(data stored in ACNUC10043 zone)

EMBL: CP002069

ID   CP002069; SV 1; circular; genomic DNA; STD; PRO; 2242317 BP.
XX
AC   CP002069;
XX
PR   Project:PRJNA37945;
XX
DT   16-JUN-2010 (Rel. 105, Created)
DT   23-JUN-2016 (Rel. 129, Last updated, Version 5)
XX
DE   Methanohalobium evestigatum Z-7303, complete genome.
XX
KW   .
XX
OS   Methanohalobium evestigatum Z-7303
OC   Archaea; Euryarchaeota; Stenosarchaea group; Methanomicrobia;
OC   Methanosarcinales; Methanosarcinaceae; Methanohalobium.
XX
RN   [1]
RP   1-2242317
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Saunders E., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Kyrpides N., Mikhailova N., Sieprawska-Lupa M., Whitman W.B., Anderson I.,
RA   Woyke T.;
RT   "Complete sequence chromosome of Methanohalobium evestigatum Z-7303";
RL   Unpublished.
XX
RN   [2]
RP   1-2242317
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Saunders E., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Kyrpides N., Mikhailova N., Sieprawska-Lupa M., Whitman W.B., Anderson I.,
RA   Woyke T.;
RT   ;
RL   Submitted (09-JUN-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 5d883dac03adbe678217d290d805aed8.
DR   BioSample; SAMN00015125.
DR   EnsemblGenomes-Gn; EBG00001052510.
DR   EnsemblGenomes-Gn; EBG00001052511.
DR   EnsemblGenomes-Gn; EBG00001052512.
DR   EnsemblGenomes-Gn; EBG00001052513.
DR   EnsemblGenomes-Gn; EBG00001052514.
DR   EnsemblGenomes-Gn; EBG00001052515.
DR   EnsemblGenomes-Gn; EBG00001052516.
DR   EnsemblGenomes-Gn; EBG00001052517.
DR   EnsemblGenomes-Gn; EBG00001052518.
DR   EnsemblGenomes-Gn; EBG00001052519.
DR   EnsemblGenomes-Gn; EBG00001052520.
DR   EnsemblGenomes-Gn; EBG00001052521.
DR   EnsemblGenomes-Gn; EBG00001052522.
DR   EnsemblGenomes-Gn; EBG00001052523.
DR   EnsemblGenomes-Gn; EBG00001052524.
DR   EnsemblGenomes-Gn; EBG00001052525.
DR   EnsemblGenomes-Gn; EBG00001052526.
DR   EnsemblGenomes-Gn; EBG00001052527.
DR   EnsemblGenomes-Gn; EBG00001052528.
DR   EnsemblGenomes-Gn; EBG00001052529.
DR   EnsemblGenomes-Gn; EBG00001052531.
DR   EnsemblGenomes-Gn; EBG00001052532.
DR   EnsemblGenomes-Gn; EBG00001052533.
DR   EnsemblGenomes-Gn; EBG00001052534.
DR   EnsemblGenomes-Gn; EBG00001052535.
DR   EnsemblGenomes-Gn; EBG00001052536.
DR   EnsemblGenomes-Gn; EBG00001052537.
DR   EnsemblGenomes-Gn; EBG00001052538.
DR   EnsemblGenomes-Gn; EBG00001052539.
DR   EnsemblGenomes-Gn; EBG00001052540.
DR   EnsemblGenomes-Gn; EBG00001052541.
DR   EnsemblGenomes-Gn; EBG00001052542.
DR   EnsemblGenomes-Gn; EBG00001052543.
DR   EnsemblGenomes-Gn; EBG00001052544.
DR   EnsemblGenomes-Gn; EBG00001052545.
DR   EnsemblGenomes-Gn; EBG00001052546.
DR   EnsemblGenomes-Gn; EBG00001052547.
DR   EnsemblGenomes-Gn; EBG00001052548.
DR   EnsemblGenomes-Gn; EBG00001052549.
DR   EnsemblGenomes-Gn; EBG00001052550.
DR   EnsemblGenomes-Gn; EBG00001052551.
DR   EnsemblGenomes-Gn; EBG00001052553.
DR   EnsemblGenomes-Gn; EBG00001052554.
DR   EnsemblGenomes-Gn; EBG00001052555.
DR   EnsemblGenomes-Gn; EBG00001052556.
DR   EnsemblGenomes-Gn; EBG00001052557.
DR   EnsemblGenomes-Gn; EBG00001052558.
DR   EnsemblGenomes-Gn; EBG00001052559.
DR   EnsemblGenomes-Gn; EBG00001052560.
DR   EnsemblGenomes-Gn; EBG00001052561.
DR   EnsemblGenomes-Gn; EBG00001052562.
DR   EnsemblGenomes-Gn; EBG00001052563.
DR   EnsemblGenomes-Gn; EBG00001052564.
DR   EnsemblGenomes-Gn; EBG00001052565.
DR   EnsemblGenomes-Gn; EBG00001052566.
DR   EnsemblGenomes-Gn; EBG00001052567.
DR   EnsemblGenomes-Gn; EBG00001052568.
DR   EnsemblGenomes-Gn; EBG00001052569.
DR   EnsemblGenomes-Gn; EBG00001052570.
DR   EnsemblGenomes-Gn; EBG00001052571.
DR   EnsemblGenomes-Gn; EBG00001052572.
DR   EnsemblGenomes-Gn; EBG00001052573.
DR   EnsemblGenomes-Gn; EBG00001052574.
DR   EnsemblGenomes-Gn; EBG00001052575.
DR   EnsemblGenomes-Gn; EBG00001052576.
DR   EnsemblGenomes-Gn; EBG00001052577.
DR   EnsemblGenomes-Gn; EBG00001052578.
DR   EnsemblGenomes-Gn; Metev_R0001.
DR   EnsemblGenomes-Gn; Metev_R0002.
DR   EnsemblGenomes-Gn; Metev_R0003.
DR   EnsemblGenomes-Gn; Metev_R0004.
DR   EnsemblGenomes-Gn; Metev_R0005.
DR   EnsemblGenomes-Gn; Metev_R0006.
DR   EnsemblGenomes-Gn; Metev_R0007.
DR   EnsemblGenomes-Gn; Metev_R0008.
DR   EnsemblGenomes-Gn; Metev_R0009.
DR   EnsemblGenomes-Gn; Metev_R0010.
DR   EnsemblGenomes-Gn; Metev_R0011.
DR   EnsemblGenomes-Gn; Metev_R0012.
DR   EnsemblGenomes-Gn; Metev_R0013.
DR   EnsemblGenomes-Gn; Metev_R0014.
DR   EnsemblGenomes-Gn; Metev_R0015.
DR   EnsemblGenomes-Gn; Metev_R0016.
DR   EnsemblGenomes-Gn; Metev_R0017.
DR   EnsemblGenomes-Gn; Metev_R0018.
DR   EnsemblGenomes-Gn; Metev_R0019.
DR   EnsemblGenomes-Gn; Metev_R0020.
DR   EnsemblGenomes-Gn; Metev_R0021.
DR   EnsemblGenomes-Gn; Metev_R0022.
DR   EnsemblGenomes-Gn; Metev_R0023.
DR   EnsemblGenomes-Gn; Metev_R0024.
DR   EnsemblGenomes-Gn; Metev_R0025.
DR   EnsemblGenomes-Gn; Metev_R0026.
DR   EnsemblGenomes-Gn; Metev_R0027.
DR   EnsemblGenomes-Gn; Metev_R0028.
DR   EnsemblGenomes-Gn; Metev_R0029.
DR   EnsemblGenomes-Gn; Metev_R0030.
DR   EnsemblGenomes-Gn; Metev_R0031.
DR   EnsemblGenomes-Gn; Metev_R0032.
DR   EnsemblGenomes-Gn; Metev_R0033.
DR   EnsemblGenomes-Gn; Metev_R0034.
DR   EnsemblGenomes-Gn; Metev_R0035.
DR   EnsemblGenomes-Gn; Metev_R0036.
DR   EnsemblGenomes-Gn; Metev_R0037.
DR   EnsemblGenomes-Gn; Metev_R0038.
DR   EnsemblGenomes-Gn; Metev_R0039.
DR   EnsemblGenomes-Gn; Metev_R0040.
DR   EnsemblGenomes-Gn; Metev_R0041.
DR   EnsemblGenomes-Gn; Metev_R0042.
DR   EnsemblGenomes-Gn; Metev_R0043.
DR   EnsemblGenomes-Gn; Metev_R0044.
DR   EnsemblGenomes-Gn; Metev_R0045.
DR   EnsemblGenomes-Gn; Metev_R0046.
DR   EnsemblGenomes-Gn; Metev_R0047.
DR   EnsemblGenomes-Gn; Metev_R0048.
DR   EnsemblGenomes-Gn; Metev_R0049.
DR   EnsemblGenomes-Gn; Metev_R0050.
DR   EnsemblGenomes-Gn; Metev_R0051.
DR   EnsemblGenomes-Gn; Metev_R0052.
DR   EnsemblGenomes-Gn; Metev_R0053.
DR   EnsemblGenomes-Gn; Metev_R0054.
DR   EnsemblGenomes-Gn; Metev_R0055.
DR   EnsemblGenomes-Gn; Metev_R0056.
DR   EnsemblGenomes-Gn; Metev_R0057.
DR   EnsemblGenomes-Gn; Metev_R0058.
DR   EnsemblGenomes-Gn; Metev_R0059.
DR   EnsemblGenomes-Tr; EBT00001655806.
DR   EnsemblGenomes-Tr; EBT00001655807.
DR   EnsemblGenomes-Tr; EBT00001655808.
DR   EnsemblGenomes-Tr; EBT00001655809.
DR   EnsemblGenomes-Tr; EBT00001655810.
DR   EnsemblGenomes-Tr; EBT00001655811.
DR   EnsemblGenomes-Tr; EBT00001655812.
DR   EnsemblGenomes-Tr; EBT00001655813.
DR   EnsemblGenomes-Tr; EBT00001655814.
DR   EnsemblGenomes-Tr; EBT00001655815.
DR   EnsemblGenomes-Tr; EBT00001655816.
DR   EnsemblGenomes-Tr; EBT00001655817.
DR   EnsemblGenomes-Tr; EBT00001655818.
DR   EnsemblGenomes-Tr; EBT00001655819.
DR   EnsemblGenomes-Tr; EBT00001655820.
DR   EnsemblGenomes-Tr; EBT00001655821.
DR   EnsemblGenomes-Tr; EBT00001655822.
DR   EnsemblGenomes-Tr; EBT00001655823.
DR   EnsemblGenomes-Tr; EBT00001655824.
DR   EnsemblGenomes-Tr; EBT00001655825.
DR   EnsemblGenomes-Tr; EBT00001655826.
DR   EnsemblGenomes-Tr; EBT00001655827.
DR   EnsemblGenomes-Tr; EBT00001655828.
DR   EnsemblGenomes-Tr; EBT00001655829.
DR   EnsemblGenomes-Tr; EBT00001655830.
DR   EnsemblGenomes-Tr; EBT00001655831.
DR   EnsemblGenomes-Tr; EBT00001655832.
DR   EnsemblGenomes-Tr; EBT00001655833.
DR   EnsemblGenomes-Tr; EBT00001655834.
DR   EnsemblGenomes-Tr; EBT00001655835.
DR   EnsemblGenomes-Tr; EBT00001655836.
DR   EnsemblGenomes-Tr; EBT00001655837.
DR   EnsemblGenomes-Tr; EBT00001655838.
DR   EnsemblGenomes-Tr; EBT00001655839.
DR   EnsemblGenomes-Tr; EBT00001655840.
DR   EnsemblGenomes-Tr; EBT00001655841.
DR   EnsemblGenomes-Tr; EBT00001655842.
DR   EnsemblGenomes-Tr; EBT00001655843.
DR   EnsemblGenomes-Tr; EBT00001655845.
DR   EnsemblGenomes-Tr; EBT00001655846.
DR   EnsemblGenomes-Tr; EBT00001655847.
DR   EnsemblGenomes-Tr; EBT00001655848.
DR   EnsemblGenomes-Tr; EBT00001655849.
DR   EnsemblGenomes-Tr; EBT00001655850.
DR   EnsemblGenomes-Tr; EBT00001655851.
DR   EnsemblGenomes-Tr; EBT00001655852.
DR   EnsemblGenomes-Tr; EBT00001655853.
DR   EnsemblGenomes-Tr; EBT00001655854.
DR   EnsemblGenomes-Tr; EBT00001655855.
DR   EnsemblGenomes-Tr; EBT00001655856.
DR   EnsemblGenomes-Tr; EBT00001655857.
DR   EnsemblGenomes-Tr; EBT00001655858.
DR   EnsemblGenomes-Tr; EBT00001655859.
DR   EnsemblGenomes-Tr; EBT00001655860.
DR   EnsemblGenomes-Tr; EBT00001655861.
DR   EnsemblGenomes-Tr; EBT00001655862.
DR   EnsemblGenomes-Tr; EBT00001655863.
DR   EnsemblGenomes-Tr; EBT00001655864.
DR   EnsemblGenomes-Tr; EBT00001655865.
DR   EnsemblGenomes-Tr; EBT00001655866.
DR   EnsemblGenomes-Tr; EBT00001655867.
DR   EnsemblGenomes-Tr; EBT00001655868.
DR   EnsemblGenomes-Tr; EBT00001655869.
DR   EnsemblGenomes-Tr; EBT00001655870.
DR   EnsemblGenomes-Tr; EBT00001655871.
DR   EnsemblGenomes-Tr; EBT00001655872.
DR   EnsemblGenomes-Tr; EBT00001655873.
DR   EnsemblGenomes-Tr; Metev_R0001-1.
DR   EnsemblGenomes-Tr; Metev_R0002-1.
DR   EnsemblGenomes-Tr; Metev_R0003-1.
DR   EnsemblGenomes-Tr; Metev_R0004-1.
DR   EnsemblGenomes-Tr; Metev_R0005-1.
DR   EnsemblGenomes-Tr; Metev_R0006-1.
DR   EnsemblGenomes-Tr; Metev_R0007-1.
DR   EnsemblGenomes-Tr; Metev_R0008-1.
DR   EnsemblGenomes-Tr; Metev_R0009-1.
DR   EnsemblGenomes-Tr; Metev_R0010-1.
DR   EnsemblGenomes-Tr; Metev_R0011-1.
DR   EnsemblGenomes-Tr; Metev_R0012-1.
