEQYKDLQTQITSLKSEIS
FT                   QTKSQITSLQLQLQQRVVRSPIDGTIFELPIKKPGSVVQPGQMIAQIAPKGAALILKAE
FT                   MPSRQSGFVKEGMPVKIKFDAYPFQEYGVMQGYVTSISPDSKIQENSPTRQETYQLEIA
FT                   LDQPYIQTGNKRIPLTPGQTATAEVIVRQRRVIDFILDPFKKLQKNGLEL"
FT   gene            771707..772492
FT                   /locus_tag="Aazo_0730"
FT   CDS_pept        771707..772492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0730"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F3522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63183"
FT                   /db_xref="GOA:D7E1F6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1F6"
FT                   /inference="similar to AA sequence:KEGG:Npun_F3522"
FT                   /protein_id="ADI63183.1"
FT                   /translation="MSKVIIVSHEDIVDHVRITCQIPNLLEAVATRRTIVDTAVQEGIQ
FT                   IEIQELQQAADSLRLANKLIKAEDTWAWLEKHYLSLDNFEEIAQLNLLSAKLANHLFAD
FT                   KVEPFFYAHQLDYTGAVTYEVILDDEDLALEIFYSLQEGEISFQEIARQYIDNAEIRRA
FT                   GGYQGIRKRNDFRPEIASAIFAANPPQILKPIITPKGAHIIMVEEIIKPQLNEQMRLKI
FT                   MGELFTNWLKQQVNTLEIVAKLIEHQNPPSSSEKLSEAS"
FT   gene            complement(773175..773477)
FT                   /locus_tag="Aazo_0731"
FT   CDS_pept        complement(773175..773477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0731"
FT                   /product="heterocyst differentiation protein"
FT                   /note="KEGG: cyc:PCC7424_3517 heterocyst differentiation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63184"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1F7"
FT                   /inference="similar to AA sequence:KEGG:PCC7424_3517"
FT                   /protein_id="ADI63184.1"
FT                   /translation="MIKGNYEQNKQFNKILQQSQFREIIKAIILGKYSWACILFLHFSG
FT                   CDPLDYIPHETYSKLIRENYIFAEDNHDSIHENKLRLPGIKLSWINLNNENHSSN"
FT   gene            complement(773602..774699)
FT                   /locus_tag="Aazo_0732"
FT   CDS_pept        complement(773602..774699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0732"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all1931 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63185"
FT                   /db_xref="InterPro:IPR040871"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1F8"
FT                   /inference="similar to AA sequence:KEGG:all1931"
FT                   /protein_id="ADI63185.1"
FT                   /translation="MQLLDSLHTQLSELPEQLQISLQDIATQIEIASHHCIKHPKHKTI
FT                   ALPESVIPRFEQLPLEMQQQHLKLQLRNFIYSVYYNVASKPIISADEKESNRKIKQNLE
FT                   NKNLFGIDLEFYDRLHTRNKSEGYWSHNWQVVREETDGTLAVHKNGLTLHVDPNLHLLP
FT                   TVTSWVVGKFVSIKMPKNLVQNGFYMAVANAGSQNGHNITRIYFNLTPEGAAAVMESLT
FT                   VQLNNIPISFSFKALYNPPDYGRYDSAVLYFNKDQYEIVHPALERIYADNQSYFDEPVP
FT                   LFTKQLAPGLACAEEPNQKFGDKESFGTNRCQIIANALVTAWQQGEHSPDKRMASIFKQ
FT                   FASHKIQLQRPYLNANSEDIYTPLS"
FT   gene            complement(774740..775897)
FT                   /locus_tag="Aazo_0733"
FT   CDS_pept        complement(774740..775897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0733"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   npu:Npun_R2837 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63186"
FT                   /db_xref="GOA:D7E1F9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1F9"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADI63186.1"
FT                   /translation="MPFLLSSQNVFNYLISQGLCNLEEQSLSQIELKAAKNFNLLVSLP
FT                   DGSQFLVKQERLNREGKTRGEFINEWQVHNFFRTFLEISHLRSCLSEVIHFDAENSIIV
FT                   FNYLNDYRDLAEFYGLENIFPTNIPRSIGANLASIHRLTINRQDYRAFFQTSDNIINHT
FT                   TSTLSRGLDRITPEVFGSVPADGLKFFALYQRYDNLDQAITDLSNAVNPCCLTHNDLKL
FT                   NNILLSLNWHTAIHPESRLIDWEKGAWGDPASDLGAIIASYLQIWLYSMVTSKTTPIEE
FT                   SLRLAAIPLQLLQPSLSSLVIEYLTNFPEILELRSNFLQLVLQFSGFCLIRAIQAKLQY
FT                   ERTFGNSGICILQVAKSLLCRPQASMTTIFGMEASDLTPTSLSHV"
FT   gene            complement(775983..776198)
FT                   /locus_tag="Aazo_0734"
FT   CDS_pept        complement(775983..776198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0734"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R2838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63187"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1G0"
FT                   /inference="similar to AA sequence:KEGG:Npun_R2838"
FT                   /protein_id="ADI63187.1"
FT                   /translation="MTRIIIADLHLIDSEVFINEITSTDEQSVFGGRYEYRPQILEVGV
FT                   KALEFIVMLAAIDAISFLTTSFIRTD"
FT   gene            complement(776362..776595)
FT                   /locus_tag="Aazo_0735"
FT   CDS_pept        complement(776362..776595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0735"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asl1936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63188"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1G1"
FT                   /inference="similar to AA sequence:KEGG:asl1936"
FT                   /protein_id="ADI63188.1"
FT                   /translation="MASIKLSQLQATGSELFQDSESFLNEMSDVSSIYGGGYDNDVSDI
FT                   STLEKLAEAFVNVYGIGHIAYLAKSYSYSNGY"
FT   gene            complement(777040..777288)
FT                   /locus_tag="Aazo_0736"
FT   CDS_pept        complement(777040..777288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0736"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63189"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1G2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63189.1"
FT                   /translation="MGIQIYDLYSTHEVQMIDKLTSSEMKNINGGIMNRRRRDRNPTTT
FT                   DRSNLSALVADIKTNVGNWRLELNKTIDNLREERLDF"
FT   gene            777519..778774
FT                   /pseudo
FT                   /locus_tag="Aazo_0737"
FT                   /product="hypothetical protein"
FT   gene            complement(779173..780693)
FT                   /locus_tag="Aazo_0738"
FT   CDS_pept        complement(779173..780693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0738"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   npu:Npun_R2846 peptidase M16 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63190"
FT                   /db_xref="GOA:D7E1G3"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1G3"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ADI63190.1"
FT                   /translation="MLNFLVKGRKLKFSLKFSKSWRFISAFVVACLLTFNFPWAATATA
FT                   KHYTDLQFTPLSEVKLPKYERFVLDNGLVVYLMEDHELPLVSGTTLVRTGSRWEAGDKS
FT                   GLAEIVGSVMRTGGTLKHSADELNEILEQRAAAVEISIGEAVGSASFDSLSEDLETVFG
FT                   LFAEVLREPAFAQEKLDLEKTQTKGSIARRNDDPSSIANREFKKLIYGQDSPYSRTVEY
FT                   ATLEKITREDLLRFYQQYFYPNKMILGIVGDFNAKKMRSLIQAKFGDWKPNPKISKTLL
FT                   PEVSQANLGGVFFVNQPQLTQSNILIGHLGGSFNNPDYPALDVMNGVLNGFGGRLFNEV
FT                   RSRQGLAYSVYGSWSPRHDYPGMFIAGGQTRSDATVQFIKSLEAEIKRMQNEKVTTQEL
FT                   NYAKDSTLNSFVFNFQDPSQTLSRLMRYEYYGYPADFLFHYQKAVTATTTADIQRVAKK
FT                   YLKPENLVTLVVGNQTAIQPPLTQLAAKVTPVDVTIPGSQTQAQNSSK"
FT   gene            complement(780888..782507)
FT                   /locus_tag="Aazo_0739"
FT   CDS_pept        complement(780888..782507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0739"
FT                   /product="processing peptidase"
FT                   /EC_number="3.4.24.64"
FT                   /note="KEGG: npu:Npun_R2847 peptidase M16 domain-containing
FT                   protein; PFAM: peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63191"
FT                   /db_xref="GOA:D7E1G4"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1G4"
FT                   /inference="protein motif:PRIAM:3.4.24.64"
FT                   /protein_id="ADI63191.1"
FT                   /translation="MNYSILDSWKSKTNKSQFRYSQLFHKFPFSPVLHRLLITALAVMI
FT                   FCLGVTPQAAIALEPTQSLIQPYLDQVVKQLTEFRLDNGLKFIVLERHQVPVVSFLTYA
FT                   DVGGIDESDGKTGVAHFLEHLAFKGTKRIGTIDYKAEKPLLESLEQLDTQIRTAKSQGK
FT                   NDDLAKLETEFKSLESQALKLVKQNEIGQIVEQAGGVGLNANTSTEATRYFYSFPANKL
FT                   ELWMSLESERFLDPVFREFYKEKDVILEERRMRVENSPVGLMVEKFIDTAFKVHPYRRP
FT                   VIGYDEDIRNLSPKDVKQFFDSYYVPNNLVIAIVGDVKPNEVKKLAQVYFGRYPAKLKA
FT                   QAKITPEPKQTEPREFTLKLPTQPWYFQGYHRPGITHPDNAVYDIIGSLLSDGRTSRLY
FT                   KSLVEKQSLALAAHGVSGFPGDKYPNLILFYALTSPGHTVDDLAIALGKEIEKLKTEPV
FT                   STTELQRVKTQARAGLLRSLDSNMGMAQQLLEYEVKTGSWRNLFKQLENIAAVTPADIQ
FT                   RVAQVTFTRENCTVGKLLSKEG"
FT   gene            782740..783357
FT                   /locus_tag="Aazo_0740"
FT   CDS_pept        782740..783357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0740"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: npu:Npun_F2848
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63192"
FT                   /db_xref="GOA:D7E1G5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1G5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADI63192.1"
FT                   /translation="MRVFNSPPPSEAQTRTRILQAAQRLFASQGFDGTTTRDLAQAAGV
FT                   AEGTLFRHFTNKKAILVEVATNGWVDILTDLLTELSEMGSYKAVAQVMRRRMWNLRKNA
FT                   DMMRVCFMEVQFHPDLRDRIQTEVITKMTDVAEAFFQTAMDKGIYRQMDANLVAKVFLG
FT                   MFAVAGFSDNTLIEPNASPQEMQLMAEGLADIFLNGVLAKES"
FT   gene            complement(783411..783887)
FT                   /locus_tag="Aazo_0741"
FT   CDS_pept        complement(783411..783887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0741"
FT                   /product="peptidase domain protein"
FT                   /note="PFAM: peptidase domain protein; KEGG: npu:Npun_F0272
FT                   peptidase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63193"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1G6"
FT                   /inference="protein motif:PFAM:PF04151"
FT                   /protein_id="ADI63193.1"
FT                   /translation="MNKAFVAALGKIIIFPVTLLTMGISINTVFAQKNTIINSSNLYKP
FT                   LPINGSTEIKDTLSDQDIPTGQGGFARDYTMKLTKGDNLAIDLSSDNFDSIITLLSPNG
FT                   STVAENDDGPDGTSNSLLFTRITQTATYIIRVRSFGETGLGKFQLKVTKLQPVK"
FT   gene            complement(783977..784636)
FT                   /pseudo
FT                   /locus_tag="Aazo_0742"
FT                   /product="hypothetical protein"
FT   gene            complement(785037..785499)
FT                   /pseudo
FT                   /locus_tag="Aazo_0743"
FT                   /product="hypothetical protein"
FT   gene            785658..789311
FT                   /locus_tag="Aazo_0744"
FT   CDS_pept        785658..789311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0744"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="KEGG: npu:Npun_R5741 chromosome segregation protein
FT                   SMC; TIGRFAM: chromosome segregation protein SMC; PFAM: SMC
FT                   domain protein; SMCs flexible hinge domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63194"
FT                   /db_xref="GOA:D7E1G7"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1G7"
FT                   /inference="protein motif:TFAM:TIGR02169"
FT                   /protein_id="ADI63194.1"
FT                   /translation="MVHIKRVELTNFKSFGGTTSVPLLPGCTVISGPNGSGKSNILDGL
FT                   LFCLGLASSKGMRAERLPDLVNNAQKHKGRSSLEASVTVTFDLSDIVLCRKPEGEREEV
FT                   KEVEEAGETGDIGEEEDNNSQSPVPSPQSPKEWSVTRRLRVTQQGTYTSNYYINGVSCT
FT                   LTELHEQLQELRVYPEGYNVVLQGDVTSIISMNARERREIIDELAGVAAYDRKIIQAKS
FT                   TLDKVKEREDSCRIIETELIVQRDRLGQEKAKAERYQKLRTEFVHKQSWQTVLSYRSLQ
FT                   VQHEKLTAQIQAGEQSFTDFTNQLHTVNSDISQKTLELEELNSRVKALGEEELLAVQSN
FT                   LAIHEVERKEFQRQQRDLETALKESARRLMQTQEGIQQYQVSLSQAIEQQDVETAQVIS
FT                   FKQQRNETQQALEASRQAVAEIASASEAWVKQQTVLNRQIETLLQTLEPQRTEQAQLEE
FT                   RNTQLKQLIHEQSELIATLEPELADKQVECNQLETEFNASTVPIQNLAENLAATEQELQ
FT                   IQQETQKRLLQEQREKQRQLDKLEAQAQAQQEVQGTQASKIIIQSGLPGLCGLVVHLAK
FT                   VEYRHHLALETAAGARLGHIVVEDDRVASAGIELLKQKRVGRATFLPLNKIQAPKFTPD
FT                   LTLRYADGFVEYAMNLVECDRRYQEVFKYVFGNTVVFTTLEQARKQIGLYRIVTLDGEL
FT                   LETSGAMTGGSNTQRSALKFGIGEAKESEEVSSLKTRLADIDRVLDRCLEAISNLSSYS
FT                   KKLSQEFIEERQARLEQQLRLEQLEKDIKTLTAQVETARCQLSQNTEKVTTAQTRLEIL
FT                   NRELPGLENQLQQLRHTLSELESSQTSSEWQQIQAVIKTQEQQLQGKETALRDAQEQLK
FT                   SLENQQQRLQEKTQEAQTRVIEYQQEQTTVNNQLATVTSQLTELNSQITAIQADLKQLE
FT                   ENLGEEKKKRDITETGVRALLLRQQKLQWELEKLQETQEKRREDLTALQTQFRDLGAEL
FT                   PNPLPEVPAQVELEELQQELRSLAKRLQTMEPVNMLALEDYDKVQNRLQELTDKLHTLE
FT                   AERTELLLRIENFTSLRQIAFKEAFDAVNENFQSIFATLSDGDGYLQLDNIEDPFNSGL
FT                   NLVAHPKGKPVQRLASMSGGEKSLTALSFIFSLQRYRPSPFYAFDEVDMFLDGANVERL
FT                   AKMIKQQAQQAQFIVVSLRRPMIQSAERTIGVTQARGAYTQVLGIKLQSSS"
FT   gene            789439..790428
FT                   /locus_tag="Aazo_0745"
FT   CDS_pept        789439..790428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0745"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   npu:Npun_R5740 PRC-barrel domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63195"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1G8"
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /protein_id="ADI63195.1"
FT                   /translation="MTSEQVIRRSDILNTQVITRDNGKRLGIVSQVWVDIDQREVVALS
FT                   LRDSLISISGLPRQMYLNSINQIGDVILVDNEDVIEDIEVEALSNLINWEVITETGEVL
FT                   GKVRGFKFNGDTGKIYSLVIASLGLPQIPDQFLSTYEISIDEVVSTGPSRLIVFEGAEE
FT                   RVNQLTVGVLERLGIGKAPWERDPEEEYGYSAPRVVAPPNQLPSGVPLQPPKPKVRAPE
FT                   PVGEEEEEWTEDYMEEERPHRRVMPARSYESIQYEEDEEDNWSEATGRDRYQVPLRYPP
FT                   QPSNKGYSDDYDDYDDVEGDAWEDAPKPVNIPKKVKERQPEYEEEGGY"
FT   gene            791221..791591
FT                   /pseudo
FT                   /locus_tag="Aazo_0746"
FT                   /product="hypothetical protein"
FT   gene            complement(791811..792553)
FT                   /pseudo
FT                   /locus_tag="Aazo_0747"
FT                   /product="hypothetical protein"
FT   gene            complement(792613..793416)
FT                   /pseudo
FT                   /locus_tag="Aazo_0748"
FT                   /product="hypothetical protein"
FT   gene            794135..794857
FT                   /locus_tag="Aazo_0749"
FT   CDS_pept        794135..794857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0749"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="KEGG: npu:Npun_F5478 manganese and iron superoxide
FT                   dismutase; PFAM: Manganese/iron superoxide dismutase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63196"
FT                   /db_xref="GOA:D7E1G9"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1G9"
FT                   /inference="protein motif:PRIAM:1.15.1.1"
FT                   /protein_id="ADI63196.1"
FT                   /translation="MTLNRRHFLLLLGATASAFILDSNATAETPSHTTPTIQLPPLPYA
FT                   YEALEPHIDSRTMQFHHDKHHAAYVNNLNKVLDKYPKLKNKPVEALLQNLDQVPSDIRT
FT                   IVRNNAGGHVNHSMFWKIMKPNGGGEPSGEVATAIKDNFGSFIDFRRKFNEAGAGRFGS
FT                   GWVWLVRTKNGKLEITTTGNQDSPIMKGKYPIFGNDVWEHAYYLKYQNRRPDYLEAWWN
FT                   VVNWDEINQRFANGSELG"
FT   gene            complement(794922..796355)
FT                   /pseudo
FT                   /locus_tag="Aazo_0750"
FT                   /product="hypothetical protein"
FT   gene            complement(795136..796016)
FT                   /pseudo
FT                   /locus_tag="Aazo_0751"
FT                   /product="hypothetical protein"
FT   gene            complement(796651..797406)
FT                   /locus_tag="Aazo_0752"
FT   CDS_pept        complement(796651..797406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0752"
FT                   /product="methyltransferase GidB"
FT                   /note="KEGG: ava:Ava_3880 16S rRNA methyltransferase GidB;
FT                   TIGRFAM: methyltransferase GidB; PFAM: glucose inhibited
FT                   division protein; Myb DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63197"
FT                   /db_xref="GOA:D7E1H0"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1H0"
FT                   /inference="protein motif:TFAM:TIGR00138"
FT                   /protein_id="ADI63197.1"
FT                   /translation="MNLESLPVASLPEMPEIWQQTFNWQPTNQQQEQLQQLYKLILEGN
FT                   RQLNLTRITEPEEFWEKHLWDSLKGIAPKQQFIPFLNQNASVIDIGTGAGFPGVPISII
FT                   FLSCQVTLLDSTRKKINFIDTVLSNLSLTNAKTLVGRVEEIGQENKHRENYDLAVIRAV
FT                   GSASACAEYSLPLVKKGGLAVIYRGSWTEEENQSLQNAVKQLGGRVELIEEFTTPLTNS
FT                   IRHYLYLRKVKNTAFNFPRAVGVPTQRPL"
FT   gene            complement(797513..797650)
FT                   /locus_tag="Aazo_0753"
FT   CDS_pept        complement(797513..797650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0753"
FT                   /product="transcriptional regulator"
FT                   /note="KEGG: ana:all4279 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63198"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1H1"
FT                   /inference="similar to AA sequence:KEGG:all4279"
FT                   /protein_id="ADI63198.1"
FT                   /translation="MRSIRLTDIAWTNLDELAQENNLTSSEMIKLFPSEGFGDTKESEE
FT                   "
FT   gene            798407..799159
FT                   /pseudo
FT                   /locus_tag="Aazo_0754"
FT                   /product="hypothetical protein"
FT   gene            complement(799290..800556)
FT                   /pseudo
FT                   /locus_tag="Aazo_0755"
FT                   /product="hypothetical protein"
FT   gene            complement(800637..800894)
FT                   /locus_tag="Aazo_0756"
FT   CDS_pept        complement(800637..800894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0756"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:all0364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63199"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1H2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63199.1"
FT                   /translation="MSVAGVAKITLLPHVMKSCCSPLNSTALIYSIGVTRATDGLQPLI
FT                   YNTSNGALFFDTDGNCADLSVRIPTLSTQQFLSNSDITVI"
FT   gene            complement(801104..801424)
FT                   /pseudo
FT                   /locus_tag="Aazo_0757"
FT                   /product="hypothetical protein"
FT   gene            complement(801731..802312)
FT                   /pseudo
FT                   /locus_tag="Aazo_0758"
FT                   /product="hypothetical protein"
FT   gene            complement(802285..802782)
FT                   /pseudo
FT                   /locus_tag="Aazo_0759"
FT                   /product="hypothetical protein"
FT   gene            803604..804100
FT                   /pseudo
FT                   /locus_tag="Aazo_0760"
FT                   /product="hypothetical protein"
FT   gene            804242..805565
FT                   /pseudo
FT                   /locus_tag="Aazo_0761"
FT                   /product="hypothetical protein"
FT   gene            complement(805832..806377)
FT                   /pseudo
FT                   /locus_tag="Aazo_0762"
FT                   /product="hypothetical protein"
FT   gene            806735..807094
FT                   /locus_tag="Aazo_0763"
FT   CDS_pept        806735..807094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0763"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F0870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63200"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1H3"
FT                   /inference="similar to AA sequence:KEGG:Npun_F0870"
FT                   /protein_id="ADI63200.1"
FT                   /translation="MFRFIENLIGGILGFITGLFGNKDGYYLELKEEVAETKPVAAKPA
FT                   VAPAAKAEPAKVAKASVKAEPAKAIKAEPAKPVAPTETTFAPKYLIPSSSNDRRRPGAN
FT                   MNTYMDMARQVKVPG"
FT   gene            complement(807499..808587)
FT                   /pseudo
FT                   /locus_tag="Aazo_0764"
FT                   /product="hypothetical protein"
FT   gene            complement(808665..809372)
FT                   /locus_tag="Aazo_0765"
FT   CDS_pept        complement(808665..809372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0765"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   ava:Ava_5042 16S ribosomal RNA methyltransferase RsmE"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63201"
FT                   /db_xref="GOA:D7E1H4"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1H4"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ADI63201.1"
FT                   /translation="MSQLQRITINPSQLQESQLLLTPQQQHYLLRVLRSRDGDKFIAMD
FT                   GISKWWLAQLIGEQGQILEPLEVTTELPVSITLMVALPKGNGCDDIVRCSTELGVTCIL
FT                   PILSDRTLLKPSPQKLERWRRIALEAAEQSERAFVPTILEPVAFRTAINECASIHRYIC
FT                   EARGNYPHLTTVSNKFSSEIIIAIGPEGGWTDQELEIALESGFQPISLGRRILRAVTAP
FT                   IVALSLIAAACEV"
FT   gene            809512..810891
FT                   /locus_tag="Aazo_0766"
FT   CDS_pept        809512..810891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0766"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: npu:Npun_F2852 peptidase
FT                   M24"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63202"
FT                   /db_xref="GOA:D7E1H5"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1H5"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ADI63202.1"
FT                   /translation="MHTSSIFLETLHHRRQRLAELIDFPAILWSGGSSSRNFPANVFPF
FT                   RPSSHFLYFGGIPLQNAAIRLESGKLQLFIDDPNPSSTLWHGETPTREEIAANIGADDA
FT                   RPIAELEDYLENAATIPVQDAATSTEQSLLLHRWLLPQQPPQGIDLELAKAIVSLRLTH
FT                   DAAALVELRKAVAVSVEAHKAGMVVTSTAKLEAEVRAAMEAVIIGYNMTTAYASIVTVH
FT                   GEFLHNNHYYHSLEPGDLLLADVGAETETGWAADITRTWPVSGKFSSTQRDIYDIVLAA
FT                   HDACFEKIAPGVEYGEIHLIAATVITEGLVDLGILQGKPEDLVKMDLHALFFPHGIGHL
FT                   LGLDVHDMEDLGDLAGYEEGRKRSDRFGLSYLRLNRPLRAGMLVTIEPGFYQVPGILND
FT                   PKIRDQYEYLINWERLEQFADVRGIRIEDDVLVTESGSEVLTAALPNQANNIEDLLKLP
FT                   K"
FT   gene            810902..811399
FT                   /locus_tag="Aazo_0767"
FT   CDS_pept        810902..811399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0767"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F2853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63203"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1H6"
FT                   /inference="similar to AA sequence:KEGG:Npun_F2853"
FT                   /protein_id="ADI63203.1"
FT                   /translation="MINKPMQLLLTGVIISVGLSPLLAEIKPPVSYSQIAAMVEALRLA
FT                   APQTKKPNSGYYSAWQVKPETLKVWSKNCLKKELTPTQFETDPKTARQIISCIVNRELT
FT                   NQLKATNNNEIAAVRGAACWWMTGLYTGCDKGFTGDYVQKVVRFYQQEKAKPKSVNSPS
FT                   TR"
FT   gene            complement(811767..811961)
FT                   /locus_tag="Aazo_0768"
FT   CDS_pept        complement(811767..811961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0768"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GSVIVT00033555001; hypothetical protein
FT                   LOC100265282"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63204"
FT                   /db_xref="GOA:D7E1H7"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1H7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63204.1"
FT                   /translation="MIYLLNIFIYLLTPLGGVLSYYSLLGIAFDTIFGALLFLQYLFSL
FT                   HMFVFMLPWIFSLRNFSLW"
FT   gene            complement(812077..813649)
FT                   /pseudo
FT                   /locus_tag="Aazo_0769"
FT                   /product="hypothetical protein"
FT   gene            complement(813880..814503)
FT                   /locus_tag="Aazo_0770"
FT   CDS_pept        complement(813880..814503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0770"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr2974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63205"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1H8"
FT                   /inference="similar to AA sequence:KEGG:alr2974"
FT                   /protein_id="ADI63205.1"
FT                   /translation="MTSKFFLPFIAATIVYSGVVSAEVCKSKPAASSSKSTVTQQKSTV
FT                   PQVVQPQWKVFTPPDKGFQILMPGRPKTKTQMQKTYMGEIELQIFVAQPPEQEVAYLVT
FT                   YNEFPYSYAQMTKPQTILSQAQSNTLKATQSNLISERSIRSWNGHPGKEIQYIDSAGKV
FT                   TTNRIFVAEGRLYQVMGIVSKKQRSNLSRTITGYLNSFQLVVRR"
FT   gene            complement(814546..815571)
FT                   /locus_tag="Aazo_0771"
FT   CDS_pept        complement(814546..815571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0771"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="TIGRFAM: glucokinase; KEGG: ana:alr2973 glucokinase;
FT                   PFAM: Glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63206"
FT                   /db_xref="GOA:D7E1H9"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1H9"
FT                   /inference="protein motif:TFAM:TIGR00749"
FT                   /protein_id="ADI63206.1"