DR   EnsemblGenomes-Tr; Metev_R0013-1.
DR   EnsemblGenomes-Tr; Metev_R0014-1.
DR   EnsemblGenomes-Tr; Metev_R0015-1.
DR   EnsemblGenomes-Tr; Metev_R0016-1.
DR   EnsemblGenomes-Tr; Metev_R0017-1.
DR   EnsemblGenomes-Tr; Metev_R0018-1.
DR   EnsemblGenomes-Tr; Metev_R0019-1.
DR   EnsemblGenomes-Tr; Metev_R0020-1.
DR   EnsemblGenomes-Tr; Metev_R0021-1.
DR   EnsemblGenomes-Tr; Metev_R0022-1.
DR   EnsemblGenomes-Tr; Metev_R0023-1.
DR   EnsemblGenomes-Tr; Metev_R0024-1.
DR   EnsemblGenomes-Tr; Metev_R0025-1.
DR   EnsemblGenomes-Tr; Metev_R0026-1.
DR   EnsemblGenomes-Tr; Metev_R0027-1.
DR   EnsemblGenomes-Tr; Metev_R0028-1.
DR   EnsemblGenomes-Tr; Metev_R0029-1.
DR   EnsemblGenomes-Tr; Metev_R0030-1.
DR   EnsemblGenomes-Tr; Metev_R0031-1.
DR   EnsemblGenomes-Tr; Metev_R0032-1.
DR   EnsemblGenomes-Tr; Metev_R0033-1.
DR   EnsemblGenomes-Tr; Metev_R0034-1.
DR   EnsemblGenomes-Tr; Metev_R0035-1.
DR   EnsemblGenomes-Tr; Metev_R0036-1.
DR   EnsemblGenomes-Tr; Metev_R0037-1.
DR   EnsemblGenomes-Tr; Metev_R0038-1.
DR   EnsemblGenomes-Tr; Metev_R0039-1.
DR   EnsemblGenomes-Tr; Metev_R0040-1.
DR   EnsemblGenomes-Tr; Metev_R0041-1.
DR   EnsemblGenomes-Tr; Metev_R0042-1.
DR   EnsemblGenomes-Tr; Metev_R0043-1.
DR   EnsemblGenomes-Tr; Metev_R0044-1.
DR   EnsemblGenomes-Tr; Metev_R0045-1.
DR   EnsemblGenomes-Tr; Metev_R0046-1.
DR   EnsemblGenomes-Tr; Metev_R0047-1.
DR   EnsemblGenomes-Tr; Metev_R0048-1.
DR   EnsemblGenomes-Tr; Metev_R0049-1.
DR   EnsemblGenomes-Tr; Metev_R0050-1.
DR   EnsemblGenomes-Tr; Metev_R0051-1.
DR   EnsemblGenomes-Tr; Metev_R0052-1.
DR   EnsemblGenomes-Tr; Metev_R0053-1.
DR   EnsemblGenomes-Tr; Metev_R0054-1.
DR   EnsemblGenomes-Tr; Metev_R0055-1.
DR   EnsemblGenomes-Tr; Metev_R0056-1.
DR   EnsemblGenomes-Tr; Metev_R0057-1.
DR   EnsemblGenomes-Tr; Metev_R0058-1.
DR   EnsemblGenomes-Tr; Metev_R0059-1.
DR   EuropePMC; PMC3017947; 21234345.
DR   EuropePMC; PMC4794207; 26982497.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01133; sR3.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01982; PYLIS_1.
DR   RFAM; RF02033; HEARO.
DR   SILVA-LSU; CP002069.
DR   SILVA-SSU; CP002069.
DR   StrainInfo; 158514; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4086216
CC   Source DNA and organism available from William B. Whitman
CC   (whitman@uga.edu)
CC   Contacts: Iain J. Anderson (IJAnderson@lbl.gov)
CC        Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Methanohalobium evestigatum Z-7303, DSM
CC                            3721
CC   Culture Collection ID :: DSM 3721, OCM 161
CC   GOLD Stamp ID         :: Gi01749
CC   Greengenes ID         :: 425
CC   Funding Program       :: DOE-LSP 2007
CC   Isolation Site        :: Microbial mat community in Crimea, USSR
CC   Isolation Country     :: USSR
CC   Latitude              :: 45.3453
CC   Longitude             :: 34.49973
CC   Oxygen Requirement    :: Anaerobe
CC   Temperature Range     :: Thermophile
CC   Temperature Optimum   :: 50C
CC   Salinity              :: Halophile
CC   pH                    :: 7
CC   Gram Staining         :: gram-
CC   Diseases              :: None
CC   Habitat               :: Fresh water
CC   Energy Source         :: Lithotroph, Autotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2242317
FT                   /organism="Methanohalobium evestigatum Z-7303"
FT                   /strain="Z-7303"
FT                   /mol_type="genomic DNA"
FT                   /country="USSR:Crimea"
FT                   /lat_lon="45.3453 N 34.4997 E"
FT                   /isolation_source="mud from a salt lagoon"
FT                   /db_xref="taxon:644295"
FT   gene            358..1596
FT                   /locus_tag="Metev_0001"
FT   CDS_pept        358..1596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0001"
FT                   /product="orc1/cdc6 family replication initiation protein"
FT                   /note="TIGRFAM: orc1/cdc6 family replication initiation
FT                   protein; PFAM: CDC6 domain protein; KEGG: mbu:Mbur_1733
FT                   cell division control protein 6; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72933"
FT                   /db_xref="GOA:D7E5R1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5R1"
FT                   /inference="protein motif:TFAM:TIGR02928"
FT                   /protein_id="ADI72933.1"
FT                   /translation="MKNDDPLDNLFDKLLENESIFKSKEVLRPSYTPEFLPHRDRQINS
FT                   LATILVSALRGDTPSNILIYGKTGTGKTAATRHVGFELEKKSENLNTFCSVLYINCEII
FT                   DTQYRLVANLARQFGEDIPMTGWPTDQVFTKFKETIDSKQQVLIIILDEVDKLIKKGDD
FT                   VLYNLSRINEDLKNSKVSIIGVSNDLKFTEFLDPRVKSSLGEEEIVFPPYDAEQISDIL
FT                   HQRAEMAYKEGVLDDMVIPLCSAFAAQEHGDARRALDLLRVSGELAERESKQVVEERHV
FT                   RNAQEKIENDRIVEVVRTLPTQSKLALYSVILLRKNGYVNVTTGEVYNVYRQLSQNIDM
FT                   DILTQRRVTDLISELDMLGILNAVVVSKGRYGRTKEIDLSVPVESTLEVLFEDYKLKPL
FT                   ENFKPVITSQTHL"
FT   gene            complement(1605..2642)
FT                   /locus_tag="Metev_0002"
FT   CDS_pept        complement(1605..2642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0002"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mbu:Mbur_2409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72934"
FT                   /db_xref="GOA:D7E5R2"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5R2"
FT                   /inference="protein motif:PFAM:PF03706"
FT                   /protein_id="ADI72934.1"
FT                   /translation="MCPMNKFGKWLPLSLLISFISIIVVLVFTVDPTTFEIIKEVKTEY
FT                   LLLAVALHSFSYVIWGARTQLMSNALGHKTKLIRCIEIVTSSTFVAALTPSSVGGEPLR
FT                   VHLLYKENLPVGRASAVVLGERIMDAILMLTFAPFALYIFRDIMQDSKIDTIFAIGQIF
FT                   MAVILVLLIYTIWKPEKTKSGMHYIVDKITGLLGKKSEGKHHKLIEQIDHELEQFHESL
FT                   VTFLKDGRRGLLYGAGCTALFWIVEFTMLPVILLGLNQEPQLLLVYAAQVLLILLIVIP
FT                   ATPGSSGIAELGATTLFSVFVPSSILGIIVVAWRALTFYMNLVVGGIISFKILKDTDIM
FT                   KKMMK"
FT   gene            2809..3933
FT                   /locus_tag="Metev_0003"
FT   CDS_pept        2809..3933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0003"
FT                   /product="Glycosyltransferase 28 domain protein"
FT                   /note="PFAM: Glycosyltransferase 28 domain; KEGG:
FT                   mac:MA0452 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72935"
FT                   /db_xref="GOA:D7E5R3"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5R3"
FT                   /inference="protein motif:PFAM:PF04101"
FT                   /protein_id="ADI72935.1"
FT                   /translation="MKILILVCGEGLGHTSRCVSLGRELTSANHEVLFGAYGYSKEFIE
FT                   GSGYQTREIPSEIRLVGRSGSLDLKASIGATLKEGDLLGAPRIFRLFNEFNPDAVVSDS
FT                   YYLGVLAAKAKKLPVYFIINQSNMEEFFKNKGVPYKLIGEIVKRFYSTVFKKVDKIVIP
FT                   DFPMPYTICQYNLSFQPEIAENVFYSGPLIKRKYHEVEAKPLDKPHILSAVGGFGYREP
FT                   IFRKVIETAKKDSSINYTLMMGPTIDPEKYSNLPENVGVMDFYSEPFPYFKSVDAVIAP
FT                   GGHTTIMEALSFGVPVLSFPDMNHSEQENNARVIDEMGYGRCLNYSTSSEELLHCIKEI
FT                   TDNSKFKENTQKLKDISKDLDGPVAIMKMLENRE"
FT   gene            complement(3934..4488)
FT                   /locus_tag="Metev_0004"
FT   CDS_pept        complement(3934..4488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0004"
FT                   /product="peptidase S26B, signal peptidase"
FT                   /note="KEGG: mbu:Mbur_1734 peptidase S26B, signal
FT                   peptidase; TIGRFAM: peptidase S26B, signal peptidase; PFAM:
FT                   Peptidase S24/S26A/S26B, conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72936"
FT                   /db_xref="GOA:D7E5R4"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5R4"
FT                   /inference="protein motif:TFAM:TIGR02228"
FT                   /protein_id="ADI72936.1"
FT                   /translation="MNLKDAINSFRHSDNFWVSLLRDITVVFLAVAIFASFSQIVFGMW
FT                   TPMVAVESGSMEPNIHVGDIIFVEDIDRTQIQTHTSSNNYTSFGNEGDVILYQPYGREG
FT                   VTPVIHRAMYHVEKGEPMWNGGPSAPYNGYITKGDNPNTNNHFDQQGSISYHRPVKDEW
FT                   VIGVARYRIPYIGYLRLIVPG"
FT   gene            4631..6208
FT                   /locus_tag="Metev_0005"
FT   CDS_pept        4631..6208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0005"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: mba:Mbar_A1005 DNA polymerase II small
FT                   subunit; PFAM: metallophosphoesterase; nucleic acid binding
FT                   OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72937"
FT                   /db_xref="GOA:D7E5R5"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR011149"
FT                   /db_xref="InterPro:IPR024826"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5R5"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ADI72937.1"
FT                   /translation="MSETDVLRMFAEAGYQISPDAAELIASQSSQDELVDYVLKNIDDS
FT                   VLVVDVDDIDLDGFLSHNGNGSENDTSTVTENSAEPELNCSSEPFNASPVTHSSQLQSS
FT                   FSPDLSGKTANPVKVISDITNQSTCVGEYMEFVQYFRDRYSKLSEIIRGRINARPVESL
FT                   TKNRRLGDGGNNDEVSVIGMISDVRTTTNGHKLIEIEDNTGSLSVLVRTADKELFEQAN
FT                   SFVLDEVVGVTGMLTNDKKLLIASKFTLPDLPNTNFTNKGSHGKAVFISDVHVGSSTFL
FT                   EDEWLRFIDFLNGYIDDKKMQDISNDIRYVVVSGDLVDGIGIYPGQDKELSIPDVYEQY
FT                   RKAAEYFKQIPEHITVIIGPGNHDAVRQAEPQPCFGEELKSYFPKNVTFVGNPAMVDLD
FT                   GVKVLMYHGRSIDDFVASVPHVSYQKPTTAMVEMMKFRHLSPIYGGRVSIAPEKHDHFV
FT                   INQIPDILHCGHVHTVGVEPYKNVLLINSGTWQSQTEFQKRVNLVPDPARVPVVDLSNM
FT                   KTSILKFN"
FT   gene            6256..7191
FT                   /locus_tag="Metev_0006"
FT   CDS_pept        6256..7191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0006"
FT                   /product="Wyosine base formation domain protein"
FT                   /note="PFAM: Wyosine base formation domain protein; Radical
FT                   SAM domain protein; KEGG: mbu:Mbur_1737 tRNA-modifying
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72938"
FT                   /db_xref="GOA:D7E5R6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR023993"
FT                   /db_xref="InterPro:IPR034556"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5R6"
FT                   /inference="protein motif:PFAM:PF08608"
FT                   /protein_id="ADI72938.1"
FT                   /translation="MPDQIYNNIPDFRTLLKNQGYSLVGNHSAVKTCLWLKRSIKDEGA
FT                   CYKSRFYGIKSHCCIQMTPTLLCNQKCIHCWRPTEIEVPAPEEWDSPVEIMGSSIYAQR
FT                   KLISGFGGSAPRERWMEANKPEHAAISLSGEPTLYPYLPELIDEFTKEGITTFVVTNGT
FT                   RPEMITRIRPTQLYLSLDAPDKNTYLEVCNPESPELWENIKKSLSNLYSKDVRTVVRIT
FT                   LIKGVNMYNPEGFAELINTAKPDFVEIKAYMHLGFSRGRLSRESMPSHDEVYAFASKIA
FT                   DYLDYEVADNVEISRVVLLSRPLEPLPGQS"
FT   gene            7352..8593
FT                   /locus_tag="Metev_0007"
FT   CDS_pept        7352..8593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0007"
FT                   /product="peptide chain release factor 1"
FT                   /note="KEGG: mbu:Mbur_1738 peptide chain release factor 1;
FT                   TIGRFAM: peptide chain release factor 1; PFAM: eRF1 domain
FT                   1 protein; eRF1 domain 2 protein; eRF1 domain 3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72939"
FT                   /db_xref="GOA:D7E5R7"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5R7"
FT                   /inference="protein motif:TFAM:TIGR03676"
FT                   /protein_id="ADI72939.1"
FT                   /translation="MVEQSAHDKYEFKKKLEELRNKKGRGTELISLYLPPDKPISEVTS
FT                   QLKDEYGQASNIKSKVTRTNVQGAIDSLVSRLKYLEEVPENGIVFFTGAVDVGANKTNM
FT                   ETTVIEPPEQLVTYRYHCDSSFFLEPMEDMLKESKTYGLVVLDRREATIGLLVGKRIET
FT                   HRHLTSTVPGKQKKGGQSADRFEQLRLIAIHDFNKRIGEAASDVFLNVDQENFEGVLIG
FT                   GPSPTKEEFKEGEFLHHEIQKKILGMFDVSYTDESGLSELVNAATDKLADIDLMKEKKL
FT                   MRQFFNELIAESGKAAYGEETVRKNLEIGAVNTLLISEDMKSERDIIRCSSCGYKTSFT
FT                   RKPSGQVTDYGTCPKCGGSFEFVDSIDIVEDLSTMADQTGAKVEFISTEFEEGSQLLNA
FT                   FGGIVAILRYNTGI"
FT   gene            8634..10325
FT                   /locus_tag="Metev_0008"
FT   CDS_pept        8634..10325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0008"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="TIGRFAM: arginyl-tRNA synthetase; KEGG:
FT                   mbu:Mbur_1739 arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72940"