FT                   /translation="MTLVLAGDIGGTKTILRALESSESSGLKTLYEESYCSGDFPDLVL
FT                   MVQKFLAAANSSTPEKACFAIAGPVVNNTAKLTNLAWFLDTHRLAQELGIVSISLINDF
FT                   AAVGYGIFGLTKQDLLTLQVGKHKPEAPIGVIGAGTGLGQGFLIKQGNQYQVFPSEGGH
FT                   ADFAPRNELEFQLLKYLLDKHDIERVSAERVISGLGITSIYQFLRDRKIASESPEIAQV
FT                   VRNLEQEAGQAEKTVDAAAAIGSAALAKSDCLSEQTIQLFIEAYGAEAGNLALKLLPHG
FT                   GLYIAGGIAPKILPLMQDGSFMLNFTHKGRMRSILEEIPVHIILNQQVGLIGAALCASR
FT                   L"
FT   gene            complement(815761..816408)
FT                   /locus_tag="Aazo_0772"
FT   CDS_pept        complement(815761..816408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0772"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: ava:Ava_0934
FT                   phosphoglycerate/bisphosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63207"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1I0"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADI63207.1"
FT                   /translation="MSQIIWIARHANRLDFVNPDWFMTAEKPYDPPLSDDGMVQAKQLA
FT                   KRLKGEKISQIFASPFLRTVQTANAVAEVLDLPIKLETGLSEWLNPEWMSEEPEKLSMI
FT                   ALAALFPRIDNGYTSHIAAQYPETHEKVRQRSGQTARCLAAECWPDDILLVAHGASVLG
FT                   AAMGLVGDIAKTEVKATLCSLVKVVRQESEWLLELKGDISHLTTIEEVVRFV"
FT   gene            817212..817679
FT                   /pseudo
FT                   /locus_tag="Aazo_0773"
FT                   /product="hypothetical protein"
FT   gene            817695..818621
FT                   /pseudo
FT                   /locus_tag="Aazo_0774"
FT                   /product="hypothetical protein"
FT   gene            complement(819001..819543)
FT                   /locus_tag="Aazo_0775"
FT   CDS_pept        complement(819001..819543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0775"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all2724 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63208"
FT                   /db_xref="GOA:D7E1I1"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1I1"
FT                   /inference="similar to AA sequence:KEGG:all2724"
FT                   /protein_id="ADI63208.1"
FT                   /translation="MAILLLDNGITESNFSEIVHELKSLNIKLRNYELGTSLLSSELLE
FT                   QETVTESEKLYIIELHNSLFEFLQKETDYHWSDLLNIHPGSTNLETWIVTYGRYHTHNA
FT                   AEVIYLLAGEMIYGFVKPDGSQVQLLLQHQDYLYIPIGVEHWCSPSASLHFKVIRYFTT
FT                   VEGWMPNYTGTHQQFKI"
FT   gene            819876..821315
FT                   /locus_tag="Aazo_0776"
FT   CDS_pept        819876..821315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0776"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="KEGG: ava:Ava_4292 deoxyribodipyrimidine photo-lyase
FT                   type I; PFAM: DNA photolyase FAD-binding; DNA photolyase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63209"
FT                   /db_xref="GOA:D7E1I2"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1I2"
FT                   /inference="protein motif:PRIAM:4.1.99.3"
FT                   /protein_id="ADI63209.1"
FT                   /translation="MSHLILFWHRRDLRISDNTGLIAAREQSSKIVGVFCLDPCILNSD
FT                   DVAPARIKYMMGCLQSLEKQYTQAGSQLVILYDNPIAVIPALAEALKVKAVFWNWDVEP
FT                   YAQIRDNDVICVLREKGIQTLNQNWDQLLHSPDEILSGSKTPYTVYTPFWKNWSSKPKA
FT                   NPVATLKNSEGLTAAEQEIAKQSGAINLPSAQDLGFIWDGELIIEPGEAVAKARLETFT
FT                   TSAINEYQEQRNFPTVHGTSQLSAALKFGVIGIRTIWQATKELLETSNSEEVTASIRTW
FT                   QQEFAWREFYQHAMYHFPALANGAYRDIFKKFPWQNNQAHFQAWCEGKTGYPIVDAAMR
FT                   QLNEIGWMHNRCRMIVASFLTKDLIINPQWGEKYFMQKLIDGDLSANNGGWQWSASSGM
FT                   DSKPLRIFNPASQAQKFDIDGEYIRQWVRELKSVDTEYLVSGNITPLERRAVGYPTPIV
FT                   DHKKQQGLFKQLYQEQKTGMD"
FT   gene            821405..825256
FT                   /pseudo
FT                   /locus_tag="Aazo_0777"
FT                   /product="hypothetical protein"
FT   gene            complement(825393..826343)
FT                   /locus_tag="Aazo_0778"
FT   CDS_pept        complement(825393..826343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0778"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   ava:Ava_3228 3-beta hydroxysteroid dehydrogenase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63210"
FT                   /db_xref="GOA:D7E1I3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1I3"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADI63210.1"
FT                   /translation="MAKIIVTGAAGFIGSHLVDILLQRGEEVIGIDEFNDYYDPVLKRK
FT                   NIATFQNLSNFTLIEGDIRFLELPGICQNVEIIYHQAAQAGVRSSWGKGFRAYTERNIN
FT                   TTQVLLEAAKDARNLKRLVFASTSSIYGDAETLPTNEEIHPKPVSPYGITKLAAERLCG
FT                   LYQKNFGVPFVSLRYFTVYGPRQRPDMAFNKFFKAVLEDEAIPVYGDGQQTRDFTFVSD
FT                   AVAANLAAATVPEAVGEIFNIGGGSRVVLAEVLDTMSEIVGKPIKRNHIEKAMGDARHT
FT                   AADVSKARKILGYEPRISLREGLQQEWEWVKSLYL"
FT   gene            826745..828031
FT                   /locus_tag="Aazo_0779"
FT   CDS_pept        826745..828031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0779"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="TIGRFAM: phosphoribosylamine/glycine ligase; KEGG:
FT                   ava:Ava_3227 phosphoribosylamine--glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, N-domain;
FT                   Phosphoribosylglycinamide synthetase, C-domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63211"
FT                   /db_xref="GOA:D7E1I4"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1I4"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ADI63211.1"
FT                   /translation="MKVLVVGNGGREHALAWKLLQSNKVEQVVCVPGNGGTATLERCQN
FT                   LPLAVDDFEGISQFALKKGISLVVVGPEVPLSNGITDYLQNQGLMVFGPVKAGAQIEAS
FT                   KAWAKALMQEAGVPTATAAVFRESAAAKSYLQAQGAPIVIKADGLAAGKGVTVAETIEQ
FT                   AESAIDTIFQGQFGSAGNFVVIEECLLGQEVSVLALTDGLTIRPLLPAQDYKRIGEGDT
FT                   GENTGGMGAYTPTPIATPELMARVQTEVLEKTITALRNRGIDYRGVLYAGLMVAPNGDF
FT                   KVLEFNCRFGDPETQVILPLLETPLEDLILACIDQRLREMPPLAWKEGAAATVVAASGG
FT                   YPGDYEKGKIITGIQKAEAAGAIVFHAGTKLNSAQQIITEGGRVLNITGTGENFQEAIA
FT                   QVYTGIKHIQFPGVYYRRDIGHRVLKIET"
FT   gene            828188..830197
FT                   /locus_tag="Aazo_0780"
FT   CDS_pept        828188..830197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0780"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: npu:Npun_R3716 multi-sensor
FT                   signal transduction histidine kinase; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS domain containing protein; histidine kinase
FT                   HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63212"
FT                   /db_xref="GOA:D7E1I5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1I5"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADI63212.1"
FT                   /translation="MLAFFTTIRDAITHWWYEFTLQTKLLAVATLVVSLVMSGLTFWAV
FT                   NTIQQDARLNDTRFSRDLGLLLASNVAPLIADHNLTEVAQFSQRFYSSTSSVRYMLYAD
FT                   ETGKIFFGIPFWEPEVENSLTIKRKMQLPEDYPSDDDQPIVRQHTTPDGIVTDVFIPLI
FT                   VDKKYLGVLAIGINPNQTAVISTNFTRDVTIAVFITIWVMVILAGVINALTITKPIKEL
FT                   LVGVKQIAAGNFKQRIDLPLGGELGELIFSFNEMAERLERYEEQNIEELTAEKAKLETL
FT                   VSTIADGAVLIDNNMQIILVNPTARRIFAWEGVDVVGSNLLHNLPQSIQIEITRTLYKM
FT                   AAGECESAEFRIPLQQPTKRTIRILLTTVLNLQRESIKGIAITVQDITREVELNEAKSQ
FT                   FISNISHELRTPLFNIKTYIETLHDYGEDLGAEERQEFLETVNHETDRLTRLVNDVLDL
FT                   SKLESGRTYNFDGVDLGQALEQTLRTYQLNAKDKGLELVQEVAPNLPLVIGNYDLLLQV
FT                   FGNLIGNALKFTKAGGKVAIRAYQLHPHPNFALSSPETDLVETENHTHATLNEHNHRSR
FT                   VRIEISDTGIGIAPEDQQAIFDRFFRVENRVHTLEGTGLGLSIVRNIMQRHHSQVNLVS
FT                   EVGVGTTFWFDLDVLEEKISPTKIETANADSLET"
FT   gene            complement(830202..830507)
FT                   /pseudo
FT                   /locus_tag="Aazo_0781"
FT                   /product="hypothetical protein"
FT   gene            830919..832396
FT                   /locus_tag="Aazo_R0008"
FT   rRNA            830919..832396
FT                   /locus_tag="Aazo_R0008"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            832726..835551
FT                   /locus_tag="Aazo_R0009"
FT   rRNA            832726..835551
FT                   /locus_tag="Aazo_R0009"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            835626..835742
FT                   /locus_tag="Aazo_R0010"
FT   rRNA            835626..835742
FT                   /locus_tag="Aazo_R0010"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            complement(835831..836631)
FT                   /locus_tag="Aazo_0782"
FT   CDS_pept        complement(835831..836631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0782"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63213"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1I6"
FT                   /inference="similar to AA sequence:KEGG:Ava_1833"
FT                   /protein_id="ADI63213.1"
FT                   /translation="MLKTMTANNPTILALDFDGVICDGLIEYFEVAWRTYHQIWLSSAT
FT                   DIRPYDLALRFYRLRPVIETGWEMPVLIKALIEGFSDDKILQDWTNITSQILTADNLDA
FT                   KEVAKKLDTLRDEWIKADLDSWLNLHKFYPGVIEKLKMTVTSEVQLYIITTKEGRFVQH
FT                   LLRKEGVHLPTTAIFGKEVKRPKYETLRQLIEKSEHSSVSVWFVEDRLKTLQLIQKQSD
FT                   LNHVQLFLADWGYNTQRERQTGNNDQRIKLISLSHFAHDFSKWS"
FT   gene            complement(836917..837255)
FT                   /locus_tag="Aazo_0783"
FT   CDS_pept        complement(836917..837255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0783"
FT                   /product="transposase"
FT                   /note="KEGG: mar:MAE_48030 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63214"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1I7"
FT                   /inference="similar to AA sequence:KEGG:MAE_48030"
FT                   /protein_id="ADI63214.1"
FT                   /translation="MIILMALCLLVYNLGERQLRISLKTQKATVKIQLNKPTESPTLHW
FT                   IFQSQCVGLVPRLVREAPRKEAATGVCFQGILFLSTQGVHRILNLTEEGCRIFQFLPTA
FT                   CQKYYLFS"
FT   gene            complement(837252..837446)
FT                   /pseudo
FT                   /locus_tag="Aazo_0784"
FT                   /product="hypothetical protein"
FT   gene            837544..838862
FT                   /pseudo
FT                   /locus_tag="Aazo_0785"
FT                   /product="hypothetical protein"
FT   gene            838897..839115
FT                   /locus_tag="Aazo_0786"
FT   CDS_pept        838897..839115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0786"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63215"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1I8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63215.1"
FT                   /translation="MTHLHCYKLPDLWAYLTSMDLQVEGYRVVFDAEHKPLIKRGLELL
FT                   GKYMITHILGLDYADNILVIAHKSSLT"
FT   gene            839312..839557
FT                   /locus_tag="Aazo_0787"
FT   CDS_pept        839312..839557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0787"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="KEGG: ade:Adeh_3059 polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63216"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1I9"
FT                   /inference="similar to AA sequence:KEGG:Adeh_3059"
FT                   /protein_id="ADI63216.1"
FT                   /translation="MLQLVTLSISIFGTPLLLYWLGDERYGAFLAATDWGNYLNLLELG
FT                   ISGSLLALLAKAVGIGEHQQILLTLVTGIKPYLKIY"
FT   gene            839563..839688
FT                   /locus_tag="Aazo_0788"
FT   CDS_pept        839563..839688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0788"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63217"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1J0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63217.1"
FT                   /translation="MVLAGLGLGLFMTHLVPVQGILIGELQKGYWVGFMAICCCH"
FT   gene            839748..839939
FT                   /locus_tag="Aazo_0789"
FT   CDS_pept        839748..839939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0789"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63218"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1J1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63218.1"
FT                   /translation="MFQSLLITGLALLLAWKGFAITGQFLAVLAGNIGFQALICWDGLR
FT                   RYQHVFSAIKDHKAQIPI"
FT   gene            839970..840713
FT                   /pseudo
FT                   /locus_tag="Aazo_0790"