FT                   /db_xref="GOA:D7E5R8"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5R8"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ADI72940.1"
FT                   /translation="MELKKQVESILNDAVVSLGYEIDSLYVEASQHSDVASNVAFRLAS
FT                   KYRQNPKDIAEKIGNTAVIGDKSYIGKMEVTGPYLNFWAKRDYLDDTVLKIRKEKENFA
FT                   SNFSSGDIILEHTSANPNGPLHVGHIRNSVIGDTLSRVLKHAGYNVRTQYYVNDIGRQI
FT                   AIVSWGLKNFGFDESKKSDHAIADLYIKSNQELEKDTSKVQDIDSLMQMVENGDEDTIK
FT                   IFDESVRYSLEGTKQTLKTLNVSHDEFVYESEFIRNGSVSKIVNELKSTGHTEMDNGAL
FT                   VVDLSGYGFEKQLVIQRSDGTSLYTTRDLAYHEQKSAESDRVIDILGADHKLVSSQLKA
FT                   TMNLLDKKEPEVVIFEFVSLPEGSMSTRKGKFITADDVFDKVKSQAYKEVDKRRPDMPA
FT                   DFKKEISDQVGMGAVRYDIISVSPEKSTVFDWKKALDFEKQGGPYIQYSHARACNILKK
FT                   AETFWNPEDAVNPSVLVEDDEVALIKKMAKFDQMIDQSAKELKPHTVATYARELADDFN
FT                   QFYRYVPVNSAEDDEVRNARLGLVDCARIMLANTLYILGISAPESM"
FT   gene            10451..10915
FT                   /locus_tag="Metev_0009"
FT   CDS_pept        10451..10915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0009"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   drt:Dret_0434 peptidylprolyl isomerase FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72941"
FT                   /db_xref="GOA:D7E5R9"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5R9"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ADI72941.1"
FT                   /translation="MPVKQGDKVKVEYEGTLEDGSVFDSTENHGEPLEFEIGSGQIIEG
FT                   FEESIKGMEEGEEKQFQLQPSEAYGEPRDDLTRDVPKEQVPDDQEITPGMMLLVTLPDE
FT                   SQIPAEVLEVTEEKVTLDLNHPLAGKVLNFKVKIDEIDESGSDEETESQS"
FT   gene            11020..12171
FT                   /locus_tag="Metev_0010"
FT   CDS_pept        11020..12171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0010"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: mac:MA3361 transposase; TIGRFAM: transposase,
FT                   IS605 OrfB family; PFAM: putative transposase
FT                   IS891/IS1136/IS1341 family; transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72942"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5S0"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADI72942.1"
FT                   /translation="MLNHNNYGMLKAYKYRMYPNQIQQELIAKHIGACRFIYNWALENK
FT                   IKYYEQDGKAISRFELNKQIRVLKQDHEWLNEINSQSLQGATLNLENAFTKFFREKLGF
FT                   PKFKSKKNPVQSFSVPQYYKVDFENNKVYIPKIGWIKTRLHRSFDGKQRTATITRTPTG
FT                   KYYISILVDDDKQLPQKQTFYEVNTVGVDVGIKDFAVTSDGEKIDNPRYLKNSIERLKV
FT                   LQKRLSRKKKGSNNYRKLKHQIAKYHEKIANQREDFQHKLSSRLISENQAVALECLNVK
FT                   GLLKNHNLAQHITDASWSSFVQKLEYKAEWYGKNIIKIGRFDPSSKICHVCGYYHQDLE
FT                   LKDREWECPDCKTIHDRDINASVNIKKFTLDKQNLIGINSPSG"
FT   gene            complement(12258..12929)
FT                   /locus_tag="Metev_0011"
FT   CDS_pept        complement(12258..12929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0011"
FT                   /product="oxidoreductase molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   mbu:Mbur_0650 oxidoreductase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72943"
FT                   /db_xref="GOA:D7E5S1"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5S1"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ADI72943.1"
FT                   /translation="MGFLKIIYAFFCVVFLILFSGCLSSTPSNTYDTEISRNQTETKNY
FT                   QGVDLTPIDQQQTRDIKGTPNINIESYRLQINGMVENPENFTYEQIKSYPNVSKVIDLN
FT                   CVEGWSFTAKWTGIPLKTLFNETGVKDNATNVVFYSADGYSTSLKLDYLMDNNIILAYK
FT                   INDVILPRDRGFPLQLVAESKYGYKWAKWITEIEITNQSYEGYWEKRGYSNSANVSGPS
FT                   F"
FT   sig_peptide     complement(12837..12929)
FT                   /locus_tag="Metev_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.894 at
FT                   residue 31"
FT   gene            complement(12995..14020)
FT                   /locus_tag="Metev_0012"
FT   CDS_pept        complement(12995..14020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0012"
FT                   /product="methyltransferase MtaA/CmuA family"
FT                   /note="KEGG: mac:MA2163 methylcobalamin:coenzyme M
FT                   methyltransferase; TIGRFAM: methyltransferase MtaA/CmuA
FT                   family; PFAM: Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72944"
FT                   /db_xref="GOA:D7E5S2"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006360"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5S2"
FT                   /inference="protein motif:TFAM:TIGR01463"
FT                   /protein_id="ADI72944.1"
FT                   /translation="MDEITPKERMVRLLKGKTVDKTPVGSFTSMSPVDLMELSGSQRPE
FT                   ADRDSEKMATLAISASKFAGFETVRYPFDMVTLGEAMGCEIDIGTKKRTPSVTSGLSEE
FT                   AIRELELPEDFLENGRIPTILDASRIIKEEVKDELPVIMGVEGPIDLASNIADIKTFMK
FT                   WLLKDREIVEKLLDVCTDACIEYANACLKHGADTVCIAEAVASPDLLPPSDFDNLLKPR
FT                   YQKIAENLEGHRVLHVCGKSDKIIPSMVECGFNGISIEENVRDFKTAVETAHKNNNIVI
FT                   GNVSTSQTLYNGTPEQVISESFDCLKNGVDVLAPGCGIAPESPLANLKAMVQARNEYYK
FT                   S"
FT   gene            complement(14026..15039)
FT                   /locus_tag="Metev_0013"
FT   CDS_pept        complement(14026..15039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0013"
FT                   /product="methyltransferase MtaA/CmuA family"
FT                   /note="KEGG: mac:MA0855 methylcobalamin:coenzyme M
FT                   methyltransferase; TIGRFAM: methyltransferase MtaA/CmuA
FT                   family; PFAM: Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72945"
FT                   /db_xref="GOA:D7E5S3"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006360"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5S3"
FT                   /inference="protein motif:TFAM:TIGR01463"
FT                   /protein_id="ADI72945.1"
FT                   /translation="MNPRDRLLNCLKGKKVDIVPALSVTQTATVELMRMTDSEWPEAHS
FT                   DPEKMVKLAVSGHEIAGLEAVRYPFCLTVLAEAMGCEVNMGAMDIQPSIVSNPYSNNSD
FT                   IPQIPDDLEKRGRIPVMLEVAELIRDKLDENVPIIAGLVGPATLTAHLMGTSNFLIGLI
FT                   KKPEYVRQFLEVSTDICIRHANNLLEHGADVVCVPDGTAGPDLIDPAMFENFIKPEYQR
FT                   FCRDVKGFKVSHMCGDINAILEPLSECGFEGISVEEKIIDLQTAKEILGDKSKLIGNVS
FT                   TSGTMLMRSYDDVKNEAKNCLEEGVDVLAPGCGIAPNTPLKNIKALVDARNEYYQR"
FT   gene            15183..16208
FT                   /locus_tag="Metev_0014"
FT   CDS_pept        15183..16208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0014"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /note="KEGG: mbu:Mbur_1754
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72946"
FT                   /db_xref="GOA:D7E5S4"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5S4"
FT                   /inference="similar to AA sequence:KEGG:Mbur_1754"
FT                   /protein_id="ADI72946.1"
FT                   /translation="MTELIFDEIGSYPLPEGVTKEWLAHAFSTREEDEQLFSVINNTFQ
FT                   KKIDAEVQVPNYPQFQDMNQQFLSIINDEECSDGPYDVKEDCAKILELEAIEPAAKKYR
FT                   EEHGEKLGIRVCITGPLELYLKEFGSTEYTDILNLLASSVDKFAKKAIESAKNFYVKTI
FT                   SIDEPSIGINPQIMFSDSELIEALTIASQSANKLGADVEIHLHSPIHYHLAARTPSINV
FT                   IGVESAANPDYLELIDKKLLEDTDSYLRVGVARTDVFNLAAVLNEKYNTNVWKDLDKFE
FT                   EIITDLETPETVSKRLENAYSKFGDRVKYVGPDCGLGSWPTQEMASRLLNNVARGIADF
FT                   K"
FT   gene            complement(16220..17251)
FT                   /locus_tag="Metev_0015"
FT   CDS_pept        complement(16220..17251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0015"
FT                   /product="protein of unknown function DUF95 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF95
FT                   transmembrane; KEGG: bbe:BBR47_02610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72947"
FT                   /db_xref="GOA:D7E5S5"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5S5"
FT                   /inference="protein motif:PFAM:PF01944"
FT                   /protein_id="ADI72947.1"
FT                   /translation="MRVQIMNDFSDKTFSIKKSDVLWSLKLFAMAIGFACLLGFSLYLI
FT                   MNSFTGPETVNKAITTTSSTATKKVEVSAKYISPVWSIFIFNTIAAFTAAAGTGLFVYI
FT                   HHALLGDLEHRFKNKKYSTFSIKTEQLFRFFSNKIYKLTTKINKSYKQNGYRPNSEYTQ
FT                   DSIWYYSGFSEYDYQKIAQLLPYTIPVIIIFVNGILIGLLFSYFIFNGIIDGYEVMGLK
FT                   GIMFGGVYSFSYFISSILPHGILELPALLLTASMGHRFAKIQSCTVKNKSLFRGDSIAS
FT                   IYQSLEQVNSTTKTYLKSKPLWILLTSITVVLFAAAYIEINITPVFVKIVMEILDNIIL
FT                   SIK"
FT   gene            17412..18161
FT                   /locus_tag="Metev_0016"
FT   CDS_pept        17412..18161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0016"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: mbu:Mbur_1755 ATPase; PFAM: KaiA binding;
FT                   Circadian clock protein KaiC central region"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72948"
FT                   /db_xref="GOA:D7E5S6"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5S6"
FT                   /inference="protein motif:PRIAM:2.7.11.1"
FT                   /protein_id="ADI72948.1"
FT                   /translation="MVTRIQTGISGFDELVQGGLLSERVYLVSGPPGSGKTTFGIQFLT
FT                   HGAANGEIGLYITLNESPQNVIDDMSNYKLGIPSLIKKRKLLFADLGPRMEYGYSDEMN
FT                   EVISPNYDVGYAPVESEAPSPNLVFKQITAYVMEYNVKRLVIDSVSAIRFTSKDRSLEE
FT                   KEMSRFIRSLKNLGCTTVLLSEMVDPTSYSTEQFSSHGVIFLHNFLYQKTMTRALQIIK
FT                   MRGTRHDCNMRGIEFTEKGLKINDQLS"
FT   gene            18174..18695
FT                   /locus_tag="Metev_0017"
FT   CDS_pept        18174..18695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0017"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72949"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5S7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI72949.1"
FT                   /translation="MIDFIKKSDSTRNSSSTGKFRNTEVLKKVYDLGFEVGYNKHSELG
FT                   WVTDKYSRLYSLSKMYGQDEYVHRYYIRGKRDGAQEKEQNLYASLSREEKENKDEEKEL
FT                   QESQELDSEENVDTNFESGFGCTYSNDYECIQSPAQKPTMMDLPDFLAKPKKLEKPDSV
FT                   KGFKPFTHRR"
FT   gene            complement(18709..19752)
FT                   /locus_tag="Metev_0018"
FT   CDS_pept        complement(18709..19752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0018"
FT                   /product="elongation factor Tu domain 2 protein"
FT                   /note="PFAM: elongation factor Tu domain 2 protein; KEGG:
FT                   mbu:Mbur_1757 elongation factor Tu domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72950"
FT                   /db_xref="GOA:D7E5S8"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5S8"
FT                   /inference="protein motif:PFAM:PF03144"
FT                   /protein_id="ADI72950.1"
FT                   /translation="MTSVAIIGSEQSGRTSLASHLGKKEDESDITKFEYSKGGRILTAI
FT                   DANGYPESVKPLITALSLSDIALICVPPEGLNATIGECIIALDIMKYQHGIFVLTKSDT
FT                   TYPYAIEELKEQIKKVTAGTSLENWDCISTSTTSFEGMNELRDMIFELRDTVTKEKKSL
FT                   DDKPPRVVIDQVFNVTGIGCVALGSVSQGTIHSKDKMYLYPLEKPLEIRSIQMHDEDTK
FT                   SAGAGSRVGLALKHVQTKEIDRGFIISNDESVGTDFTLNCTLTQLTDGFAVGDVLHLFT
FT                   GLQSTPVRVENITSNSNNIEHAKPGYEYLVEFSGTKEIAYNSSDRFIIANLNNDKQRFI
FT                   GYGFVNA"
FT   gene            complement(19781..20950)
FT                   /locus_tag="Metev_0019"
FT   CDS_pept        complement(19781..20950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0019"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase; KEGG: mac:MA4653
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72951"
FT                   /db_xref="GOA:D7E5S9"
FT                   /db_xref="InterPro:IPR001072"
FT                   /db_xref="InterPro:IPR021122"
FT                   /db_xref="InterPro:IPR041596"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5S9"
FT                   /inference="protein motif:PFAM:PF01068"
FT                   /protein_id="ADI72951.1"
FT                   /translation="MSFESNTKLDIDGVAEFLNLPSSKVKKLASKKRILQNWGKYQNLF
FT                   RFDKKVSKIESGTVLYQNNGYFELIRGFPKIKRAMAVEPAVKSHFKNSGTVSVEEKMNG
FT                   YNVRVASINGDVTAFTRSGIVCPYTTERAKYLIGQEFFEKHPEFVLYGEMVGPDNPYVP
FT                   KNIYNIESLDFFIFDIRYKNTGEPLPVYERRKLMNDYNLNQVQLFGEYKIEEAPKNITK
FT                   IIKEIGKQEREGVVIKDPQMRINAIKYTSSESNCADLREGFKFYNDFGRDYFYSRVIRE
FT                   GFQSVELGESEEEFQERCLQLGRSILEPMSRTMRKVAQGEEVHDDVQIRVKEPETIYEF
FT                   EKHLKRMGIDAKFGAPQQVGDEYLVSIRKLNQSTNDKTKAIWNGSLWKS"