FT                   /product="hypothetical protein"
FT   gene            complement(841190..841771)
FT                   /locus_tag="Aazo_0791"
FT   CDS_pept        complement(841190..841771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0791"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: ava:Ava_4111 PBP
FT                   family phospholipid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63219"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1J2"
FT                   /inference="protein motif:PFAM:PF01161"
FT                   /protein_id="ADI63219.1"
FT                   /translation="MPQRRGFLNQSFAIFGLVGLWLISSCSLTGNRSESKQEVKTMKLT
FT                   SSAFINNGLIPAKYTCDGADISPPLSWDEIPSETQSLALIVDDPDALARNFVHWVIYDI
FT                   TPTVNQLPEKIIGSKTIPSGGVQGKNDFGKLGYGGLCPPSGIHRYFFQLYALDQKLSLG
FT                   TGASKSQMISAMEGHILEKAELIGRYQRQR"
FT   gene            842270..842551
FT                   /locus_tag="Aazo_0792"
FT   CDS_pept        842270..842551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0792"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA0763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63220"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1J3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63220.1"
FT                   /translation="MEIINVYTSRLESQVDNNQQKLFNNKLIVFAEFNNGDEEGHLRLN
FT                   PIGTMDDLVNQNMELQDGKIMTFYSEHLEVDGIIKHSQEENIWVAIIN"
FT   gene            complement(842586..842771)
FT                   /locus_tag="Aazo_0793"
FT   CDS_pept        complement(842586..842771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0793"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63221"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1J4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63221.1"
FT                   /translation="MSKGSLRIYILYHLSLHPVNLQGHSGLIFYHLVWKYIQILVGYAI
FT                   LQKYVLAFPKNQEISS"
FT   gene            complement(843153..843413)
FT                   /locus_tag="Aazo_0794"
FT   CDS_pept        complement(843153..843413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0794"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asl2490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63222"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1J5"
FT                   /inference="similar to AA sequence:KEGG:asl2490"
FT                   /protein_id="ADI63222.1"
FT                   /translation="MDISPNQSSTQFLTLDESSQVDAALLSSPEKFLTRLTISSLRILQ
FT                   HIAKEYDVRIEELTTKQIINWFEIDAEIRREKGVEEAFLKW"
FT   gene            complement(843464..844168)
FT                   /locus_tag="Aazo_0795"
FT   CDS_pept        complement(843464..844168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0795"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: ana:all2491 hypothetical protein; TIGRFAM:
FT                   iron-sulfur cluster biosynthesis transcriptional regulator
FT                   SufR; PFAM: regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63223"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014075"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1J6"
FT                   /inference="protein motif:TFAM:TIGR02702"
FT                   /protein_id="ADI63223.1"
FT                   /translation="MATTQQSSTKQDILEYLLKEVQATSLELAEVLEVSPQAIRRHLKD
FT                   LETDNLVVYFVPEQVGMGRPQHLYQLSQRGREQLQRNVNRLSDGYGDFAVSLLDTLAAT
FT                   VGREQVKTILQKQWERKAQEYRERVGTGSLQERVANLVELRKAEGFMAEFYPVESDSAH
FT                   SERFIFMEHTCAISNVAESFPSICGHELEMFAAILPDCTVKRTHWLIDGEHRCGYLVQR
FT                   SSGVTGVTEVEN"
FT   gene            844379..845818
FT                   /locus_tag="Aazo_0796"
FT   CDS_pept        844379..845818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0796"
FT                   /product="FeS assembly protein SufB"
FT                   /note="KEGG: ana:alr2492 cysteine desulfurase activator
FT                   complex subunit SufB; TIGRFAM: FeS assembly protein SufB;
FT                   PFAM: SufBD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63224"
FT                   /db_xref="GOA:D7E1J7"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1J7"
FT                   /inference="protein motif:TFAM:TIGR01980"
FT                   /protein_id="ADI63224.1"
FT                   /translation="MSASVKTLVNQPYKYGFVTDIEADTIPRGLNEDVIRLISAKKNEP
FT                   EFMLEYRLRAYHQWLKMIEPSWPHVTYPPINYQDIIYYSAPKQKKAKLNSLDEVDPTLL
FT                   ETFEKLGIPLNEQKRLSNVAVDAIFDSVSVATTFKENLAKDGVIFCSISEALQEHPELI
FT                   KKYLGSVVPIADNYFAALNAAVFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTL
FT                   IIAEEGSYVSYLEGCTAPMYDSNQLHAAVVELVALDNAEIKYSTVQNWYAGDANGKGGI
FT                   YNFVTKRGLCQGVNSKISWTQVETGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQAD
FT                   TGTKMIHIGKNTRSTIISKGISAGKSSNSYRGLVKINPTAKGARNYSQCDSMLIGDNAQ
FT                   ANTFPYIQVQNNNGKVEHEASTSKIGEDQLFFFAQRGISSEDAISMMISGFCKDVFNQL
FT                   PMEFAVEANKLLSLKLEGSVG"
FT   gene            845903..846688
FT                   /locus_tag="Aazo_0797"
FT   CDS_pept        845903..846688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0797"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="TIGRFAM: FeS assembly ATPase SufC; PFAM: ABC
FT                   transporter related; KEGG: ava:Ava_0425 FeS assembly ATPase
FT                   SufC; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63225"
FT                   /db_xref="GOA:D7E1J8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1J8"
FT                   /inference="protein motif:TFAM:TIGR01978"
FT                   /protein_id="ADI63225.1"
FT                   /translation="MIIEKSDLILSVKGLTADVDGTPILKGLNLDVRAGEIHAIMGPNG
FT                   SGKSTFSKVLAGHPAYSVTGGEVIFQGQNLLEMEATERARSGVFLAFQYPLEIPGVSNL
FT                   DFLRVAYNSRRKAQGLEEVDAFDFDDLVEEKLDIVKMNPAFLNRSLNEGFSGGEKKRNE
FT                   ILQMGILEPRLAILDETDSGLDIDALKIVANGVNQLTSPENATIMITHYQRLLDYIVPD
FT                   FVHVMAQGQIIRSGGKELALELESRGYNWVLEEALGVGV"
FT   gene            846691..848037
FT                   /locus_tag="Aazo_0798"
FT   CDS_pept        846691..848037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0798"
FT                   /product="FeS assembly protein SufD"
FT                   /note="KEGG: npu:Npun_F4824 FeS assembly protein SufD;
FT                   TIGRFAM: FeS assembly protein SufD; PFAM: SufBD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63226"
FT                   /db_xref="GOA:D7E1J9"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1J9"
FT                   /inference="protein motif:TFAM:TIGR01981"
FT                   /protein_id="ADI63226.1"
FT                   /translation="MTIQVSPSSISDSLLNRDAFLNGLLNQVTTSATTGWLQQLRDSAV
FT                   KWVRHSVIPNTRNEEWRFTDLSLLKEVEFNSVDIKTLEKFQETALDVEIFSEVSHCLVF
FT                   VNGIFAPNLSAITNLPPGLKIGNLDILPDAVAQEYLAQSEGTRDVFTTLNTAGLNDVAV
FT                   VWVGKNVVVQNPIYLLFISVAGESAIISQPRCLVVAESNSQVSLIEEYTNRRGAEKAED
FT                   EVYFANSVTEIWVNENAQVSHTRVVMQGEAAFHIGKTAVTQAQYSRYSCNAVTVGGKIS
FT                   RHNLEILQTGEQTETTLNGLTVIAEKQLADTHSVLFLNHPHGVSKHLHKCIIGDRAHGV
FT                   FNGKIFVPKHAQLTDAYQLNRNLLLSSKARVDTKPQLEITADNVKCSHGATVSQLEDDE
FT                   IFYLQSRGIDRNNARKLLVNAFASEIINFIPVSPLREKLLKTVVSLTHK"
FT   gene            848172..849443
FT                   /locus_tag="Aazo_0799"
FT   CDS_pept        848172..849443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0799"
FT                   /product="cysteine desulfurase, SufS subfamily"
FT                   /note="KEGG: npu:Npun_F4825 SufS subfamily cysteine
FT                   desulfurase; TIGRFAM: cysteine desulfurase, SufS subfamily;
FT                   PFAM: aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63227"
FT                   /db_xref="GOA:D7E1K0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1K0"
FT                   /inference="protein motif:TFAM:TIGR01979"
FT                   /protein_id="ADI63227.1"
FT                   /translation="MTFTSTKTLGDKVRKDFPILHQEVHGKPLVYLDNAATSQKPLAVL
FT                   NAWRDYYEQYNSNVHRGAHFLSAKATDAYEAARDKVANFINAKSRQDIVYTRNASEAIN
FT                   LVAYSWGMKNLQPGDEIILSVMEHHSNIVPWQFVAQKTGAVLKFVELTPEETFDLEQFK
FT                   KLISEKTKLVSVVHISNTLGCINPVKEIAEIAHRYDAKFLMDACQSVPHMPIDVQEINC
FT                   DWLVASGHKMCAPTGIGFLYGKLELLEAMPPFFGGGEMIAEVYLDHSTYADLPHKFEAG
FT                   TPAIGEAIALGAAIDYLTHIGIGMDKIHAYEAELTAYLFEQLEQIPQIRIYGPKPNAQG
FT                   EGRSALAAFTAEGVHANDLATLLDQEGVAIRSGHHCTQPLHRYLGLAGTARASLSFYNT
FT                   SQEIDVFIKALKETLDFFASVFGE"
FT   gene            849491..849670
FT                   /locus_tag="Aazo_0800"
FT   CDS_pept        849491..849670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0800"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: npu:Npun_F4826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63228"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1K1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63228.1"
FT                   /translation="MQRRRDAKRILVELSQGLSGKCHFISRSPEFLIVNAPVITIVEGF
FT                   RWSGIDKCDRRGRI"
FT   gene            849676..852284
FT                   /pseudo
FT                   /locus_tag="Aazo_0801"
FT                   /product="hypothetical protein"
FT   gene            850625..850777
FT                   /pseudo
FT                   /locus_tag="Aazo_0802"
FT                   /product="hypothetical protein"
FT   gene            850847..851720
FT                   /pseudo
FT                   /locus_tag="Aazo_0803"
FT                   /product="hypothetical protein"
FT   gene            851757..851951
FT                   /locus_tag="Aazo_0804"
FT   CDS_pept        851757..851951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0804"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_BR159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63229"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1K2"
FT                   /inference="similar to AA sequence:KEGG:Npun_BR159"
FT                   /protein_id="ADI63229.1"
FT                   /translation="MNQVEIELSVLSRQCLERRIPNVEILSSEIATWESQRNQQKPSVY
FT                   WGFKTKDARKKMQRLYPSI"
FT   gene            852256..852555
FT                   /locus_tag="Aazo_0805"
FT   CDS_pept        852256..852555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0805"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F4826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63230"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1K3"
FT                   /inference="similar to AA sequence:KEGG:Npun_F4826"
FT                   /protein_id="ADI63230.1"
FT                   /translation="MFCFPYTFFNPSTLQLNPYIIVEVKGENIDAGLGQCVAEMIAARI
FT                   SNEREGNNIPTIYGTVTTGSNWKFLKLINQVVEIDLSEYYINNIGKNLGFYLLS"
FT   gene            852628..853704
FT                   /pseudo
FT                   /locus_tag="Aazo_0806"
FT                   /product="hypothetical protein"
FT   gene            853735..854229
FT                   /pseudo
FT                   /locus_tag="Aazo_0807"
FT                   /product="hypothetical protein"
FT   gene            854630..855244
FT                   /locus_tag="Aazo_0808"
FT   CDS_pept        854630..855244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0808"
FT                   /product="Lipoprotein LpqB, GerMN domain protein"
FT                   /note="PFAM: Lipoprotein LpqB, GerMN domain; KEGG:
FT                   ana:alr5055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63231"
FT                   /db_xref="GOA:D7E1K4"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1K4"
FT                   /inference="protein motif:PFAM:PF10646"
FT                   /protein_id="ADI63231.1"
FT                   /translation="MNDQQRTNRNVSSGVIAAVSAAVVAVSGGVAWLTSQTPNTSTPGN
FT                   PSQSIKQPQKPLTTKPGNEQSANIYWLRPTEKSLELVPQPVKIAAAQPNQALEAAFKTL
FT                   LAGPTEGSDSTTIPKGTQLLGLKVENNDVHVNLSEDFTSGGGSTSMLGRIGQVVYTATT
FT                   LNPNAKVYIEVNGKQLDVLGGEGVELQQPLTRETFNKNYPL"
FT   gene            complement(855447..855977)
FT                   /locus_tag="Aazo_0809"
FT   CDS_pept        complement(855447..855977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0809"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="KEGG: npu:Npun_R0439 acetyl-CoA carboxylase, biotin
FT                   carboxyl carrier protein; TIGRFAM: acetyl-CoA carboxylase,
FT                   biotin carboxyl carrier protein; PFAM: biotin/lipoyl