FT   gene            complement(20979..21755)
FT                   /locus_tag="Metev_0020"
FT   CDS_pept        complement(20979..21755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0020"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="KEGG: mbu:Mbur_1759 CBS domain-containing protein;
FT                   PFAM: CBS domain containing protein; SMART: CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72952"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5T0"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADI72952.1"
FT                   /translation="MQVKEIMVEPPTIDKSDTTSHALDVMEKKNTRRLLVTHDDKIMGV
FT                   LTMRSLNEELGTRKKGNKPASSLHVATAVSDDYSKVLPDTDIKDAITLMKNKGKVIVVT
FT                   DNDDIYGWVTPEELLKNNHFDGYAGEIMQKDPLKANPSDRVIHIRHQMLENNIGRVPVV
FT                   EDEKIVGIVTEKDIAKSMRAFRDLVAGNKQDTRIRNLIIEDIMTRGAKTVYTNTPTSDV
FT                   VNMMIEDNIGGVPVLNLEDELVGIITRRNIIESMAD"
FT   gene            complement(21809..22669)
FT                   /locus_tag="Metev_0021"
FT   CDS_pept        complement(21809..22669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0021"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="KEGG: mbu:Mbur_1760 CBS domain-containing protein;
FT                   PFAM: CBS domain containing protein; SMART: CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72953"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5T1"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADI72953.1"
FT                   /translation="MTVKDIMSSPVYVLKPNDTVAHARNLMLRHKINTLIVVDDEEEMV
FT                   GIVTMSDLSRKKAQSGPTWKRRPVDDILIDRVMTESPLTIYSSASISQATSMMLENHIS
FT                   SLPVMKNKVAGIITRTDIVKYIVENRSLEGSISEWMTKNPIFVHRHHTINHVIDEMDKS
FT                   NIHKLLVVNDVEKTVGMISTRDLALNSLKDDEGKLQSKEIKMARKPETGGQRVYRDVEK
FT                   VSLVAEDIMSTQLHVIDSSDSLNNATKIMIDENVLGLPVRENEDIVGIISRSDILRAIQ
FT                   NQLSE"
FT   gene            complement(22701..23762)
FT                   /locus_tag="Metev_0022"
FT   CDS_pept        complement(22701..23762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0022"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="KEGG: mbu:Mbur_1761 CBS domain-containing protein;
FT                   PFAM: CBS domain containing protein; SMART: CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72954"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5T2"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADI72954.1"
FT                   /translation="MSEIIRKNHSIDQFKVISLDIREKRNIASEKKVRMQEKIHAQDKE
FT                   KISRKKDPQLHTTDGVQELGPVDFQGHEAEHEGDIMAIAKRDVITVPPTTTIMGAIKTM
FT                   MNKGFRRIPITDAGTNRLEGIVTSVDIINFMGGGDKNLLVENHYNGNLIAAINAEIREI
FT                   MENDIVYLHNTDSIDDAIDTMNTKNIGGLPIVDEDNRVHAICTERDFLQFIDGVYTNKS
FT                   VGEYMNKNVMRVKSNATIEDAAKIMMNEGFRRLPVVKDSILLGIVTATNIMNYLGSGKA
FT                   FEKLITGNVHEPLNEPISSMITKDVVWTTSDTDLGEAARLMQENNVGSLPIIDNGQFIG
FT                   IITERDFLKAIVE"
FT   gene            complement(23750..24517)
FT                   /locus_tag="Metev_0023"
FT   CDS_pept        complement(23750..24517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0023"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="KEGG: mma:MM_1302 hypothetical protein; PFAM: CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72955"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5T3"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADI72955.1"
FT                   /translation="MTVVEDIMTKDPVKVTENDYITHARQLMRDYFLRSVPVVDNHDSN
FT                   HVTGLLTDQDILNITSTKSNLTVKGFERAFPTILPDTDILKASKLLLDAKLHRSPVMIS
FT                   TTEKRLAGIISNRDLLEKINPSRRSPETIGEIMNTKVITCYTDDNVARIWNNMLDWDYT
FT                   GIPVVNQKNEPIGVVTRRDIIKSGHARINSPEKSSRVEKIMSTPTYTITPNTPITEAID
FT                   KIIHYDVGRLTVVNNNKVVGIVDRNDLLEACLR"
FT   gene            complement(24563..25198)
FT                   /locus_tag="Metev_0024"
FT   CDS_pept        complement(24563..25198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0024"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="KEGG: mma:MM_1301 hypothetical protein; PFAM: CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72956"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5T4"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADI72956.1"
FT                   /translation="MTLGTQKDIEAGEPYKELDDNLTVHEIMNRSVYTIDIDASVVDVA
FT                   KEMSKNNVGSIIIVQNNDPVGVITERDLVKKILTGDIRPSRITAGEVMSSPLITTKPST
FT                   SVIDAAELMVKSNIRRLIVMQDNKIVGFITDRDILTISSGLNTILKNLIEMNQEQYFTT
FT                   NSDIETSSEQSETSQSVEQGICEYCGTFSEYLKMFNGMMLCESCRDNT"
FT   gene            complement(25410..25949)
FT                   /locus_tag="Metev_0025"
FT   CDS_pept        complement(25410..25949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecb:100061858 similar to Radixin"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72957"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5T5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI72957.1"
FT                   /translation="MIKNECFYCQKTDLECIHPRGDCVNCPVNNAEELNRRTIENEKYN
FT                   KKETESQNQRLEREGYIATKKENGQLKIDSITEKGKKKLSKDLLDELNSDLKIDEILCT
FT                   QAEILRNSPVFWKRVIELMKYGVLKKDTIENVNILALVGFIGLFEGLETKLTENEERLL
FT                   EWQTEGFVDMCMDYTQ"
FT   gene            26246..26704
FT                   /locus_tag="Metev_0026"
FT   CDS_pept        26246..26704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDB_0191488 zipper-like domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72958"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5T6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI72958.1"
FT                   /translation="MSKVKINTSIPQEYKEMIEQSGYSQTYCVTEALRQFFYGSDGKNQ
FT                   ETSSDEEKNSDVDVLVYEERIQELKQDKERLYKLLGNKDLQLQNKDNQLTEKDNQLKNK
FT                   EYQISSMFHKINTVEQKQNNKPHLTDHLKTDDGNPGLLKRLKSKFTNN"
FT   gene            complement(26712..27848)
FT                   /locus_tag="Metev_0027"
FT   CDS_pept        complement(26712..27848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0027"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /note="PFAM: nucleic acid binding OB-fold
FT                   tRNA/helicase-type; KEGG: mbu:Mbur_1764 replication factor
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72959"
FT                   /db_xref="GOA:D7E5T7"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5T7"
FT                   /inference="protein motif:PFAM:PF01336"
FT                   /protein_id="ADI72959.1"
FT                   /translation="MSETEEIDKIYDKLEDSISREDFLSKVDEKVEQMSGLCDRKTAAL
FT                   LVANDLGVSDTGNDVVKISDISPNNNVKFIAKVVSVFGTKDFNKNDGTEGKVGNLIVAD
FT                   ETGSIRLTLWDDKASLIESGEFEVDQSLQISGYAKEGYKGLEVHIGQYGTIDEADERID
FT                   TSANSQKIEYIEDGTGDINILGKVLNIWDVKTFQRKDGSQGRVSNLQIGDDTGKIKVTL
FT                   WDDKADLVKEVDYNDNVEIINGFARTNNYNQEVEIQIGNYGLIKKTNTNVDYNEHFTPI
FT                   EKIDASSRKLYSVEGAVSGLGDIKEFTKKDGSTNTVANIYLSDDTGRIRIALWGEKANL
FT                   IDQLDFDSKIQVIDATSKPGYQDDVELSAGNRSRVVFL"
FT   gene            28078..28704
FT                   /locus_tag="Metev_0028"
FT   CDS_pept        28078..28704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0028"
FT                   /product="phosphotransferase KptA/Tpt1"
FT                   /note="PFAM: phosphotransferase KptA/Tpt1; KEGG:
FT                   mbu:Mbur_1765 RNA 2'-phosphotransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72960"
FT                   /db_xref="GOA:D7E5T8"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5T8"
FT                   /inference="protein motif:PFAM:PF01885"
FT                   /protein_id="ADI72960.1"
FT                   /translation="MIRKCNEHGYFRGEVCPECNTKGRHVLGDRYEERLGKFVSGALRH
FT                   FPNATGLEMDKKGWVNLDQFCNILKQKYKWATKESLISLVESDIKNRYEIDGGYLRACY
FT                   GHSVDVELDHCECDLPYLYYGVSQEEADMILENGIKPVHQRYVHLSTSYGKANDAAQVH
FT                   TDNPIIIKIDVDVARENGMSFMSATDEIVLAKQVPSEYLSIANFG"
FT   gene            complement(28727..29731)
FT                   /locus_tag="Metev_0029"
FT   CDS_pept        complement(28727..29731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0029"
FT                   /product="RNA 3'-phosphate cyclase"
FT                   /EC_number="6.5.1.4"
FT                   /note="TIGRFAM: RNA 3'-phosphate cyclase; KEGG:
FT                   mba:Mbar_A0961 RNA 3'-terminal-phosphate cyclase; PFAM: RNA
FT                   3'-terminal phosphate cyclase; RNA 3'-terminal phosphate
FT                   cyclase insert region"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72961"
FT                   /db_xref="GOA:D7E5T9"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR017770"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5T9"
FT                   /inference="protein motif:TFAM:TIGR03399"
FT                   /protein_id="ADI72961.1"
FT                   /translation="MIEIDGSYGEGGGQIVRTAIALSATTGKSVKIYNIRKFRSNPGLK
FT                   KQHIKTLETAARICNAQIDGEYLGSLRISFFPGEIKGGYFDVDIKTAGSITLLLQCIMP
FT                   LVIKSNEDIQLKITGGTDVAWSPTIDYLKHITVTALSKMGYTCDIKNIRRGYYPKGQGV
FT                   VYANLKSKKLHKFNFCNQKTTVSKIYGISHCSNLPEHIAQRQAESASYHLNYKNFDCNI
FT                   ATEVTNNPSKGTGITLWKNLCGGSALGKRGFPAEEVGKKAADKVSVELESGADVDINLA
FT                   DQLIPYMGLVPGCSYTVKDITQHTKTNIWVTEKFLDVEFNIMEENGLFRVTSQ"
FT   gene            complement(29724..31127)
FT                   /locus_tag="Metev_0030"
FT   CDS_pept        complement(29724..31127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0030"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: mbu:Mbur_1767
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72962"
FT                   /db_xref="GOA:D7E5U0"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5U0"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADI72962.1"
FT                   /translation="MVGNTSENNTKKQDLVIIGGGAVGMAVATHVQRHGNYNIKVLSKD
FT                   SHTAYSQCGMPFVLAGDIPDFNKLIVKNLQFFKDMGIDVRLNTQVNSIDLENHTVHTQI
FT                   DTVRYDKLVIATGSSPSIPEPLKEFIKMDNVFTLRTLSDGIKIQNNLEKSKNLVVIGAG
FT                   GIGVEIAVAGVKRGISTTLINRSKNVLSHNLDSDMSQILQNHLDSKGINLLTGHTPVSI
FT                   NGSDTAESVTIKENITGKIKNISVDTIVISTGVNPEVSLAKNAGISVGESGGLLVNNKL
FT                   QVKYDNKYLDDVFAGGECAQVYDFVTGNPFVSQLASTARRMASVIAENLLEKTSTFTPI
FT                   TNPWIGVIGDYQVGNVGLTEKTAYKNKINTVTGSSTGFTRAGYYPGGEKIYIKLLFSNR
FT                   CLSGAQIIGRKGVKERIDGLSLAIRKKASIDDMLKMETCYTPPVSELVDPITYAVKDAY
FT                   KNMDNQKYD"
FT   gene            31273..31758
FT                   /locus_tag="Metev_0031"
FT   CDS_pept        31273..31758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA4585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72963"
FT                   /db_xref="GOA:D7E5U1"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5U1"
FT                   /inference="similar to AA sequence:KEGG:MA4585"
FT                   /protein_id="ADI72963.1"
FT                   /translation="MLDLSIFKGIGILLVIVVFSSGLLFATASELNLGINKTNKSLETS
FT                   LGDGQNGSQINNTNQSGYISGLAKIDDINLERNPDEQLLVNVSGHLSDSCTEIDEIVKQ
FT                   KTGDKFIINITTKRPKDAMCPQVIIPFEKEFKFDISGMDIDNLEVKVNEVTKSYLSE"
FT   sig_peptide     31273..31359
FT                   /locus_tag="Metev_0031"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.535 at
FT                   residue 29"
FT   gene            32640..33998
FT                   /locus_tag="Metev_0032"
FT   CDS_pept        32640..33998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0032"
FT                   /product="TOPRIM domain protein"
FT                   /note="KEGG: mbu:Mbur_1769 DNA primase; PFAM: TOPRIM domain
FT                   protein; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72964"
FT                   /db_xref="GOA:D7E5U2"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR020607"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5U2"
FT                   /inference="protein motif:PFAM:PF01751"
FT                   /protein_id="ADI72964.1"
FT                   /translation="MQNQNHNQNNQNQSADTTKYIIHSKISANGIIERPDIVGAIFGQT
FT                   EGLLGKDLDLRDLQKTGRIGRIEVLISGKGGKSKGTILIPSSLDRVETSVLAAALETID
FT                   RVGPCSAKIEVSKIEDIRATKRKNIIERARMIYSSMFDDNLPESQEIADEVRESLRIHE
FT                   MEYYGKNKIPCGPEVFDSDEVILVEGRADVLNLLRYGIKNTICVGGTNIPPEIAELTKK
FT                   RNVTAFTDGDRGGVLIIKELLQVANIDYIARAPEGKSVEDLVHREVMRALQQRVPIEQA