FT                   attachment domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0809"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63232"
FT                   /db_xref="GOA:D7E1K5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1K5"
FT                   /inference="protein motif:TFAM:TIGR00531"
FT                   /protein_id="ADI63232.1"
FT                   /translation="MPLDFNEIRQLLATIAQTDIAEVTLKSDDFELTVRKGVTPVLSVG
FT                   QATLGGVVGSGLTSVTTGNQIASTQLPEAAASRDNSVGGGQSPLSVNTPSARFVEVQSP
FT                   MVGTFYRAPAPGEPPFVEVGDRVRSGQSVCIIEAMKLMNEIEAEVSGQVMEILVQNGEP
FT                   IEYGQPLMRINPD"
FT   gene            complement(856169..856726)
FT                   /locus_tag="Aazo_0810"
FT   CDS_pept        complement(856169..856726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0810"
FT                   /product="translation elongation factor P"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor KOW domain protein; Elongation factor P;
FT                   Elongation factor P/YeiP protein; KEGG: ana:all5058
FT                   elongation factor P; SMART: Elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63233"
FT                   /db_xref="GOA:D7E1K6"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1K6"
FT                   /inference="protein motif:TFAM:TIGR00038"
FT                   /protein_id="ADI63233.1"
FT                   /translation="MISSNDFRPGVSIVLDGSVWRVVEFLHVKPGKGSAFVRTKLKNVQ
FT                   NGSVVERTFRAGETVPQATLEKITMQHTYKEGEEFVFMDMETYEEGRLSAAQIGDRVKY
FT                   LKEGMEANVIRWGEQVLEVELPNSVVLEVVQTDPGIKGDTATGGTKPAIVETGATIMVP
FT                   LFITQGERIKIDTREDKYLGRE"
FT   gene            856973..858079
FT                   /locus_tag="Aazo_0811"
FT   CDS_pept        856973..858079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0811"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="KEGG: npu:Npun_F0441 peptidyl-prolyl cis-trans
FT                   isomerase, cyclophilin type; PFAM: peptidyl-prolyl
FT                   cis-trans isomerase cyclophilin type"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0811"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63234"
FT                   /db_xref="GOA:D7E1K7"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1K7"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ADI63234.1"
FT                   /translation="MFNLLKSWLKHSLRAILLVTILLGISTVGWTFSSYAALPSGNAIT
FT                   DGKALLRYALPIDNQPVRKLQASLEDISNQLRANKRWGAVSRDLSQASRILDKPSQILA
FT                   SVPEERQPQASAWITELKSGIAELQEVVKNKQKDPIVEGRAKLLSLITLLEESMVKKFP
FT                   FEVPAEYSNLPQLKGRATIAFKTNKGDLTVVVDGYSAPVTAGNFVDLVQQGFYNGLEFT
FT                   RSEESYVLQTGDPEGKELGFIDPKTGKYRAIPLEILVEGEKEPTYGITLEDAGRYLDMP
FT                   VLPFSSFGALAMARPESDANGASSQVFFFLFEPELTPAGRNLLDGRYTVFGYLTEGKEI
FT                   LDKLKAGDKIESANVVQGIENLVQPQPA"
FT   gene            858188..859228
FT                   /locus_tag="Aazo_0812"
FT   CDS_pept        858188..859228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0812"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="TIGRFAM: thiamine-monophosphate kinase; KEGG:
FT                   ava:Ava_2317 thiamine monophosphate kinase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0812"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63235"
FT                   /db_xref="GOA:D7E1K8"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1K8"
FT                   /inference="protein motif:TFAM:TIGR01379"
FT                   /protein_id="ADI63235.1"
FT                   /translation="MNSDLSYLQVRDIGEQGILERLQRFCPPEIIGDDAAVLAITAQES
FT                   LVVTTDMLVDGVHFSDITTSPEDTGWRASAANLSDLAAMGAFPLGITVGLGLPGDLAVS
FT                   WVERLYQGMTECLQKYNVPILGGDIVRSPITTLAITAFGQANPNFIIRRSTAQVGDAII
FT                   VTGIHGASRAGLELLLNPQICQNLESEEKAALIKAHQRPNPRLDVIPILQEIFTSPCPI
FT                   SISGMDSSDGLADAVLQICRASRVGAILEQSKIPLPSAFHKWLTPGQWLHPPQAWLNYA
FT                   LYGGEDFELVLCLPPPAALTLVQKLGAGASIIGTITPGLTVILHHENERIPDQALSLSQ
FT                   GFQHFS"
FT   gene            complement(859293..860306)
FT                   /locus_tag="Aazo_0813"
FT   CDS_pept        complement(859293..860306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0813"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.13"
FT                   /note="TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase,
FT                   type I; KEGG: ana:all5062 glyceraldehyde-3-phosphate
FT                   dehydrogenase; PFAM: Glyceraldehyde 3-phosphate
FT                   dehydrogenase, NAD(P) binding domain; Glyceraldehyde
FT                   3-phosphate dehydrogenase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0813"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63236"
FT                   /db_xref="GOA:D7E1K9"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1K9"
FT                   /inference="protein motif:TFAM:TIGR01534"
FT                   /protein_id="ADI63236.1"
FT                   /translation="MIRVAINGFGRIGRNFARCWVGRENSQIELVAINDTSDPRTNAHL
FT                   LRYDSMLGRLQNADITADDNSITVNGKTIKCVSDRNPDNLPWKEWNIDLIIESTGVFTS
FT                   KEGAMRHVNAGAKKVLITAPGKNEDGTFVMGVNHHDYDHNLHNIISNASCTTNCLAPIA
FT                   KVLNEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAAINIVPTSTGAAKAVALVL
FT                   PALKGKLNGVALRVPTPNVSMVDFVVQVEKRTITEEVNQALKDASEGSLKGILGYSELQ
FT                   LVSSDYQGTNESSIVDANLTMVMGNDMVKVMAWYDNEWGYSQRVLDLAELVAQKWV"
FT   gene            complement(860422..861048)
FT                   /locus_tag="Aazo_0814"
FT   CDS_pept        complement(860422..861048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0814"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /note="KEGG: npu:Npun_R0445 nicotinate (nicotinamide)
FT                   nucleotide adenylyltransferase; TIGRFAM: nicotinate
FT                   (nicotinamide) nucleotide adenylyltransferase;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   cytidylyltransferase; Nicotinamide mononucleotide
FT                   adenylyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0814"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63237"
FT                   /db_xref="GOA:D7E1L0"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1L0"
FT                   /inference="protein motif:TFAM:TIGR00482"
FT                   /protein_id="ADI63237.1"
FT                   /translation="MQQVAIFGGTFDPIHWGHLLVAKTALEQLHLEQVIWVVSKNPPHK
FT                   QAALFEHRVAMLQLATKHHPRFTVSLIEKKHSGASYSINTLIELSACYPNTHWYWIIGL
FT                   DTFQTLPRWYRGPELAQMCDWLIAPRLLGGETIPQSESICKQVEQQLKEQSYIINWQLL
FT                   HTPLLRFSSSIMRELCRQGCAIGDLVPDTVRSYIVNHNLYTNNSE"
FT   gene            861502..862983
FT                   /locus_tag="Aazo_0815"
FT   CDS_pept        861502..862983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0815"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="KEGG: npu:Npun_F0446 UDP-N-acetylmuramate--alanine
FT                   ligase; TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   Mur ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0815"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63238"
FT                   /db_xref="GOA:D7E1L1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1L1"
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /protein_id="ADI63238.1"
FT                   /translation="MNNSIDFSGRPFHFIGIGGIGMSALAYVLAKRQLPVSGSDLRTNQ
FT                   ITRKLESLGAHIFSRQEARNLEFFRPQVSTNGILLNSQEQLSATKTILPQVICSTAINT
FT                   NNLEYKAALELGCPILHRSDVLAALIADYYSIAVAGTHGKTTTTSIIGYMLLQAGLDPT
FT                   ILVGGEVNAWEGNARLGESKYLVAEADESDGSLVKHSPAIGVITNIELDHPDHYENLEE
FT                   VVDTFQKFAQGCQILVGSIDCDTVRDCFDRPGQRLKPTISYSLHPETNADYTVTNIDYR
FT                   ADGTTALVWEKAKALGVLNLRLLSRHNLSNGLAAVAVGRSLGLEFGEIAKGIATFEGAR
FT                   RRFEFRGEAAGITFIDDYAHHPSEIRATLAAASLQARPGQRVVAIFQPHRYSRTLTFLD
FT                   QFAGSFAHADLVVLTDIYSAGEADLGQISGEQLADEIAKQHPQVIYQPTLSSIRELLLS
FT                   TLRPGDLALFLGAGNLNQAIPEVIATLREPATATS"
FT   gene            863142..864107
FT                   /locus_tag="Aazo_0816"
FT   CDS_pept        863142..864107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0816"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; KEGG: npu:Npun_F0447
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein; FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0816"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63239"
FT                   /db_xref="GOA:D7E1L2"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1L2"
FT                   /inference="protein motif:TFAM:TIGR00179"
FT                   /protein_id="ADI63239.1"
FT                   /translation="MISALTTNKQEKANLTERNIIHLPGTDCVIKSAASLSAFTSYRVG
FT                   GSAEWYVAPRSLEALQASIEYAKDLNLPVTILGAGSNLLVSDQGIPGLVIASRHFRSKH
FT                   FDLQTGQLTVAAGESIPSLAWEAADLGWQGLEWAVGIPGTVGGAVVMNAGAHNSCIADM
FT                   LVSAELLSPDGRLETITPAELGYQYRSSLLQRGKRIVTQATFQLQPGADPAKVLATTKE
FT                   HKQHRLTTQPYNYPSCGSVFRNPKTYSAGWLIEQAGLKGYQIGGAQVAQLHANFIVNRG
FT                   GAKASDIFCLISHIQREVQERWSIWLEPEVKMIGEFQPVG"
FT   gene            864238..864588
FT                   /locus_tag="Aazo_0817"
FT   CDS_pept        864238..864588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0817"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ana:alr5067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0817"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63240"
FT                   /db_xref="GOA:D7E1L3"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1L3"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADI63240.1"
FT                   /translation="MTAGKGQGFGFGLGKMKELAAAFQKAQQVQEGAKRLQEELEQMEI
FT                   QGESGGGLVKVIVSGNQEPRRVEISPDALGEGADVLSDLITAAMKDAYNKSTATMRERM
FT                   EDLTSGLELPGL"
FT   gene            864703..865176
FT                   /locus_tag="Aazo_0818"
FT   CDS_pept        864703..865176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0818"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="KEGG: ava:Ava_2323 protein tyrosine phosphatase;
FT                   PFAM: Protein-tyrosine phosphatase, low molecular weight;
FT                   SMART: Protein-tyrosine phosphatase, low molecular weight"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0818"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63241"
FT                   /db_xref="GOA:D7E1L4"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1L4"
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /protein_id="ADI63241.1"
FT                   /translation="MAYKLLFVCLGNICRSPSAENIMNHLVSQAGLSDRIYCDSAGTSS
FT                   YHIGSPSDRRMSAAAVSKLGIKLLGQARQFQTSDFQEFDLILAMDKDNYKNILAVDSSG
FT                   QYHHKVRLICDFCSRHTLKEVPDPYYGGTEGFNQVIDLLIDACEGLLEYVNSV"
FT   gene            complement(865239..865922)
FT                   /locus_tag="Aazo_0819"
FT   CDS_pept        complement(865239..865922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0819"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: npu:Npun_R0450 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: response
FT                   regulator receiver; regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0819"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63242"
FT                   /db_xref="GOA:D7E1L5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1L5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADI63242.1"
FT                   /translation="MALKILVVDDDLGTRLSISDYLELSGYSVIMADDGQEALAMVEEN
FT                   NPDLIVTDIVMPRLNGYELVRRVRQKAEFRLLPVILLTERTKTQERILGYQSGCDLYLP
FT                   KPFELEELAAAIRNLLERSQIIQSEYRFPHQDNLETSITGKLRDSNHALSTQIHAPKLL
FT                   SSLTTREQEVLELLTHGLSNADIGNQLHLSPRTVEKYVSSLLRKTLTSNRAELVRFAMK
FT                   HGLVE"
FT   gene            866232..866699
FT                   /locus_tag="Aazo_0820"
FT   CDS_pept        866232..866699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0820"
FT                   /product="SsrA-binding protein"
FT                   /note="KEGG: npu:Npun_F0451 SsrA-binding protein; TIGRFAM:
FT                   SsrA-binding protein; PFAM: SmpB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0820"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63243"
FT                   /db_xref="GOA:D7E1L6"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1L6"
FT                   /inference="protein motif:TFAM:TIGR00086"
FT                   /protein_id="ADI63243.1"
FT                   /translation="MSDKNEGFKVITDNRQARYLYEILETYEVGIQLTGTEVKSIRAGK