FT                   MESYTSKPVESSKTGKSARVSKRKDNRSQEIQKPSSLKPKNLVKETEVEPQQEVQESFT
FT                   EDVEIAEEPVVTEEAEPQFKFKPHIDAISGTLDARLLDSGEELVEEIAVRDLVNKLKNY
FT                   NGEVVSVVFDGVITQRILDVSSEKGIKNLVGVKLGNVTKVPTEINIFTENDYC"
FT   gene            34189..34473
FT                   /locus_tag="Metev_0033"
FT   CDS_pept        34189..34473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0033"
FT                   /product="Protein of unknown function UPF0058"
FT                   /note="PFAM: Protein of unknown function UPF0058; KEGG:
FT                   mma:MM_1294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72965"
FT                   /db_xref="InterPro:IPR002753"
FT                   /db_xref="InterPro:IPR036519"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5U3"
FT                   /inference="protein motif:PFAM:PF01893"
FT                   /protein_id="ADI72965.1"
FT                   /translation="MHKDELIQLHTLMAQLKRYFECQGVECDFSEYKSLSISPVHVHRS
FT                   KAEHKHAIFVLGNDIAKIISEDENMGGGRTSERMQELAARTGNKVIQDN"
FT   gene            complement(34470..34994)
FT                   /locus_tag="Metev_0034"
FT   CDS_pept        complement(34470..34994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0034"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="KEGG: mac:MA4633 acetyltransferase (GNAT) family
FT                   protein; TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72966"
FT                   /db_xref="GOA:D7E5U4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5U4"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ADI72966.1"
FT                   /translation="MNLRYFEPEDFEDILEIEMETFSEHNPFVYINFYEINSDGFIVAT
FT                   VGDKVAGYVVGYQIYENEGRIFTLAVKKGYRDKGIGSELLRAILNLFCRTGLKYARLEV
FT                   RRSNVRAQKLYNSMGFVQCWVEKKYYSDGEDGIIMKAYLQPPYDMNSYTNLLDNKINNK
FT                   YESGITNENTL"
FT   gene            complement(35025..36866)
FT                   /locus_tag="Metev_0035"
FT   CDS_pept        complement(35025..36866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0035"
FT                   /product="tRNA-guanine transglycosylase, various
FT                   specificities"
FT                   /note="TIGRFAM: tRNA-guanine transglycosylase, various
FT                   specificities; PFAM: PUA domain containing protein;
FT                   Queuine/other tRNA-ribosyltransferase; KEGG: mbu:Mbur_1772
FT                   tRNA-guanine transglycosylases, various specificities;
FT                   SMART: PUA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72967"
FT                   /db_xref="GOA:D7E5U5"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029402"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR038250"
FT                   /db_xref="InterPro:IPR040777"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5U5"
FT                   /inference="protein motif:TFAM:TIGR00449"
FT                   /protein_id="ADI72967.1"
FT                   /translation="MTKHFEVEQRDGKARLGKLILSRNLKTPCIINIEDIGDTEKLPII
FT                   DAGSVWKQGKHIFENQYLNQLRQKVSENNLIILPHQNYPYNVPDKAVSNATGNYDIETS
FT                   GATGSVFHPGKKVKNSDLYIMEGGGGLENNARQFFNALKGLKEEIPHDTAVYVPNIALP
FT                   ENLAMLIYLGADVFDYTRATISAYNDIYLTSSGKFYLYNITELPCRCDACTSVTVDDLK
FT                   LMDAENRGIILEEHNKNMLDSELSLVREKIRKGYLREYVEGQCRTQPWLTALLRIADFD
FT                   QCYLEEQFPTTRTVQLTANTSESLNRPEITRFAERVQNRYTPPKKDILLLLPCSARKPY
FT                   STSNSHQKFIDTLGQYRKYVHELVLTSPLGIVPRELELTYPAAHYDIAVTGHWDADEVE
FT                   WVTDCLVNYLSKNKYSCVVAHVEGAYQKVCDLAARKLGIDIVYTCESDVTSKESLEVLK
FT                   DTIKNLAYERTQPKPMSKHNLMRAIADYQFGKGAGNILVPDDAVIKAPYPKHQVYLNKE
FT                   QIATLVPHHGTLSLTARGAELLIPHDNYVVKIGSFVPKGSILAPGIQEADVSIRPGDEV
FT                   LISGENAIGVGRALMSGREMEKSTRGIAITLRHVKKT"
FT   gene            36964..38337
FT                   /locus_tag="Metev_0036"
FT   CDS_pept        36964..38337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0036"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   mma:MM_1291 (S)-2-hydroxy-acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72968"
FT                   /db_xref="GOA:D7E5U6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5U6"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADI72968.1"
FT                   /translation="MKYIEKLREIVGKNRVRTSSPELYCYSCDASQIKGMPDYVVRPDS
FT                   TDQVSKIVQFANKHKIPVTSRGAGTGLAGGAVPISGGIVLDLSSMNRILDVDIENLQVA
FT                   VEPGVVHAKLNEKLKPYGFFFPPDPGSSAMCTIGGLIANNGSGMRSVKYGTSSRYALDL
FT                   EVVMADGTVINTGSKTLKTVAGYNLTGLMVGSEGTLGIITKAVLKIAPLPKARTVILAS
FT                   FENPELAGEGVVKTLSSGIVPSACEILDKTAIEALNAFDPNLNLPDVGAILMFEVDGTE
FT                   GAVEEEAKLIESACSSLATNVKSASTKQESEELWRARRLVGAAISRLDPNRTRVYVGED
FT                   VGVPIKEIPRMLKKVREISEEFNIPIMTYGHIGDGNLHTGMAIDVLDDSQWDSLNKAGD
FT                   KIHRTAIELGGTVSAEHGIGGARSEYMELELGPALDVMLNIKNALDPNNILNPGKLGV"
FT   gene            38346..39428
FT                   /locus_tag="Metev_0037"
FT   CDS_pept        38346..39428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0037"
FT                   /product="CoB--CoM heterodisulfide reductase"
FT                   /EC_number="1.8.98.1"
FT                   /note="KEGG: mbu:Mbur_1774 hypothetical protein; PFAM:
FT                   protein of unknown function DUF224 cysteine-rich region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72969"
FT                   /db_xref="GOA:D7E5U7"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5U7"
FT                   /inference="protein motif:PRIAM:1.8.98.1"
FT                   /protein_id="ADI72969.1"
FT                   /translation="MTESEDKSDSYLRSILKCVRCGTCRSVCPVFDELGWESSGARGRI
FT                   LVAHALSQGMDVDSDVLNSLNTCTTCGLCEQNCPSGAKPPDVIEDTRRQLVLKNKMTDK
FT                   QAELRENVTKYGNPLAETSDRYSWLGQDSADIKSRAEYVFFVGCLESYRYPEVAKTTFD
FT                   ILKKFDVTLLPNEHCCGSPLLRTGFEADDVTEENIEQIRKIGAHTVITGCAGCYTTFKN
FT                   DYPDEFNVKHVSEFLADHIDELGLKPLDITVTYHDPCHIGRKHGIYEAPRKVIKAICNL
FT                   KEMKTVRENARCCGGGGGVLSGYPELSHSIAETRMTEVPEGVDYVVTSCPLCRRNLSQG
FT                   NKNISVIDLIELVALAMKQN"
FT   gene            complement(39442..41277)
FT                   /locus_tag="Metev_0038"
FT   CDS_pept        complement(39442..41277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0038"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: mma:MM_1287 hypothetical protein; PFAM:
FT                   Radical SAM domain protein; Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72970"
FT                   /db_xref="GOA:D7E5U8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5U8"
FT                   /inference="protein motif:PFAM:PF08497"
FT                   /protein_id="ADI72970.1"
FT                   /translation="MKKSKHNIFLTSDFLPVSLEDANKRGWEELDVIIVTGDAYVDHPG
FT                   FGATIIGRVLEDEGFRVGIIAQPDWNNIDDFKKLGKPRLFFAVTAGNTDSMVSNYTSSL
FT                   KPRSSDAYSPGGEKNRRPNRATLVYTNRLKEVYPDVPIVLGGIEASLRRFAQYDYLSNK
FT                   VRKSILADAPADILVYGMGELQNKEIAKQLDNGKSVNEIQNIDGTVWKLAVKKWKKQKG
FT                   DYLNDYVEIASYDEVSTNKKSYANAFKTIYEEQDYINGKAIVQPHPKTIIVQNKPMRPL
FT                   TQQELDHVYELPFTREAHPSYKEPIPALDTVKFSITSHRGCFGNCSFCAITQHQGRIIT
FT                   SRSIESIVREATGFTERPDFKGTVSGVGGPSANMYGMECKKWHKSGVCKNKFCLYPEPC
FT                   PSLDTKHKKSIDMLRRLRQIPGVSKVLIGYGIRHDLALQDENYMEELCAHHVGGQLKVA
FT                   PEHFSDEVTDVMRKPGKQVFEEFASKFNEINEKLGKEQYLVSFLISGHPGSKIENMVEL
FT                   AEYIRDTGRYTEQVQDFTPTPMTVSTCMFYTGIDPFTGKKVYIPDSPKEKRIQRALMHY
FT                   RNPKNHKLVYEGLKKANRMDLVGNAWKCLISRRKK"
FT   gene            complement(41274..41921)
FT                   /locus_tag="Metev_0039"
FT   CDS_pept        complement(41274..41921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A0944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72971"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5U9"
FT                   /inference="similar to AA sequence:KEGG:Mbar_A0944"
FT                   /protein_id="ADI72971.1"
FT                   /translation="MHVQKINASPYDSNIYLINKKFLIDTGMDAAALIKELENHIDLNT
FT                   LDTIILTHCHFDHSGAASEVAEKSGAKIAIHEDDVECLKDNSASAADLFGYKAPGIEPD
FT                   IIYKDGDKVQIADDEYLQIIHTPGHTKGCICLYEPQSKSLFSGDTVFPSGSVGRTDLDG
FT                   GSADKLEQSIEKLTEFDVKVLYPGHGNVSVDNVNEQIKQSHQASKQLKYLQL"
FT   gene            complement(41960..42721)
FT                   /locus_tag="Metev_0040"
FT   CDS_pept        complement(41960..42721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0040"
FT                   /product="hydrolase, TatD family"
FT                   /note="KEGG: mbu:Mbur_1778 TatD-related deoxyribonuclease;
FT                   TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72972"
FT                   /db_xref="GOA:D7E5V0"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5V0"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ADI72972.1"
FT                   /translation="MSYNIIDSHCHLDFKKFNKDREEAIERANLNGVTELINSGIDYKT
FT                   NESSLKLSDKYPNIHATLGLSPMVASNSEDDVVDDILSHIEQNLETAVGIGEAGMDFYH
FT                   CKNESEKDDQLQAFKNVVELADSFDKTLVIHGRDAEDKLLNLVQHLDNVVFHCYSGSIE
FT                   TMKKITGMGYYISIATLVCFSKHHQSLVRELPIDKMLLETDSPYLSPYRGKRNEPAFIV
FT                   NSVDKIANILNTDASYIASKTAKNTHRVFGL"
FT   gene            complement(42736..44268)
FT                   /locus_tag="Metev_0041"
FT   CDS_pept        complement(42736..44268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0041"
FT                   /product="isopropylmalate/citramalate/homocitrate synthase"
FT                   /note="manually curated; TIGRFAM:
FT                   isopropylmalate/citramalate/homocitrate synthase; KEGG:
FT                   mma:MM_1284 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72973"
FT                   /db_xref="GOA:D7E5V1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011830"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5V1"
FT                   /inference="protein motif:TFAM:TIGR02090"
FT                   /protein_id="ADI72973.1"
FT                   /translation="MRGIVFYGTEHIRNKHISIFDTTLRDGEQTPGISLNTEQKLNIAQ
FT                   QLDKLGVDVLEAGFAVSTKGDRESVQAIANAGLSLDVCGLARVKREDIDACVETGVDMI
FT                   HTFVSTSDVQRIHTINKSREEVLEMAVDAVEYIKDHDIKCLFSAMDATRTDFDYLIDIY
FT                   KSVEGAGCDIINVPDTVGVMSPSSMYNLISDINNNVNIPIDVHCHNDFGLAVANSLMAV
FT                   EAGASQTQVTINGLGERAGNADLAETAMSLNSIYGAKTNINTKYIMETAKMVERYTGIN
FT                   IPAHMPIVGENAFAHESGIHTHGVLEKSDTFEPGIMTPEMVGQNRRIVLGKHAGKHAIK
FT                   KSLETAGIYPTDEQLNEIIDNIKSIADKGKRITDADLYTIASTVMGKPSGEDAIKLKEL
FT                   SVMTGNISTPTAVVKAVIRDSETIASNTGVGPVDAAIKAVEEIIGEYATINIHDFRIEA
FT                   ISGGSDALAEVTIGVEDEKGKIISARSASADIVIASVDALITSLNIMLKSKS"
FT   gene            44458..45492
FT                   /locus_tag="Metev_0042"
FT   CDS_pept        44458..45492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0042"
FT                   /product="phosphate binding protein"
FT                   /note="KEGG: afu:AF1356 phosphate ABC transporter,
FT                   periplasmic phosphate-binding protein (PhoX); TIGRFAM:
FT                   phosphate binding protein; PFAM: extracellular
FT                   solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72974"
FT                   /db_xref="GOA:D7E5V2"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5V2"
FT                   /inference="protein motif:TFAM:TIGR02136"
FT                   /protein_id="ADI72974.1"
FT                   /translation="MENIYIIYCEFGIGINMRKDALKKTSTKKTTLMLVGILIFSVALA
FT                   GCASNNGNGENQQLSGQVIVDGSSTVYPVSQAMAEEFKKQHPGVTTSVTSSGTGGGFKK
FT                   FVQGETDINDASRPIKPSESQKCKENGIEYVEFKVATDGISVVVNQNADWIDSVSKDTL
FT                   AEIWGPENPPQKWSDVKSEWPDKNVELYGPTSASGTFDFFTEHIVGEEDASRTDYQTTE
FT                   NDNFIIKGVRGSENAMGYLGYAYYQQNENSVKAIGINGVKPTEQTISSGEYPLSRPLFF
FT                   YVNIDHLKENEALREFVKFYIEKSDSEIINQVGYVPATESQQKDLMDKFEKVMNGNYEV
FT                   NYKS"
FT   gene            45638..46546
FT                   /locus_tag="Metev_0043"
FT   CDS_pept        45638..46546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0043"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="KEGG: nph:NP1980A phosphate ABC transporter
FT                   permease; TIGRFAM: phosphate ABC transporter, inner
FT                   membrane subunit PstC; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72975"
FT                   /db_xref="GOA:D7E5V3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5V3"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ADI72975.1"
FT                   /translation="MDNRLKIKRSNPKVLKERAIKSALFSCAFVSLLVTILIIATLLGD
FT                   AINFFTEVSIVEFLTGTNWSPSMKPYSFGVLPLVTGTLMITVISAAVAIPLGVATSVYL
FT                   SEYADKKVRKVVKPVLEVLAGIPTVVYGFFALTFITPVLQTIFPEISLYNALSAGIVVG
FT                   IMILPMISSLSEDAMSSVPDDLRDGGYALGASKFNVTTGIVVPASISGILSSFILGISR
FT                   AIGETMAVTIAAGRLANMSLDPLKSIETMTAAMVEVAEGDIAAGTAAYDSLFAIGLLLF
FT                   VITLAMNMVSQYLKSRYKEKY"
FT   sig_peptide     45638..45772
FT                   /locus_tag="Metev_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.878) with cleavage site probability 0.799 at
FT                   residue 45"
FT   gene            46547..47398
FT                   /locus_tag="Metev_0044"
FT   CDS_pept        46547..47398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0044"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="KEGG: nph:NP1982A phosphate ABC transporter
FT                   permease; TIGRFAM: phosphate ABC transporter, inner
FT                   membrane subunit PstA; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72976"
FT                   /db_xref="GOA:D7E5V4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5V4"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ADI72976.1"
FT                   /translation="MDIKSNKGDLKGQTFLFLLVIATCVGVASLAILVYSVLEDSIGWF
FT                   DLAFIFNSPSRFPEEAGIYPALIGSIYLMLLVAVFSFPLGVGTAIYLEEYAGQSRIKNI
FT                   IELNISNLAAVPSIVYGLLGLALFVRALNMGRSLIAGALTLTLLILPIVIVSSQEAIKA
FT                   VPDSLRDASYGIGATKWQTIRKIVIPEALPGIMTGTILSLSRAIGETAPLIMIGAATSM
FT                   YSAPDGIFSLFSAMPLQIYAWVGQPQYAFQEGVASAGILLLLIVLLTMNSVAILIRNRF
FT                   QR"
FT   gene            47405..48220
FT                   /locus_tag="Metev_0045"
FT   CDS_pept        47405..48220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0045"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: phosphate ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; KEGG: fps:FP0364 ABC-type
FT                   phosphate-transport system, ATPase component PstB; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72977"
FT                   /db_xref="GOA:D7E5V5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5V5"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ADI72977.1"
FT                   /translation="MPEINVEEALAGDSANVKSFNNSIIDVENLNLWYGESHALNEITL
FT                   EIPEKQVTAIIGPSGCGKSTFLRTLNRMNDRIPNVRIEGSIVYDGINIYEGDIDVATLR
FT                   KEVGMVFQKPNPFPKSIYENVAYGPRVHGVNDKTKLNEVVEESLKNAALWDEVKDRLDA
FT                   SAVDLSGGQQQRLCIARALAVEPKVLLMDEPASALDPVAMSKIEDLIYELKKNYTVVIV
FT                   THNMQEAARVSDYTAFFHLGELIEYSKTKKLFENPDKRMTEEYITGRFG"
FT   gene            48670..50146
FT                   /locus_tag="Metev_R0001"
FT   rRNA            48670..50146
FT                   /locus_tag="Metev_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            50229..50301
FT                   /locus_tag="Metev_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            50229..50301
FT                   /locus_tag="Metev_R0002"
FT                   /product="tRNA-Ala"
FT   gene            50512..53418
FT                   /locus_tag="Metev_R0003"
FT   rRNA            50512..53418
FT                   /locus_tag="Metev_R0003"
FT                   /product="23S ribosomal RNA"
FT   gene            53605..53677
FT                   /locus_tag="Metev_R0004"
FT                   /note="tRNA-Cys1"
FT   tRNA            53605..53677
FT                   /locus_tag="Metev_R0004"
FT                   /product="tRNA-Cys"
FT   gene            53700..53821
FT                   /locus_tag="Metev_R0005"
FT   rRNA            53700..53821
FT                   /locus_tag="Metev_R0005"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 88.72"
FT   gene            complement(54208..54567)
FT                   /locus_tag="Metev_0046"
FT   CDS_pept        complement(54208..54567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0046"
FT                   /product="alpha-NAC related protein"
FT                   /note="KEGG: mbu:Mbur_1786 nascent polypeptide-associated
FT                   complex protein; TIGRFAM: alpha-NAC related protein; PFAM:
FT                   ubiquitin-associated- domain-containing protein; Nascent
FT                   polypeptide-associated complex (NAC) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72978"
FT                   /db_xref="GOA:D7E5V6"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR005231"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR038187"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5V6"
FT                   /inference="protein motif:TFAM:TIGR00264"
FT                   /protein_id="ADI72978.1"
FT                   /translation="MFPGMGGRGMNPSKMKQMMKQMGISTEEINDVEQVIIRKSDKDIV
FT                   FNDASVTVMTAQGVDTYQIVGTPEEVEREVEIPDDDVKMVAEQAGTSEDAAREALKNTK
FT                   GDLAEAITKLSETSE"
FT   gene            complement(54620..54937)
FT                   /locus_tag="Metev_0047"
FT   CDS_pept        complement(54620..54937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0047"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="KEGG: mbu:Mbur_1787 HesB/YadR/YfhF; TIGRFAM:
FT                   iron-sulfur cluster assembly accessory protein; PFAM:
FT                   HesB/YadR/YfhF-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72979"
FT                   /db_xref="GOA:D7E5V7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5V7"
FT                   /inference="protein motif:TFAM:TIGR00049"
FT                   /protein_id="ADI72979.1"
FT                   /translation="MVNITDEAASELKSLLESEEKEDHALRIFIAGMGCSGIQYGLALD
FT                   NEIKEEDVTEESNGLKVVMSSDIEEGLSDATIDYVETEEGKGFVIDNPNPASCGSCSSC
FT                   Q"
FT   gene            complement(55059..56102)
FT                   /locus_tag="Metev_0048"
FT   CDS_pept        complement(55059..56102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1788 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72980"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5V8"
FT                   /inference="similar to AA sequence:KEGG:Mbur_1788"
FT                   /protein_id="ADI72980.1"
FT                   /translation="MKEDLKQILNDIFTSSQYNIIESNNYDLIASRNNYNIYINIGDQA
FT                   EYQKIRKLSNEINGNNQDGNSIGIYVVTDNPDERLYQYADKMGIILWGRDQLALQIGKA
FT                   VIADIEGEPCNLELVQPYSTAQSSQEYCNDSYYDYSVMNDTTSEQVEQNTEQETVKTDC
FT                   LNIKTAPINTSKDSAVSIAKAHLGKIQNATLKFVPYWKYNYSVYTEQNYKSKTIDISAE
FT                   DTGYLNALNGSHESLPVEKIIEYVEEPEYNYYIVSNSLTREEASSEILKNIIEKNTKNI
FT                   RFDKTAGEAIISEHKRFKPKSSDIDYNLELVYLPVWEVKDKRNSIEINGHNSEVFSKPT
FT                   GNDVEFM"
FT   gene            56382..56777
FT                   /locus_tag="Metev_0049"
FT   CDS_pept        56382..56777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0049"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: mba:Mbar_A1051 response regulator receiver;
FT                   PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72981"
FT                   /db_xref="GOA:D7E5V9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5V9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADI72981.1"
FT                   /translation="MSNINILLVEDDRLNRELISDFLNPHGYNIINAEDGFEALEKLED
FT                   YYVDLILLDIQLPQMNGLEFIYKLKNNFLFTDIPVVALTAHAMLGDKKKFIDAGCDGYI
FT                   PKPINVDVFESQVKQHLKNSEMVSVLQ"
FT   gene            56966..57328
FT                   /locus_tag="Metev_0050"
FT   CDS_pept        56966..57328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0050"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="KEGG: mma:MM_2019 phosphoribosyl-AMP cyclohydrolase;
FT                   PFAM: phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72982"
FT                   /db_xref="GOA:D7E5W0"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5W0"
FT                   /inference="protein motif:PRIAM:3.5.4.19"
FT                   /protein_id="ADI72982.1"
FT                   /translation="MVDLDNLNYENGLVMAVAQDFETNEVLMCAYMDKTALEKTVETGY
FT                   VHYWSRSRNKLWKKGESSGHLQLLHEMYVDCDMDAVLLKIKQMGASCHEGFYSCFYRTI
FT                   EGNIVGKKVFEPEDVY"
FT   gene            57381..59222
FT                   /locus_tag="Metev_0051"
FT   CDS_pept        57381..59222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0051"
FT                   /product="PilT protein domain protein"
FT                   /note="KEGG: mbu:Mbur_1791 ATPase; PFAM: PilT protein
FT                   domain protein; K Homology, type 1, subgroup; SMART:
FT                   Nucleotide binding protein PINc; AAA ATPase; KH domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72983"
FT                   /db_xref="GOA:D7E5W1"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5W1"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADI72983.1"
FT                   /translation="MKKKNDEEFRIVPDTSVIIDGRISEKVKSGKYKRSMIYIPEAVVS
FT                   ELEAQANRGLEVGYKGLEELRELRRLADSGEIDLKYTGTRPSLDQIKLVKGGEIDALIR
FT                   SVAADMDAMFVTGDKVQSEVAIAKGLKVEQLFPQSFEFKPLLIESFFTEDTMSVHLKNK
FT                   VPPMAKRGSIGDVKFVKIRDEPSTFKELKNISRELVERARSDPDSFTEMSANGAMVLQI
FT                   RNMRIAISNPPFSDDIEITAVRPVAAVTLDEYRLSDQLKQRIVDQRGILIAGPPGAGKS
FT                   TFAAGIAVYLKEKDFVVKTMESPRDLQVPKEITQYSPLDEDMANTADLLLLVRPDYTVY
FT                   DEVRKTRDFQIFADMRFAGVGMVGVVHSYRAVDAIQRLIGRVELGVIPQIVDTVIFIDK
FT                   GEVSKVQVLEFTVKVPYGMTEADLARPVITVSDFETGKTEFELYTYGEQVVVMPVGTES
FT                   KKPALKLAEGGIHEVIEQYVSGAFEVEMVSDEKAIVRVMEYDIPKIIGKGGSMIAEIER
FT                   QLGIHIDVQRIEEETPKRGEHTGKTFQPTVERTRKHVILTIPELSTEDVEVYAGGIYLF
FT                   TATVSRSGDIKVRKDSTIADSIIDAVDEGEVITVKVI"
FT   gene            59369..60670
FT                   /locus_tag="Metev_0052"
FT   CDS_pept        59369..60670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0052"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; KEGG:
FT                   mac:MA4457 UDP-glucose 6-dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72984"
FT                   /db_xref="GOA:D7E5W2"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5W2"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ADI72984.1"
FT                   /translation="MKVSVVGSGYVGTVTAACLAELGHQVICIDIDEERVNKINSGVSP
FT                   IWEQGLDELIQNHAGGNLKATSDYESAVNDSDISFICVGTPSDDYGNIDLSIVKSASES
FT                   LGYAIGSKDDYHVVVLKSTVVPETTENFVTPILEQASGKQAGKDFGVSMNPEFLREGKA
FT                   VYDFMNPDRIVIGALDKHSGDVVSHLYDKVECLNEFIRTNPRTAEMIKYANNSFLATKI
FT                   SFSNEIGNICKKLDIDTYEVMKVVGMDFRISPYFLNSGAGFGGSCFPKDVRALTGKSKE
FT                   IGYEPILLDSVIRVNENQPHRMIDLLEEKIGHLENKTITVLGLAFKNGTDDIRESRSVP
FT                   VIADLLYNGAKIKAYDPQANGNMKKVFSSVNYCDSAEEALYNSEACLVMTDWNEFKNLD
FT                   SEFGLMKNKVVVDGRRIIPFQNLEQEIDYVGICW"
FT   gene            60727..60909
FT                   /locus_tag="Metev_0053"
FT   CDS_pept        60727..60909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A3608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72985"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5W3"
FT                   /inference="similar to AA sequence:KEGG:Mbar_A3608"
FT                   /protein_id="ADI72985.1"
FT                   /translation="MAKSPSRVSGTANKKSILCYLGLHKWKRAGGSSHFSSNVREKEYR
FT                   CERCGRTKTVYETKV"
FT   gene            60960..61568
FT                   /locus_tag="Metev_0054"
FT   CDS_pept        60960..61568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0054"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="KEGG: mac:MA0913 imidazole glycerol phosphate
FT                   synthase subunit HisH; TIGRFAM: imidazole glycerol
FT                   phosphate synthase, glutamine amidotransferase subunit;
FT                   PFAM: glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72986"
FT                   /db_xref="GOA:D7E5W4"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5W4"
FT                   /inference="protein motif:TFAM:TIGR01855"
FT                   /protein_id="ADI72986.1"
FT                   /translation="MKKITIIDYGLGNLRSIRKALEKVGAKPVISSNPEEILDADGVIL
FT                   PGVGAFIDAMKNLQPLTDVIYEYVDTGKPLLGICLGQQILMSKSDEGGLTEGIDLVPGH
FT                   VRRIPSSELKVPHMGWNSITINKSHPLLKGISDGDYVYFVHSFYVDTDEFHTLSSCDYG