FT                   VNLKDGYGLIRNGEAWLINAHISPYTSSGQYFNHEPRRTRKLLLHRQEIRKLIGKVEQQ
FT                   GLTLVPLKMYLQGGWVKLSIGLGKGKKVHDKREDIKRRQDQRDIQRAMKSY"
FT   gene            867248..867526
FT                   /locus_tag="Aazo_0821"
FT   CDS_pept        867248..867526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0821"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F0452 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0821"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63244"
FT                   /db_xref="GOA:D7E1L7"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1L7"
FT                   /inference="similar to AA sequence:KEGG:Npun_F0452"
FT                   /protein_id="ADI63244.1"
FT                   /translation="MKSNFTRTIGAGVLTLSMGILPVSLPAQTQVTPPRTDALPNRTVY
FT                   DDPNHVNWGWLGLIGLIGLAGLLGKRREEEPTRYPDPNAPGATTYRD"
FT   gene            complement(867658..869073)
FT                   /locus_tag="Aazo_0822"
FT   CDS_pept        complement(867658..869073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0822"
FT                   /product="inorganic carbon transporter"
FT                   /note="KEGG: npu:Npun_R0453 O-antigen polymerase; TIGRFAM:
FT                   inorganic carbon transporter; PFAM: O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0822"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63245"
FT                   /db_xref="GOA:D7E1L8"
FT                   /db_xref="InterPro:IPR006007"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1L8"
FT                   /inference="protein motif:TFAM:TIGR00947"
FT                   /protein_id="ADI63245.1"
FT                   /translation="MNLVWQRFTLSSLPLKEYLNTSYLHRFMVGILRPWRQTSLLMQWG
FT                   DTIAAALLSLVYALAPFVSTTLMLVLLLACIGFWLLLTLSDETTSVNVASVTPIHLLVL
FT                   LYWGIAAIATALSPVKKAALSDLATLSLYLLLFTVCARVLRFSRMRSWLITLYLHTSLI
FT                   VSVYGIRQWFFGAKALATWVDPESPLSKTTRVYSYLGNPNLLAGYLLPAVVLSLVAIFA
FT                   WQGWFKKTLAVTMFAVNTICLVLTYSRGGWIALVVAFLTGMALLVYWWSLEMPPFWRTW
FT                   SLPIILGSLIGVLVLAMIFVEPVRLRVVSIFADRQDSSNNFRRNVWDAVFRMIGDRPII
FT                   GIGPGHHSFNKVYPLYQQPRYTALSAYSIFLEVAVETGFMGLACFLWLIIVTFNTAFIQ
FT                   LQRFRESRSIEGFWVIGAIAALLGMLAHGMVDTVWYRPSLNTLWWLMVALVASYWTPLS
FT                   QTTNQPNPEPGLK"
FT   gene            complement(869315..870859)
FT                   /locus_tag="Aazo_0823"
FT   CDS_pept        complement(869315..870859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0823"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="KEGG: npu:Npun_R0454 GAF sensor signal transduction
FT                   histidine kinase; PFAM: GAF domain protein; histidine
FT                   kinase A domain protein; ATP-binding region ATPase domain
FT                   protein; SMART: histidine kinase A domain protein;
FT                   ATP-binding region ATPase domain protein; GAF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0823"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63246"
FT                   /db_xref="GOA:D7E1L9"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1L9"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ADI63246.1"
FT                   /translation="MVMIEPENKLFALDNGWNPLETKEQQRIKILSELGLRLPETIPIF
FT                   EEATQTAAHFLAAEICILGFIDQEIHWFKSAVGLSRLGLMNDLAKNRQLLRQESFCTQV
FT                   VETLRALVINDTVTTENIQISTSKLVQHYGIRSYLGVPLIDASGYCLGALGVMDRQPRN
FT                   FTERDIEFLQIIARWSMSEFERNRLLQGKLQTASSRNIPGLPFPQEQIIDLKISPPNLN
FT                   TNSGSTQQIKLELLGQLTQELRTPLTSVLGMAGVLGREIYGPLTTKQREYLEIIQHSGR
FT                   YLLSLVNEITELRTLCDTSSGLNLAPVDVEMLCQQAINTLSEVTVRREQDIRLSVEPGR
FT                   NRIWYLDKDKVRQMVYHLLFSVIQLSATGSIVRVHISDKEDTLSITVWVSHPWLGDGVT
FT                   EIDPYFRLDSLSIFDILDEPRKYNIDADNQENLPEILQKSESLMDEPSGILVDASNQNL
FT                   ANVSGHLSREKLGLLLSCQLAEQHGGQIVIQGSPESGYRYVMSLPLQSNTNSEFTN"
FT   gene            871507..872643
FT                   /locus_tag="Aazo_0824"
FT   CDS_pept        871507..872643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0824"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="KEGG: npu:Npun_F0455 DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; PFAM: DegT/DnrJ/EryC1/StrS
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0824"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63247"
FT                   /db_xref="GOA:D7E1M0"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1M0"
FT                   /inference="protein motif:PRIAM:2.6.1.50"
FT                   /protein_id="ADI63247.1"
FT                   /translation="MIITVPFVDLNLQHQPIQAKLQQAIEDVLVKGDFILGQPLSDFET
FT                   AFAVASGTKYGIGVASGTDAITLGLQACNIGAGDEVILPANTFIATLIGVVSAGAKPIL
FT                   VDCNPKTALIDLEAAAKAITPQTKAIIPVHLYGQMVSPSQLLDFANTYKILIFEDAAQA
FT                   HLAEREGYRAGSVGIAAAFSFYPSKNLGAFGDGGMVVTNNPDVATKMRRLRNYGSSQKY
FT                   VHIEPGTNSRLDTLQAAILHQKLPYLSQWNSARLNIGQRYDIELVPLASAGIIPIHNQS
FT                   GTGHIYHLYVVKIDDSCPIQRQQLQGQLTAAGIQTGIHYPIPCHLQPAFNYLGYQQGNF
FT                   PQSEQLSQQILSLPIYPGLNNSQITEIVTAIYSILKIK"
FT   gene            872860..873789
FT                   /locus_tag="Aazo_0825"
FT   CDS_pept        872860..873789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0825"
FT                   /product="eight transmembrane protein EpsH"
FT                   /note="KEGG: npu:Npun_F0456 eight transmembrane protein
FT                   EpsH; TIGRFAM: eight transmembrane protein EpsH; PFAM:
FT                   Exosortase EpsH-related"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0825"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63248"
FT                   /db_xref="GOA:D7E1M1"
FT                   /db_xref="InterPro:IPR013426"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="InterPro:IPR026492"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1M1"
FT                   /inference="protein motif:TFAM:TIGR02602"
FT                   /protein_id="ADI63248.1"
FT                   /translation="MVLQQQIKNRNTIQLLNWGILVTSLLLYAPILLHWIDGWLHKSIS
FT                   IEHEYFSHGMIGLPYAGYLTWTNRKQWQRLPNINHPVSMGLFIIGIIFYLSGVAEWVNL
FT                   SLPIILIGLCLWFKGIPGLKLQGFSLLLVFLATPTALPYLITPYTFPLQSFIAGTAAFI
FT                   LNQFGMKVMVDGINLYVGARIVEVAPYCAGLKMLFTTVYVGLMLLYWTDALSSRRITFT
FT                   FLSIAMVISITANIIRNTLLTLFHGTGQEGAFAWLHEGWGGDLYSACMLLLLIPLLNYL
FT                   NDYFSEAPAMPLIEEQKDVYTRVYYIDT"
FT   gene            873809..874531
FT                   /locus_tag="Aazo_0826"
FT   CDS_pept        873809..874531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0826"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F0457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0826"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63249"
FT                   /db_xref="InterPro:IPR030917"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1M2"
FT                   /inference="similar to AA sequence:KEGG:Npun_F0457"
FT                   /protein_id="ADI63249.1"
FT                   /translation="MISLSKIFQEKQWSQVAVLILLLLLLTVGAVPGYLTGKWAWQQPP
FT                   PVNKLQELKNIRKVGLNIPGWQTVQQSESQIGEHQWSLQILKQQYPANEAILLLLPQNG
FT                   PRDQPEVEWIDISGWGKSTWGKWDVAQYRTAEFTFKQPSTQQLNTTIKVKSRFFRATTQ
FT                   KQTFAVLQWYAMPNGGTSSLVDWFLSDQLAQWQKKRVPWVAVSILMPMESFGEAETSCS
FT                   KLQSLGEKVQSELMSIAL"
FT   gene            874559..875929
FT                   /locus_tag="Aazo_0827"
FT   CDS_pept        874559..875929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0827"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; Soluble ligand
FT                   binding domain; KEGG: npu:Npun_F0458 polysaccharide export
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0827"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63250"
FT                   /db_xref="GOA:D7E1M3"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1M3"
FT                   /inference="protein motif:PFAM:PF02563"
FT                   /protein_id="ADI63250.1"
FT                   /translation="MFIEPSSHKCAFNALFFVTLHVSVGLITSIQPILAQPSPSVEPSS
FT                   VEFTTPAATSEEISPSTKEESSPQFNRYFLDTGDTLNVIVQRPPGLYRLGIGDSISVSV
FT                   QRFPDLSFQAAINPEGNIVVPLLGVISLQGLSLKEAEAKIRSGLNRYVIDPIVLLSLSG
FT                   ERPNLSFSAPIGQDGNIIIPQVGKLFVKGLSLEEVQENIRLALSRITTDTVVTSLSQIR
FT                   PVQVTITGEVSRPGIYAAGVVIPRITDILPLAGGSTVTADLRQVQIRRKLSDGSTVSQN
FT                   VDLYASLQSGGSPPNLRLQDGDAIIIPRREVGTDDGYDRKLVARSTLAVPQIKVRILNY
FT                   AAGGIVTQSLPNGSTFIDVLGGVNLNTANLRDIALVRFDPEKGKAVTQRLDGKKALAGD
FT                   ASQNLALQDNDVILVGRNLIGKLQNLFTTITQPFFNVQSFLQFFQTFGNGFLGGGSN"
FT   gene            875998..878178
FT                   /locus_tag="Aazo_0828"
FT   CDS_pept        875998..878178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0828"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="KEGG: npu:Npun_F0459 lipopolysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0828"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63251"
FT                   /db_xref="GOA:D7E1M4"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1M4"
FT                   /inference="similar to AA sequence:KEGG:Npun_F0459"
FT                   /protein_id="ADI63251.1"
FT                   /translation="MTPRIVKKYIIAFEKYKWIGLASFGLVVAGTIVVAIQPEPPVTYL
FT                   IEAAVSYTGPPVSFSKTASEIQEQGKELTQEVLLSDQIVLKVADKVKVKPKTIATNVKL
FT                   KMPEKTKSGALESPLIIVYYTDIDVNRGVDVLTELTKLMVQLSGDINTGRLKTIIKKIN
FT                   ELLPQAKKELQAAENKLEEYDRRERPALVEAENGSLLGGISNSKIQQREIKFTIAGLDA
FT                   QLRSLEKKLGLTVRQAYISSALSADTIIANLRSQIYQVESQIAVIRRDLRPEHPTMIQL
FT                   QRQKGAAEELLQQRVDEVLGGGGMAAPIRGNLTGIRTQSSLDLTRQALANQMVALQTQR
FT                   ETLEQQLKQQIQQEEELRRESALIPNKQLERSRLEQAVGFKKAIYDQMQAKLTDAKAAE
FT                   AETVTSLSLTKPPTPLPVVAKPKSVPATLAIGALLGAVIGGGVIFLLGSLEGTFKTRED
FT                   IRESLKQRDVLLLGELPLISVDDLPPEALPVILSSHSPYLEFYEKFRSNLRRIGGKDAK
FT                   VILITSVSSQEGKTLSAYNLGIASARAGKRTLIIETDLRSPSRASSLNVASYATLEPLL
FT                   YYSSLSDCIRLVPEIENLYIIPSAGPALQSAAIIESSEMVRVIEDARQRYDLVILDTND
FT                   LSTSNDALLMQPYSDGIVLVARPNYTQENMLTEAIDQLVEGELGLLGAIINAADIRVSI
FT                   PQPAEELPTSIPDLNLEAIRQTEDISTIFGKN"
FT   gene            complement(878159..879136)
FT                   /locus_tag="Aazo_0829"
FT   CDS_pept        complement(878159..879136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0829"
FT                   /product="7,8-didemethyl-8-hydroxy-5-deazariboflavin
FT                   synthase, CofG subunit"
FT                   /note="TIGRFAM: 7,8-didemethyl-8-hydroxy-5-deazariboflavin
FT                   synthase, CofG subunit; PFAM: Radical SAM domain protein;
FT                   KEGG: npu:Npun_F4799 radical SAM domain-containing protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0829"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63252"
FT                   /db_xref="GOA:D7E1M5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019939"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1M5"
FT                   /inference="protein motif:TFAM:TIGR03550"
FT                   /protein_id="ADI63252.1"
FT                   /translation="MSPSTQNIVTYSPAYTLVPTYECFNRCTYCNFRTDPGKSPWLTIA
FT                   DSKSILQQLQSQNICEILILSGEVHPLSSRREDWFKLIYDLCALALSMGFLPHTNAGPL
FT                   SFTEMQKLKNVNVSMGLMLEQLTPKLLNTVHRHAPSKLPQLRLQQLQWAGELQIPFTTG
FT                   LLLGIGETEEDWWEGLAAISDLHHRYQHIQEVILQPHSPGSQQTFDAEAFNPLQLPEVI
FT                   AKAREILPADITIQIPPNLVKDEGWLLACLDAGARDLGAISPKDEVNPDYPHLQEQRLR
FT                   EILQPAGWELIPRLPVYNQFNGWLVGELAAALRTPLEDANFYRK"
FT   gene            879395..880477
FT                   /locus_tag="Aazo_0830"
FT   CDS_pept        879395..880477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0830"
FT                   /product="photosystem q(b) protein"
FT                   /note="KEGG: npu:Npun_R5455 photosystem q(b) protein;
FT                   TIGRFAM: photosystem q(b) protein; PFAM: photosynthetic
FT                   reaction centre protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0830"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63253"
FT                   /db_xref="GOA:D7E1M6"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1M6"
FT                   /inference="protein motif:TFAM:TIGR01151"
FT                   /protein_id="ADI63253.1"
FT                   /translation="MTTTIQQRQGANIWDRFCEWITSTENRIYIGWFGVLMIPTLVSAI
FT                   ACFVIAFIAAPPVDIDGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDE
FT                   WLYNGGPYQLVIFHFLIGVACYLGREWELSYRLGMRPWICVAFSAPVAAATAVFLIYPI
FT                   GQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSS
FT                   LVRETTETESQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVI
FT                   GIWFTALGVSTMAFNLNGFNFNQSIIDSQGRVIGTWADVINRANLGMEVMHERNAHNFP
FT                   LDLAAGDVAPVALTAPPING"
FT   gene            complement(880692..880976)
FT                   /pseudo
FT                   /locus_tag="Aazo_0831"
FT                   /product="hypothetical protein"
FT   gene            881381..884135
FT                   /pseudo
FT                   /locus_tag="Aazo_0832"
FT                   /product="hypothetical protein"
FT   gene            881700..882803
FT                   /pseudo
FT                   /locus_tag="Aazo_0833"
FT                   /product="hypothetical protein"
FT   gene            884433..884630
FT                   /locus_tag="Aazo_0834"
FT   CDS_pept        884433..884630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0834"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100240784"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0834"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63254"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1M7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63254.1"
FT                   /translation="MQLDKQRLEKGHTELIDMVRWLLNSGYQPASKNLEQAIRILAECS
FT                   RINKIRAKYLYEIDIDSPFT"
FT   gene            885136..886224
FT                   /locus_tag="Aazo_0835"
FT   CDS_pept        885136..886224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0835"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="TIGRFAM: chorismate synthase; KEGG: ava:Ava_0589
FT                   chorismate synthase; PFAM: chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0835"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63255"
FT                   /db_xref="GOA:D7E1M8"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1M8"
FT                   /inference="protein motif:TFAM:TIGR00033"
FT                   /protein_id="ADI63255.1"
FT                   /translation="MGSTFGHLFRITTFGESHGGGVGVIIDGCPPGLEISAEEIQFELD
FT                   RRRPGQSKITTPRKEADTCEILSGVFEGKTLGTPIAIFVKNKDTRAQDYDEMAQKYRPS
FT                   HADATYDAKYGFRNWQGGGRSSARETIGRVAAGAIAKKVLHQVADVVVIAYVKRIKDLE
FT                   GVVDTNTVTLEDVESNIVRCPDGEIANQMIELIEKTGRDGNSIGGVVECVVRNVPKGLG
FT                   EPVFDKLEADLGKAVMSLPASKGFEIGSGFDGTLLTGFEHNDEFYIDENGEIRTVTNRS
FT                   GGIQGGISNGENIILRVAFKPTATIRKQQKTVTKEGEETVLAGKGRHDPCVLPRAVPMV
FT                   DAMVALVLCDHLLRHYGQCKVL"
FT   gene            886743..887549
FT                   /locus_tag="Aazo_0836"
FT   CDS_pept        886743..887549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0836"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   ava:Ava_3887 ADP-ribosylation/crystallin J1"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0836"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63256"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1M9"
FT                   /inference="protein motif:PFAM:PF03747"
FT                   /protein_id="ADI63256.1"
FT                   /translation="MLGAIAGDIIGSIYEFYNIKTKDFPLFDDRCHFTDDTILTLAVAE
FT                   VILNADEFPDKTKYIDKLQYIQQFKSYYGEYPSAGYGSTFIKWANSGSTEPYNSWGNGS
FT                   AMRVSPIASAFDDLNIVLEEARHSAEVTHSHPEGIKGAQATAASIFLARTGYDKTAIKF
FT                   YIQNCFGYNLEQTLDEIRPTYKFDVSCQGSVPQAIIAFLESTDFEDAIRNAISIGGDSD
FT                   TIACITGSIAEAFYGGVPEHIAEWIFTTLDDRLWTITDKFMSQYYA"
FT   gene            887878..888243
FT                   /locus_tag="Aazo_0837"
FT   CDS_pept        887878..888243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0837"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all0746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0837"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63257"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1N0"
FT                   /inference="similar to AA sequence:KEGG:all0746"
FT                   /protein_id="ADI63257.1"
FT                   /translation="MQYNNIFITIATVNFDNLVNFYIQLLEQEPKNLIPDVYAEFQISS
FT                   LCLGIFKPKQNYESEFAVNTKSSLSLCLEVDNLESAIAHLQSLGYPLPGDISTASHGRE
FT                   IYTYDPDGNRLILHQSH"
FT   gene            888363..889244
FT                   /locus_tag="Aazo_0838"
FT   CDS_pept        888363..889244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0838"
FT                   /product="ribosome biogenesis GTP-binding protein YlqF"
FT                   /note="KEGG: ava:Ava_4647 ribosomal biogenesis GTPase;
FT                   TIGRFAM: ribosome biogenesis GTP-binding protein YlqF;
FT                   PFAM: GTP-binding protein HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0838"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63258"
FT                   /db_xref="GOA:D7E1N1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1N1"
FT                   /inference="protein motif:TFAM:TIGR03596"
FT                   /protein_id="ADI63258.1"
FT                   /translation="MSITQNYKLNLIQWYPGHIAKAEKNLKEQLKRVDVVLEVRDARIP
FT                   LATNHPQMNEWVGGKSRVLVINRLDMISPQVRSLWVDWFKSQEQVPYFTNAQHGQGITA
FT                   ITKAAQAAGVELNQRRKDRGMLPRPVRAVVIGFPNVGKSALINRLLGKRVVESAARPGV
FT                   TRQLRWVRISDQLQLLDAPGVIPSRMENQAAAVKLAICDDIGEASYDNQLVAAAFIDIL
FT                   NELQETHPHLLPSHPLLSRYEVDSIIHTGEAYLHILAEHRYKRDVERAARTLITDFRKG
FT                   LLGTIPLEIPPH"
FT   gene            889816..891183
FT                   /locus_tag="Aazo_0839"
FT   CDS_pept        889816..891183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0839"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: npu:Npun_R4631
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0839"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63259"
FT                   /db_xref="GOA:D7E1N2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1N2"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADI63259.1"
FT                   /translation="MAIATINPATGKTLKTFDPLNNGEIAAKLDLAQWAFEEYRRTSFP
FT                   ERSQWLQQAANILEQEKADFAKLMTLEMGKTLKSAIAEVEKCALVCRYYAKNGPNFLAD
FT                   LTVKTDASQSFVRYQPLGVILAVMPWNFPFWQVFRFAAPALMAGNVGLLKHASNVPQCA
FT                   LGIEDIINRAGFPVGVFQTLLIGASQVADLMADHRVKAATLTGSEPAGASLAVAAGKQI
FT                   KKTVLELGGSDPFIVLESADLETTVSTAVRARILNNGQSCIAAKRFILAEIIADKFEKL
FT                   LLEKFHTLKIGDPLATETDIGPLATPDILQDLDQKVKIAIESGGKVLTGGSALSDIPGN
FT                   FYPPTIIIDIPLDHPIAKEEFFGPVALLFRVADIDAAIKLANDIPFGLGASAWTNNETE
FT                   KNRLIQEIEAGAVFINSMVKSDPRLPFGGIKRSGYGRELSIQGIHEFVNVKTVWVQ"
FT   gene            891246..892889
FT                   /locus_tag="Aazo_0840"
FT   CDS_pept        891246..892889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0840"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein TPP binding
FT                   domain protein; thiamine pyrophosphate protein central
FT                   region; KEGG: ava:Ava_3533 acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0840"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63260"
FT                   /db_xref="GOA:D7E1N3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1N3"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ADI63260.1"
FT                   /translation="MNTADLLVQCLENEGVQYVFGLPGEENLHVLEALKNSSIQFITTR
FT                   HEQGAAFMADVYGRLTGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDRM
FT                   HIESHQYLDLVAMFAPVTKWNKQIVRPSITPEVVRKAFKRSQTEKPGAVHIDLPENIAA
FT                   MPVEGKPLHKDNSEKTYAAFASIRAAAAIISQAVNPIILVGNGAIRAQASDAVTQFTTQ
FT                   INIPVVNTFMGKGVIPYTHPLALYSVGLQQRDFITCGFDNTDLVIAIGYDLIEFSPKEW
FT                   NPDGKIPIIHIAAISAEIDSSYIPKVEVIGDISDSVNEILKLADRQGKPNPYAISLRSN
FT                   IRADYEQYAHDDGFPIKPQRLIYDLRQVMGPDDIVISDVGAHKMWIARHYHCHSPNTCI
FT                   ISNGFAAMGIAIPGALAAKLVYPDRKVVAATGDGGFMMNCQELETALRVGTPFVTLIFN
FT                   DGGYGLIEWKQENQFGKGNSCFVHFGNPNFVKLAESIGLKGYRVESATDLIPVVKEALI
FT                   QDVPAVIDCPVDYRENRRFSQKAGELNCDI"
FT   gene            complement(892954..893796)
FT                   /locus_tag="Aazo_0841"
FT   CDS_pept        complement(892954..893796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0841"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: ava:Ava_1599 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0841"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63261"
FT                   /db_xref="GOA:D7E1N4"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1N4"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ADI63261.1"
FT                   /translation="MLNTLIEPLQYGFMQRSLIIAILVGLLCAVVGSYLMVQRLALLGD
FT                   AISHSVLPGLAIAFMIGANIFAGAFIAGILSTMAIAFIKTRSPIKEDAAMGIVFSAFFA
FT                   LGVTLITVIQKSNKIDLNHFLFGNILSVTVDEVRDTSIIATIVLIVVVALYKELLFYTF
FT                   DPLGAQAAGLPVNRLNFGLMLLIALTIVASMKAVGVILVLSLLITPGATAYLLVKRLHE
FT                   VMILGAVIGVISSISGMYLSYFYNLPSGPAIVLVVSGLFILALLFCLVLDMEFLRPIR"
FT   gene            complement(893873..894694)
FT                   /locus_tag="Aazo_0842"
FT   CDS_pept        complement(893873..894694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0842"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ana:all3575 ATP-binding protein of ABC
FT                   transporter; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0842"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63262"
FT                   /db_xref="GOA:D7E1N5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1N5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI63262.1"
FT                   /translation="MQNISFYEKFSPLRIQVEETPTQARKSTDMNSTAAINISHLGVHY
FT                   RTQKALGDVNCIIKSGKVTGIFGPNGAGKSTLMKAILGLVPISSGQVLYKNQPLMQQLD
FT                   QVAYVPQRSQIDWNYPATVWDVVMMGRVRKTGWLRSFSTVSRQVVKEALERVGMKELQN
FT                   RPIGELSGGQQQRVFLARALTQQAEIFCFDEPFLGIDQKTQTIIFEIFHELAAENKTLL
FT                   VVNHDLGQSTAHFDDLILLNCELIATGSRQEVLTEENLHRAYNGKVMYFAA"
FT   gene            894784..895818
FT                   /locus_tag="Aazo_0843"
FT   CDS_pept        894784..895818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0843"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   ana:alr3576 adhesin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0843"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63263"
FT                   /db_xref="GOA:D7E1N6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1N6"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ADI63263.1"
FT                   /translation="MKQILGIKGNTVLKKTKISQLCLGMLLPLALFSCNPSDSQAPGNG
FT                   KRHVVATSTIIADLAQEVAGEEVKVTGILKPGADPHVYEPVPADSRVLETADLILYNGY
FT                   KLEPGIIKLMNAVGGKARKLAVGEVIKPLKLQKSKGEIVPDPHIWGSVENVISMVKAIK
FT                   EALIELSPEDKDKFTQKAAELTEELQQFNNWITQQIQTIPPEKRKLITTHDAFQYYGSN
FT                   YGMEIAGTLIGISTEEQPSAQTVSKLVDSVKKIGVPAIFAETTINPALITTVAQEVGVK
FT                   LVKNQLYSDSIGAKGSDGDTYIKMMEANTRTIVEALGGKYTPFVLKGASGFGRKTQIGG
FT                   KPLR"
FT   gene            complement(895791..896858)
FT                   /pseudo
FT                   /locus_tag="Aazo_0844"
FT                   /product="hypothetical protein"
FT   gene            897261..897608
FT                   /locus_tag="Aazo_0845"
FT   CDS_pept        897261..897608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0845"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0845"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63264"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1N7"
FT                   /inference="similar to AA sequence:KEGG:Ava_1602"
FT                   /protein_id="ADI63264.1"
FT                   /translation="MTNNQDNQDNQDNQINQPVSEDSFSRKEPNVKERNLTANPGDRIS
FT                   AKPQSIEEKAQQVAVDVPDITGDHIKVPTYFVVETPDGEKKALHHVKDAEEISDMIRQA
FT                   RVDEEENRIWW"
FT   gene            complement(897805..899418)
FT                   /locus_tag="Aazo_0846"
FT   CDS_pept        complement(897805..899418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0846"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   ava:Ava_3962 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0846"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63265"
FT                   /db_xref="GOA:D7E1N8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1N8"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADI63265.1"