FT                   LSFAAVVVNEKGNVVGTQFHPEKSGKTGLKIVENFVNMC"
FT   gene            61592..62920
FT                   /locus_tag="Metev_0055"
FT   CDS_pept        61592..62920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0055"
FT                   /product="AIR synthase related protein domain protein"
FT                   /note="PFAM: AIR synthase related protein domain protein;
FT                   AIR synthase related protein; KEGG: mbu:Mbur_1802 AIR
FT                   synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72987"
FT                   /db_xref="GOA:D7E5W5"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR009186"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5W5"
FT                   /inference="protein motif:PFAM:PF02769"
FT                   /protein_id="ADI72987.1"
FT                   /translation="MDIEGYAKRSLLNGVEESELEDRLTSRILEVKNTSKNYARQLSKA
FT                   AIEEAKSTLNVTGDVLNPTISGITMGQFGVGSRGTGDFYTHEKIAEIIGNTGAFVDSSH
FT                   LDDSGAVVTENGSKYVIVTVDGMHSRLSDFSYLAGFHVARAALRDIYVMGARPVALLSD
FT                   IHVADDGDVAKIFDHIAGITTVSELIDVPLVTGSTLRIGGDMVIGDRMTGGVGAVGVES
FT                   HLTSRVQAKAGDVILMTEGAGGGTVSTTALYHGMHEVVDETINIKFLEACEALIESGLT
FT                   SDIHAMTDVTNGGVRGDAQEISRTAGLKLVFDESRMSKLVNSPVMEMLESLGIDYLGVS
FT                   LDSLLIISPEEYAEDIINTVKSSGVDIDIVGNVEEGSGSELIIDGERRDFTPRFRESAY
FT                   TPIKKMVGEDEPLDFENMKSAINKAADESLDKKKKIVDRIKKG"
FT   gene            complement(62922..64226)
FT                   /locus_tag="Metev_0056"
FT   CDS_pept        complement(62922..64226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0056"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   mbu:Mbur_1803 nodulation efficiency protein NfeD"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72988"
FT                   /db_xref="GOA:D7E5W6"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5W6"
FT                   /inference="protein motif:PFAM:PF01957"
FT                   /protein_id="ADI72988.1"
FT                   /translation="MDIRPNTYFLIIISLFFFIVMMSPCAIAQEEKVLVVEISDSITSA
FT                   SDDLVTNAISVAEDENYDAIVLTLNTPGGKLSETFNIIESIESTNVPVIGYVYPEGTKA
FT                   WSAGTIILISTDIAAMAPFSVIGSAQPVQLTGGGSQPINDSKTINAIVEYTREKARQNN
FT                   RNVTAAEEFITKNLNINAETALEYNVIEYTSPSIGDLLSQVDGDVAKGKQLNVSGAQID
FT                   RYEPSINIAIMSIISDPLIASLLLIIGLYSIVIGLSNPGFGAEIFGTIAIALGLIGSGF
FT                   DVNIAAIFLIIVGMGLIFLEIQSPGIGAFGIGGLICLIVGSIFIVPTDYPDFYTPAEIQ
FT                   QEIIIAIVTPSIIMGVFMLFIVYKIIEVRHRKPIIGEIVGNTAITNEKIKRGEEGYVKY
FT                   KGEYWKAKSDEEIDKGVKVEIIDKEGPTLVVKRAE"
FT   sig_peptide     complement(64140..64226)
FT                   /locus_tag="Metev_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.971 at
FT                   residue 29"
FT   gene            complement(64263..65159)
FT                   /locus_tag="Metev_0057"
FT   CDS_pept        complement(64263..65159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0057"
FT                   /product="band 7 protein"
FT                   /note="KEGG: mac:MA0916 erythrocyte band 7 integral
FT                   membrane protein; PFAM: band 7 protein; SMART: band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72989"
FT                   /db_xref="GOA:D7E5W7"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5W7"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ADI72989.1"
FT                   /translation="MVDYTILIPAIIVVLIILSQAIKIVKEYERVVVFRLGRFLGEKGP
FT                   GLFIIIPIVDTVVKVDLRVVTIDVPKQAVITLDNVTIDVDAVVYYRVTSPGDAVTAVEN
FT                   YKYATAMLSQTTLRDILGQVEFDDVLSKRDEINQKIQNVLDSLTDPWGIKVTNVTIRDV
FT                   VLPESMYRAIARQAEAEREKRARTILADGEFKAAQKNRDAGELYQEMPAGLKLRELQTY
FT                   AEISREKNMIVVTDTTNVDTGKIAALSNAVVKGSSGQKEQYKSSTPRREETQPKSETRI
FT                   DELVESSKQESGEMGEK"
FT   gene            65298..67433
FT                   /locus_tag="Metev_0058"
FT   CDS_pept        65298..67433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0058"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein; nucleic
FT                   acid binding OB-fold tRNA/helicase-type; RNA binding S1
FT                   domain protein; KEGG: mma:MM_2034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72990"
FT                   /db_xref="GOA:D7E5W8"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5W8"
FT                   /inference="protein motif:PFAM:PF01368"
FT                   /protein_id="ADI72990.1"
FT                   /translation="MSEECIECEGRGYQIISVEKCPECKGTGKTKSVDLMKLTEQDVDD
FT                   FLSDGSYCPKCEGSGQIETTKYCETCKGRGIFYKCKVCGTSIDEPVDDEEICRVCAKSQ
FT                   VVYALDNSCDLDEVEVGQLYHGIVDGIAAFGVFVNLNAHIRGLIHIKNLKEELDIGDPV
FT                   IVYVKEIKSNGNVDLVPKNIKEFHTVELEKELPIKLSSQIPDFIGRVVRIEGEVIQVKQ
FT                   TAGPTIFTISDEAGLITGAAFEKAGERAYPHIDSNMVVTATGEITSRGDEVQLEIKSMK
FT                   RLSGEKESAVWERIEKAIDERAEPYESEFLIESEILDKLKPGMKKVAKEIRKAVIKSKP
FT                   IVIRHHADADGMTSAVALERAVLPLISEVSGSDAEYYLYRRSPSKAPFYELADVTKDLS
FT                   FALEDMERHGQKFPLILLVDNGSTDEDTPAMRQARVYGIDMIVVDHHNPDEVVDQYLQS
FT                   HINPAHAGGDFGITTGMLCTEIASMINPDVKDEIYHLPAISAVGDRSEREEATKYINIV
FT                   SDKYSLDQLKDIALALDFEAFWLKFSSGKGIVNDILNFGDPMVHKNLVSILCEQANDLI
FT                   SSQMETCLPHVKSTTLPNGAIMNALDVENYAHKFSFPPPGKTAGEVHDRMCQEYENKPV
FT                   ITIGYGPDFTVIRSKNVKMNIPQIVRELHNEVKGGGVNGGGHLVVGSIKFVEGMRKEVL
FT                   EKLAEKLGQAEIEEGLG"
FT   gene            complement(67467..68078)
FT                   /locus_tag="Metev_0059"
FT   CDS_pept        complement(67467..68078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0059"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   mba:Mbar_A3471 orotate phosphoribosyltransferase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72991"
FT                   /db_xref="GOA:D7E5W9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR022854"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5W9"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADI72991.1"
FT                   /translation="MKNIDDMIEKAEELQSKGLVTGQIADELNVSRETITWLLTRAKKD
FT                   SKSPAPKDISVDWSMVGKNSCRLRYISNALADMTMESACETDSEIDTIVGIGLSGVPLA
FT                   SHIADDLDKELAIFHGTTKQNEDKRVPGTVSRNFGEVTGKNCVVVDDVITSGATITEVI
FT                   NQLRDFGANPVVVTVIIDKKGSEKISDVPVKSMVRIVRVD"
FT   gene            complement(68118..68609)
FT                   /locus_tag="Metev_0060"
FT   CDS_pept        complement(68118..68609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA0920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72992"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5X0"
FT                   /inference="similar to AA sequence:KEGG:MA0920"
FT                   /protein_id="ADI72992.1"
FT                   /translation="MKYYIADSAVFIMDGFKNINYSSFITVASVTEELKSDEAVMRYDI
FT                   ARENGIIVEVPEPDKRNSVIETARYTRDLNELSKADIDILAKALEYRDKENITLLTDDY
FT                   AVQNVAELLKINIEPVAQKKIKDKLVWEKECIGCKKRFECGDTCPICGSKLKRKSKRKV
FT                   "
FT   gene            68699..70186
FT                   /locus_tag="Metev_0061"
FT   CDS_pept        68699..70186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0061"
FT                   /product="Carotenoid oxygenase"
FT                   /note="PFAM: Carotenoid oxygenase; KEGG: gme:Gmet_2446
FT                   twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72993"
FT                   /db_xref="GOA:D7E5X1"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5X1"
FT                   /inference="protein motif:PFAM:PF03055"
FT                   /protein_id="ADI72993.1"
FT                   /translation="MDDSEPLDNTSFPSLDEQDTPSPLGLATSVDGEYSYEAEIEGTIP
FT                   NDLKGTLYLNGPGLFDRGNLRKRYIFDGDGMIQSFHFHEGGVYYQNKFVRTDKFVDEQE
FT                   KGKLLYASWTTLAPGGPISNIFGRKLESQAGVTVIERNGKLYAFDDGSYIYELDPDTLE
FT                   TKGKTQLGLNKSKIPVNFMAHSKIDGQTEEWILVSGLKDKLNITTVDKNDNLVKFQKVK
FT                   IPKNSYIHDFFVSDNHIILNFQPAEPYVFKFMSGLSSFLESLYWRPKQGNILLVLNRNE
FT                   EGEVEPYQFSVESSWMWHTLNAYEEGNKIVADFVGYRYPEQIFGDDPTFYAIMEGREKK
FT                   SDYPGEIRRYIIDLDKETVQQQVLDGANYEYPVVNQYHSCRKHKYGYFVRAHKPEDVFW
FT                   SSVVRMDMDTGLPEFYDFGKGYYCTEPVFVPKPGYNYSSDINDEPGWILTEVYDSYLKK
FT                   SFLAILQADNLESGPVAKVHLKHHVPLSFHGFWKSSQ"
FT   gene            70254..71045
FT                   /locus_tag="Metev_0062"
FT   CDS_pept        70254..71045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0062"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="TIGRFAM: NAD+ synthetase; KEGG: mbu:Mbur_1809 NAD
FT                   synthetase; PFAM: NAD synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72994"
FT                   /db_xref="GOA:D7E5X2"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5X2"
FT                   /inference="protein motif:TFAM:TIGR00552"
FT                   /protein_id="ADI72994.1"
FT                   /translation="MDYDRARSIIVNFIRSKVKEADSTGVVIGLSGGIDSAVTANLAVE
FT                   ALGSENVLGIHLPEEGVTSTKDSKDSEIIANSLGINFKNIDISRILNCFISEIPDESGE
FT                   KPPVVGNLKSRIRMCLLYYYANSFYKMVVGTGNKSEIMLGYFTKYGDGGVDLEPIGDLY
FT                   KTEVFELAKLLSIPEHIINKKPSAGLWSGQTDENELGLPYEIIDRILNLVFHGEKPENL
FT                   QEIFDLTPDQIDLLLSRMKSNIHKRKVPPIAIVDAARHYME"
FT   gene            complement(71052..72335)
FT                   /locus_tag="Metev_0063"
FT   CDS_pept        complement(71052..72335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0063"
FT                   /product="domain of unknown function DUF1743"
FT                   /note="PFAM: domain of unknown function DUF1743; nucleic
FT                   acid binding OB-fold tRNA/helicase-type; KEGG:
FT                   mba:Mbar_A2319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72995"
FT                   /db_xref="GOA:D7E5X3"
FT                   /db_xref="InterPro:IPR013696"
FT                   /db_xref="InterPro:IPR024913"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5X3"
FT                   /inference="protein motif:PFAM:PF08489"
FT                   /protein_id="ADI72995.1"
FT                   /translation="MIIGIDDTDSREGMCTTYLGAILIEELTVYGSIRGYPILVRLNPT
FT                   IPYKTRGNAAIAIQIDTKYPDKVIEYVISKIESLAEMQSEKTNPGVVFVHDREYNKSKS
FT                   ALKDFFYDTVHNVMAIENAKNLISKLGLIAKGYKKERGLIGALAATGAMLDSEWDSTYE
FT                   YLTYRKKEKWGLSRVVDENSIYKSDLDFYPDTWDTVDWENYVIVCVPKSPDPVLYGIRG
FT                   KDDHTVKSATEDIKSETVERSAVYKTNQGTDMHLINVSSIKEVTDMQSYIVQGTVKNHP
FT                   YTIEGGHTIFTLGDNSGNTIDCAAYEPTKNFRYLVRKLKTGDNITVYGSVKNQTLNIEK
FT                   FKINRLVPIYETRNPTCPICNKRMKSAGKNQGFKCRKCKTKAGSSVLVEIDREIETGLY
FT                   EVPPSARRHLAKPLVRFMSSNYNIFPSR"
FT   gene            72403..73389
FT                   /locus_tag="Metev_0064"
FT   CDS_pept        72403..73389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0064"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: mbu:Mbur_1811 hypothetical protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72996"
FT                   /db_xref="GOA:D7E5X4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR020886"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5X4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADI72996.1"
FT                   /translation="MTKDILIHQIVDVLKRANFVVSKRCNIRPRSFDITARKDDILIFC
FT                   KALYNIDGLNEETAQEMKSLAKYLDGSALIVGAKTRNQMLEDGVVYIRYGIPALNVQTL
FT                   YDYFVESVPPLVSAAPGGLYVSIDGDVLREARMSVSMSIGTIASQLGVSRRTISKYEEG
FT                   GMDASIDIALQLEELFDVALAKSIDVLEFFDNKLQEDEENNEYETKPPEDNILNLISTL
FT                   GYDVLSTNQAPFRGVSKKDTDVILTGISKYCNSMIKRAELMSSISNVTGSQSVFIIKDQ
FT                   CNLKSESFDSTVFIKRDELNKLLDPEDLLQLIEERMKNNNKSRSESN"
FT   gene            73466..74044
FT                   /locus_tag="Metev_0065"
FT   CDS_pept        73466..74044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0065"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="KEGG: mac:MA3522 phosphoribosylglycinamide
FT                   formyltransferase; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72997"
FT                   /db_xref="GOA:D7E5X5"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5X5"
FT                   /inference="protein motif:TFAM:TIGR00639"
FT                   /protein_id="ADI72997.1"
FT                   /translation="MVVNIAVLASGRGTNLQSIINNVENGYIHDANIKAVISDVRDAHA
FT                   LERAKKYGISAVFIDPSEFSDKSEYEKELIKKLEEFNTDLVLLAGFMRILGNKFVRFYK