FT                   /translation="MRLKFLAIAVSMGVTVISVQKTTARTPLLPYLQTPSNLSNSTGNQ
FT                   TVSEWIYLDGRPLFQIAASKNDVSERLQSIQQNLQEISQDYFQSKAPEFKIQIRTTKDL
FT                   PVIYINGKYLMTINSQDAKLRQLKALTLANEIADNLQDNLEVSKKERQTSSLISQCKIA
FT                   GAIALVMILSSSLIYRYQRRSQKDDVEPICPDAETGQPITTQLNQQEHQHLAEVKNRLF
FT                   QLSQTGIWGGGSFVILGLFPYTRALQMALLAVAQIPLKVGIVVLGTYVAVRFSYALIDK
FT                   FTTTLISGGFLLNSETSERMELRVSTFSGVTKSITTLICMGVGILSILISLGIDIVPLL
FT                   AGAGLIGVAVSLASQNLIKDAINGFLIIIEDQYALGDVINVGNVGGLVENLNLRMTQVR
FT                   DAEGRLITIPNSEIKVVANLSSRWSRADLTIPVSYQANIDEALKLIEDVALNMNQEPKW
FT                   KREIIEKPSILGIDNFSERGMMIRVWIKTQPLKQWEVAREYRRRLKIALDQVGISIPIP
FT                   QQTILVNHPQLLNSARNNSD"
FT   gene            899903..901180
FT                   /locus_tag="Aazo_0847"
FT   CDS_pept        899903..901180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0847"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="TIGRFAM: adenosylhomocysteinase; KEGG: ana:alr1414
FT                   S-adenosyl-L-homocysteine hydrolase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding;
FT                   S-adenosyl-L-homocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0847"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63266"
FT                   /db_xref="GOA:D7E1N9"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1N9"
FT                   /inference="protein motif:TFAM:TIGR00936"
FT                   /protein_id="ADI63266.1"
FT                   /translation="MTATTPRLKHEVKDLALAALGRQRIEWAGREMPVLKQIRDHFEKE
FT                   KPFAGLRLVACAHVTTETAHLAIALKAGGADAVLIASNPLSTQDDVAASLVADHEIPVF
FT                   AQKGEDSATYNRHVQIALDHRPNIIVDDGSDVVAELVQHRQHQIADLIGSTEETTTGIV
FT                   RLRAMFKEGVLTFPAVNVNDADTKHFFDNRYGTGQSTLDGIIRATNILLAGKTVVVVGY
FT                   GWCGKGTALRARGMGANVIVTEIDHIKAIEAVMDGFRVLPMAEAAPLGDIFITVTGNKH
FT                   VVRGEHFDVMKDGAIVCNSGHFDLELDLKYLAANAKEIKDVRPFTEEYKLTNGKSVVVL
FT                   GQGRLINLAAAEGHPSAVMDMSFANQALACEYLVKNKGKLAPGLHSIPREVDEEIARLK
FT                   LQAMGIFIDSLTADQIEYINSWTSGT"
FT   gene            complement(901926..902544)
FT                   /pseudo
FT                   /locus_tag="Aazo_0848"
FT                   /product="hypothetical protein"
FT   gene            902731..904414
FT                   /pseudo
FT                   /locus_tag="Aazo_0849"
FT                   /product="hypothetical protein"
FT   gene            904530..904853
FT                   /locus_tag="Aazo_0850"
FT   CDS_pept        904530..904853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0850"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hha:Hhal_0251 C4-dicarboxylate
FT                   transporter/malic acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0850"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63267"
FT                   /db_xref="GOA:D7E1P0"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1P0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63267.1"
FT                   /translation="MIYLLNIFIYLLTPLGGVLSYCSLLRIAFDPIFGALLFLQCLFSL
FT                   HLFVFMLPWIFSLRNFPLWQFRVRNVGYIRVFVGGIGSGGISSKVTFSSPHFALHFVVH
FT                   IQM"
FT   gene            905027..906700
FT                   /pseudo
FT                   /locus_tag="Aazo_0851"
FT                   /product="hypothetical protein"
FT   gene            906921..907163
FT                   /locus_tag="Aazo_0852"
FT   CDS_pept        906921..907163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0852"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0852"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63268"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1P1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63268.1"
FT                   /translation="MWDEGCPAKSLSKNCDLPPPVCTGGCNKKQTDEIFEHENINQENF
FT                   YSNIDEMNWIEEEIPEFHINEPECYEVQDESFLKI"
FT   gene            907330..907557
FT                   /locus_tag="Aazo_0853"
FT   CDS_pept        907330..907557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0853"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctt:CtCNB1_0113 O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0853"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63269"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1P2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63269.1"
FT                   /translation="MWQIANYGVLERPFFGWGSNGYGVAYAHIYCRVTSGKLTRLGHLN
FT                   SDYLDKKGQMQTLLLPTTKAQNLILIHPYL"
FT   gene            complement(907823..910154)
FT                   /pseudo
FT                   /locus_tag="Aazo_0854"
FT                   /product="hypothetical protein"
FT   gene            complement(910437..911306)
FT                   /locus_tag="Aazo_0855"
FT   CDS_pept        complement(910437..911306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0855"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R1831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0855"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63270"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1P3"
FT                   /inference="similar to AA sequence:KEGG:Npun_R1831"
FT                   /protein_id="ADI63270.1"
FT                   /translation="MGGQPLTFQLGEIPTVQERFQAVLKRRLQVEIQNHPPLFPWESQL
FT                   IDYPEFVEEPSIALVPAWGWLAQQSKLNLPVSLPDKIFQQLMEKCQLLLTSSLPLGPKL
FT                   VQAVESLFPEDYQLINDLAGLVLRTSYRSVDALETIPNIQSDYSDLQPRQQMALSLIAA
FT                   KQLLENLTLPISFTNPVIEKQWQTNAGTLSIRVELQALGQKTKLCVHGELPTSGVLKLH
FT                   GNSTQVIGSTSAGGNAPGTGEVVAESANLANPSVELFCERANKTYTLEVECPEIEEQPL
FT                   FLAINLMM"
FT   gene            complement(911456..912646)
FT                   /locus_tag="Aazo_0856"
FT   CDS_pept        complement(911456..912646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0856"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_R1832 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0856"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63271"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1P4"
FT                   /inference="similar to AA sequence:KEGG:Npun_R1832"
FT                   /protein_id="ADI63271.1"
FT                   /translation="MNSAATATTQGDKSIGVEVIFQFLLKELQQSTKATHKNCRDVALR
FT                   ITGEVLRICNESKRIQASGDIESSAMTLARHRLQQCLRYYQLGSNRSRVELHSTLSAII
FT                   YRYINPPQKQLSYQGRLTIIEDFLQNFYLEALNAFRRENQQEPTYRPQTLLELAEYMAF
FT                   TERYGKRRIPLPGRQQQLIILRAQTFSQQQPPETSVDIEQAAEGSGNETDSFWEEPAVQ
FT                   QLRSAMAMQAEAEPEEDTLRSVVVTELMNYLEQRQQSDCADYFSLRLQDLSAQEIESVL
FT                   GLTPRQRDYLQQRFKYHLIRFALLHRWELVHEWLEVSLPTNLGLTPHQWQVYTGKLDDK
FT                   QRSLLDLKQQGQSDEAIAKTLGLSMAQLQKRWFKILEQAWEIRNSFVSGSGASTHE"
FT   gene            912818..913294
FT                   /locus_tag="Aazo_0857"
FT   CDS_pept        912818..913294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0857"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F1833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0857"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63272"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1P5"
FT                   /inference="similar to AA sequence:KEGG:Npun_F1833"
FT                   /protein_id="ADI63272.1"
FT                   /translation="MTDLEAQIQLLIDNAPHDGKTPELVATIAPALRAIAQKLRHSQYY
FT                   ILQNLQERWILTTLSNKENPKLEKHVVYAFPRLQDISLSSSAGLNPQVAGKAIPVINIL
FT                   FQLVALEPVDSIVFFETPGRTSNPIEVQRTELKNLIQQCLQPQKPNQQVPPNLA"
FT   gene            complement(913365..914336)
FT                   /locus_tag="Aazo_0858"
FT   CDS_pept        complement(913365..914336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0858"
FT                   /product="solanesyl diphosphate synthase"
FT                   /EC_number="2.5.1.30"
FT                   /note="TIGRFAM: solanesyl diphosphate synthase; KEGG:
FT                   npu:Npun_R1834 polyprenyl synthetase; PFAM: Polyprenyl
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0858"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63273"
FT                   /db_xref="GOA:D7E1P6"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1P6"
FT                   /inference="protein motif:TFAM:TIGR02749"
FT                   /protein_id="ADI63273.1"
FT                   /translation="MTPATSLFTPVEADLRILADNLTQLVGNRHPILYAAAEHLFGAGG
FT                   KRIRPAIVLLISRATMLEKDITPRHRRLAEITEMIHTASLVHDDVVDESNVRRGVPTVH
FT                   SLFGNRIAVLAGDFLFAQSSWYLANLDNLDVVKLLSEVIMDLAAGEIQQGLNRFDTNLS
FT                   TETYLKKSYYKTASLIANSSKAAGLLSEVSQKSAENLYNYGKHLGLAFQIVDDILDFTG
FT                   STDTLGKPAGSDLKSGNLTAPVLFALKEQPYLEVLIERELAQEGDLEQAVGLILDSQGI
FT                   QKARELAAHHAKASGEQIATLEPSESRQALINMTDYVLSRLY"
FT   gene            915335..915532
FT                   /locus_tag="Aazo_0859"
FT   CDS_pept        915335..915532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0859"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asl0095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0859"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63274"
FT                   /db_xref="GOA:D7E1P7"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1P7"
FT                   /inference="similar to AA sequence:KEGG:asl0095"
FT                   /protein_id="ADI63274.1"
FT                   /translation="MIYGNMPMMIFILASGYLFTVYLLLALAKRTGRNNVIKSRNCVIQ
FT                   EQHKQERGLRTKVTEVANSQ"
FT   gene            complement(915579..916433)
FT                   /locus_tag="Aazo_0860"
FT   CDS_pept        complement(915579..916433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0860"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="TIGRFAM: glutamate racemase; KEGG: npu:Npun_F1847
FT                   glutamate racemase; PFAM: Asp/Glu/hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0860"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63275"
FT                   /db_xref="GOA:D7E1P8"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1P8"
FT                   /inference="protein motif:TFAM:TIGR00067"
FT                   /protein_id="ADI63275.1"
FT                   /translation="MYSSSIFEGNFDDFSDQNSQPAIGVFDSGVGGLTVLRQIYKQLPN
FT                   ESIIYFGDTAHLPYGIRSQAEILQYVREILKWMQQQRVKMVIMACNTSSALALENVRQE
FT                   FDFPILGVVLPGARAAVQQGKRIGVIATPATAKSNAYRQAIMEIQPDVQVWQVSCPEFV
FT                   PLIEQNRIHDPYTTEVAKSYLEPLIKQEIDTLVYGCTHYPHLAPVLGALLPSYVKLVDP
FT                   SVHVVAACAQELDLLSIRNTRLPMPTRFAVSGCPQQFAQSGLQWLGYTPLVEQVYLTDA
FT                   TVS"
FT   gene            complement(916581..918476)
FT                   /locus_tag="Aazo_0861"
FT   CDS_pept        complement(916581..918476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0861"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   ana:alr0093 N-acetylmuramoyl-L-alanine amidase; SMART: cell
FT                   wall hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0861"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63276"
FT                   /db_xref="GOA:D7E1P9"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1P9"
FT                   /inference="protein motif:PRIAM:3.5.1.28"
FT                   /protein_id="ADI63276.1"
FT                   /translation="MKLHWLIPSSVGTIFMLSSPAMAARLESWRFDTNKNRLEINTSSP
FT                   VQPQAQLIFNPTRLVIDLPGTTFGRPQLTQQVGGAIRALRIGQFDEQTTRLVVELVPRY
FT                   TLDPNLVKFTANTGSRWLVELPQIIAQALRSSGNVGEQATETPAFIPPQSPFTPAATTS
FT                   NTYNMVTTSPVTLPNQEVAISPTGRVTQIENLQVTGDGFFIRISGGKPQIQVNRSPDNR
FT                   TINLEITGAALSSNLRQRDLLINRYGVRRIQFTQVSSRTPTVRITLQVDSNSADWRAIS
FT                   SGNDGFVVLPNRFTRLPDSQPSTQILSNSPATIQAVELAANGTQLLIKANQSVSATGGW
FT                   DRSSGLFRIIIPNAKLASRVQGPAFDANSPVLRVRFQPQVPNNVVVLVQPASGVQIGEL
FT                   NQVGEQILALQLQNSRRLQPPITLSPLPGTRGQLPSIEENPQPPQQPRLSVPRGKLIVV
FT                   IDPGHGGKDSGAPGIGGLLEKDVILPIGRRVAAILERNGVQAVMTRDADFFVELQGRVD
FT                   IAKRVNAILFVSIHANSVDSRPDVNGLEVYYYDSGYDLAEVVRKTILQDISTIKDRGTR
FT                   KARFYVLRKNTMPAILVETGYMTGREDNPRLGSPEYQSRMADAIARGILQYLRQR"
FT   gene            complement(918797..920656)
FT                   /locus_tag="Aazo_0862"
FT   CDS_pept        complement(918797..920656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0862"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   ava:Ava_1465 cell wall hydrolase/autolysin; SMART: cell
FT                   wall hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0862"
FT                   /db_xref="Ensemb