FT                   HRILNIHPSLLPAFKGLRAQKQALDYGVKVSGCTVHYVTEDMDSGPIILQECVPVYEDD
FT                   TEETLENRILQEEHEIYPEAVKLWVEGKV"
FT   gene            74134..75369
FT                   /locus_tag="Metev_0066"
FT   CDS_pept        74134..75369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0066"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="KEGG: mbu:Mbur_1813 serine hydroxymethyltransferase;
FT                   PFAM: glycine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72998"
FT                   /db_xref="GOA:D7E5X6"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5X6"
FT                   /inference="protein motif:PRIAM:2.1.2.1"
FT                   /protein_id="ADI72998.1"
FT                   /translation="MSYISEIDPEIAEAMELEAKRQDYKLNLIASENYTSRAVMEAQGS
FT                   IMTNKYAEGYSGKRYYGGCEYVDIAENLAIDRAKQIFGAEHVNVQPHSGSNANMAVYFS
FT                   VLEYGDTIMAMDLSQGGHLSHGSPVNFTGKFYNVVPYGVNKETETIDYDELMDIAKENK
FT                   PKMIVAGASAYSREIDFKRFREIADEVGAYLLADIAHIAGLVAAGVHQNPVPYADFVTT
FT                   TTHKTLRGPRGGMIMCSEDYAKAIDKTVFPGIQGGPLMHVIAGKAVAFKEAQTPQFKKD
FT                   LEQTVKNAKALCKNLEDRGFTIVSGDTDNHMMLVNLNDFDITGKDAETVFSKAGIVLNK
FT                   NTIPSETRGPFITSGVRVGTPPITTRGMKESEMEDVADFLKQAIDNRNDDSELEKISAD
FT                   VQQFASSYPIYK"
FT   gene            75385..76251
FT                   /locus_tag="Metev_0067"
FT   CDS_pept        75385..76251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0067"
FT                   /product="Methylenetetrahydrofolate dehydrogenase
FT                   (NADP(+))"
FT                   /EC_number="1.5.1.5"
FT                   /note="KEGG: mbu:Mbur_1814 methenyltetrahydrofolate
FT                   cyclohydrolase; PFAM: Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, NAD(P)-binding domain;
FT                   Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADI72999"
FT                   /db_xref="GOA:D7E5X7"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5X7"
FT                   /inference="protein motif:PRIAM:1.5.1.5"
FT                   /protein_id="ADI72999.1"
FT                   /translation="MPEGQNYDPKIIDGRSLSKKIESEVSSKVQNLKDRYNITPSLSTI
FT                   VVGDDPASKMYVKLKHKACDRVGIIAEDHFLSEDTTQDELIELVHSLNSRDDIHGILVQ
FT                   LPLPEHINEQKVMMEIDPLKDADGFHPQNMGNLLIGNEEFVPCTPKGIMTALEEYDVGI
FT                   EGSDVVVVGHSNVVGKPMATMLLNRNATVSVCHVYTSNLNRYTVNADILIVATGVKHLI
FT                   KSDMVKEGVVVIDAGISKEGDKVYGDVDFDNVKQKASLITPVPGGVGPLTIATLMQHVL
FT                   KSAQNKI"
FT   gene            76317..77561
FT                   /locus_tag="Metev_0068"
FT   CDS_pept        76317..77561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0068"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="TIGRFAM: dihydropteroate synthase; KEGG:
FT                   mbu:Mbur_1815 dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73000"
FT                   /db_xref="GOA:D7E5X8"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5X8"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADI73000.1"
FT                   /translation="MDGTGKIMAVDSDICGLKVGDEHPVRLMGVINLSQESFYKNSVID
FT                   KDSIINTAQDMVDKGATMIDVGGRSTWPLAEKITKKQETERLLPALEELKGNVDAVISV
FT                   DTMFADIAEESLKRGVDVVNDVSGLTADSRMVDLIADYDCPAVVMASYQTPGDPFGMDA
FT                   VMDSLSSIIKKAESKDIDPNKLILDPAFGKWVPEKDPIYDFETADQFERLKIFEKPLLA
FT                   AVSRKSMIKAVTGKPAEERLYGSLAATSLVVHKGADIIRTHDIHQTKDVVDVAKAIRSR
FT                   SPYVRKNGFEVSVLDVNHPSDAAYLIQSIGATTSGSNVMKKKSVYRVLRINNITTTEAL
FT                   IIKQEMLARGADAAISRDAVSHEDESTDVILMGTLLQIEQLVDKLSCQARNLPLIADMI
FT                   EETLEQYTDTKYLYQ"
FT   gene            77572..78195
FT                   /locus_tag="Metev_0069"
FT   CDS_pept        77572..78195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA3515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73001"
FT                   /db_xref="InterPro:IPR022026"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5X9"
FT                   /inference="similar to AA sequence:KEGG:MA3515"
FT                   /protein_id="ADI73001.1"
FT                   /translation="MIISSSKSFEEILESLKGENKIFVIGCDVCAAKMHTGGEPEVKDM
FT                   CARLEKAGKNVVGWALPTGTCSIHSYGSLVEKNTNIKKADAILVMACGSGTSIIAKLVD
FT                   VPVYPANNTDSLGGIYQGNVFHAQCAMCGNCTIADFGGICPTAQCPKGLLNGPCGGSMS
FT                   GKCEVNSDMDCVWELIYQRLEKLGRLDLLEKVIEPKDNVEDNSV"
FT   gene            78228..79103
FT                   /locus_tag="Metev_0070"
FT   CDS_pept        78228..79103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0070"
FT                   /product="methylenetetrahydrofolate reductase"
FT                   /note="PFAM: methylenetetrahydrofolate reductase; KEGG:
FT                   mbu:Mbur_1847 methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73002"
FT                   /db_xref="GOA:D7E5Y0"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Y0"
FT                   /inference="protein motif:PFAM:PF02219"
FT                   /protein_id="ADI73002.1"
FT                   /translation="MPSFGQKLKSGEFVVTSEITPPKGSDISSVLKISDTLKGWVDAIN
FT                   ITDNNRAVMRMSPLALGKILADTGHNVIMQMTCRDRNRLAIQSDLLGANALGIDSICIM
FT                   TGDHTTKGDHPGAKPVYDLDSVQLLSMVKKLTQGYDFSGNQLEGTPHFTVGVVSNIDIS
FT                   QKMQMMKLKKKAEMGVDFIQTQAVYDVDQFKEFTESVKHLSVPIIAGIIPLKSANMARF
FT                   MNNNIPGIKIGDDIISRLEEAKDPVYEGLAISAETINEIRDICNGVHIMPIGKSLNTVT
FT                   LLEMAGFSPE"
FT   gene            79128..80387
FT                   /locus_tag="Metev_0071"
FT   CDS_pept        79128..80387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0071"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="PFAM: thiamine biosynthesis protein ThiC; KEGG:
FT                   mac:MA0261 thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73003"
FT                   /db_xref="GOA:D7E5Y1"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Y1"
FT                   /inference="protein motif:PFAM:PF01964"
FT                   /protein_id="ADI73003.1"
FT                   /translation="MSATQIDCARDGILTPEMKYVAEAENLDETTILSYVANGKLVIMT
FT                   RDKNPPVAIGKGVTTKINVNLGTSSANVDPGSEIEKVKIADRYGADTITDLSMGGNISY
FT                   IRSRVFENTTIPITTVPIYQSIVEHGMNNVTSKDIFSTLEKHVDEGVSSVVLHCVDNNT
FT                   LGKLKGSERVMGMVSKGGSFTSVFMLTNECKNPFIQNFDAVLEILRKNDVVLSLGNTMR
FT                   SGCIHDLSDDAQMSEIETNIHLANRANEKGVQVIVEGTGGHVQANDIPDTVRYYKSLSE
FT                   YPLFVAGPLPIDVALGYDHIAGSVGASMASGAGADYLCYITPSGHLALPTPEQVREGLV
FT                   AFKIAGHIGDTIKYGMSDRDLMLSVKRRKFDWDGQIEMAIDPDKPKEMCPMEGPCTMCG
FT                   EYCAIKIMQNYLSGDNRYGN"
FT   gene            80377..81177
FT                   /locus_tag="Metev_0072"
FT   CDS_pept        80377..81177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0072"
FT                   /product="F420-dependent oxidoreductase"
FT                   /note="KEGG: mac:MA3512 hypothetical protein; TIGRFAM:
FT                   F420-dependent oxidoreductase; PFAM: protein of unknown
FT                   function DUF129"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73004"
FT                   /db_xref="GOA:D7E5Y2"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="InterPro:IPR008225"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Y2"
FT                   /inference="protein motif:TFAM:TIGR01916"
FT                   /protein_id="ADI73004.1"
FT                   /translation="MEINCPNMQMFGIKTPIIKSGDDILKAVGAGFENAGISPQDNDIL
FT                   ILAESAVATAEHRMIKLSDVKTSEMAKEYAQKYEIDPREMELILQECDEIIGGVPGAVL
FT                   TITRGNLSPNAGIDSSNAPDGYVILLPENAQKSAESIREGINKQFFCNLGVIIGDSRTQ
FT                   PMRLGCVGIALGTSGIVPVEDARGCQDLYGKSLNITHKATADNLVSAAQIIMGEAGECT
FT                   PAILVRGAPVDIVNESVEMHLFSRNECMYYSNISKNNKSLSKCQ"
FT   gene            81291..81560
FT                   /locus_tag="Metev_0073"
FT   CDS_pept        81291..81560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0073"
FT                   /product="Thioredoxin domain protein"
FT                   /note="PFAM: Thioredoxin domain; KEGG: mma:MM_0436
FT                   thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73005"
FT                   /db_xref="GOA:D7E5Y3"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Y3"
FT                   /inference="protein motif:PFAM:PF00085"
FT                   /protein_id="ADI73005.1"
FT                   /translation="MGKPILLDFSATWCGPCKMQKPIIDDLKEKYGDQVDIKEVDVDEN
FT                   GEMARNYNVMAVPTIVIEKDGEEVKRFTGLKQADVLSAELDKLL"
FT   gene            81653..82681
FT                   /locus_tag="Metev_0074"
FT   CDS_pept        81653..82681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM_0428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73006"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Y4"
FT                   /inference="similar to AA sequence:KEGG:MM_0428"
FT                   /protein_id="ADI73006.1"
FT                   /translation="MKISEQLIDLGIFVYRQKNATGTFKPHLSISFRSKKGRLHTFSID
FT                   TTRIPEKYTQPDAYLITHAHGDHHGKSAMLSNRSLCSDKTALALEARYGKKFNGKSVKI
FT                   GETIDVGDVSIYTYPTEHTVGSTAFYWENDVGTRILVTGDVKDASSLPDCDVLITEANY
FT                   GDPADLKCHFSDDLDGFRDIFESCNRVAFGAYAFGKAQRTVELLRNVGYNGAIEMEENT
FT                   LNLTQLLLDNPGELSGIGESDNNEVCVVPPHYLDDLPEDISKYNVTGRINKNQVYPSIQ
FT                   ISDHLDAFGLVDMVKSINPEITIVYHPKGHRPSKFSDYLNSIGIDSISIDNINNVLSNE
FT                   FI"
FT   gene            82798..83190
FT                   /locus_tag="Metev_0075"
FT   CDS_pept        82798..83190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73007"
FT                   /db_xref="GOA:D7E5Y5"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Y5"
FT                   /inference="similar to AA sequence:KEGG:Mbur_1853"
FT                   /protein_id="ADI73007.1"
FT                   /translation="MSESTPQKQGKGKKEGTEEQESTSKVKSPEAFEKTPEQRRKDRVE
FT                   GIIKTAVASILGIIAGVVAEYILGTGEGTTWYAIIVIIAIVTYYIQRVIYPQINISTKE
FT                   FGLKDWFYVEFLVVDFALVTWVLMLN"
FT   gene            83264..85042
FT                   /locus_tag="Metev_0076"
FT   CDS_pept        83264..85042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0076"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: mbu:Mbur_1854 putative ATPase RIL; PFAM: ABC
FT                   transporter related; metal-binding domain in RNase L
FT                   inhibitor, RLI; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73008"
FT                   /db_xref="GOA:D7E5Y6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Y6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI73008.1"
FT                   /translation="MRIAVLNYDRCQPRKCSKECHKYCPRVRTGDETIYFGEKGKPIIS
FT                   EELCVGCGICVDKCPYKAIMIIGLPEALKEPPTHRYGTNGFVLYGLPTPQAGRVTGILG
FT                   PNGIGKSTVVNILSGTLVPNLGEYKEESSWDRVIERYSGTQIQDYFRKLVNGKVNVSQK
FT                   PQYIDKIPKAFNGNTRELLEKADDRGVLNQLIERLDLDEIIDRNINELSGGELQRVAIA
FT                   ACMVKDAEFYFFDEISPYLDIYQRINVAQLIQELAQEKAVLVVEHDLAILDMLADVVHV
FT                   AYGVPGAYGVITYPKGVRIAINQYLKGYLPEENIRIRPEPIEFEVHPPRAEAEVETLVE
FT                   YGKFSKQYKDGFSLTSDGGSLKQGEVLGVVGPNGIGKSTFVKVLAGEIEPDDGELDFDI
FT                   NISFKPQYVKGDINLRVQDFLRSITSRFDTSYYQGEIARPLQIEELYDKMLPNLSGGEL
FT                   QRVAIAACLSRDADMYILDEPSAHLDVEQRSLATKAIKRFAENNKKTAMVVDHDIYMID
FT                   MLSERLIVFEGKPAVYGVAKRPSSMQEGMNKFLSNLDITFRRDDDTSRPRVNKPNSRLD
FT                   REQKSAGEYYYYGFDE"
FT   gene            complement(85046..85303)
FT                   /locus_tag="Metev_0077"
FT   CDS_pept        complement(85046..85303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0077"
FT                   /product="TM2 domain-containing protein"
FT                   /note="KEGG: mmq:MmarC5_1652 TM2 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73009"
FT                   /db_xref="GOA:D7E5Y7"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Y7"
FT                   /inference="similar to AA sequence:KEGG:MmarC5_1652"
FT                   /protein_id="ADI73009.1"
FT                   /translation="MDNTNEERLKNPLAALGLSLIFPGLGQIYNQQVKKGQMFFVIAII
FT                   LIVTMFAAVGFVLYPIFWIYNMYDAYTDAVKMNRGEIQTG"
FT   gene            complement(85392..86786)
FT                   /locus_tag="Metev_0078"
FT   CDS_pept        complement(85392..86786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0078"
FT                   /product="MATE efflux family protein"
FT                   /note="KEGG: mbu:Mbur_1925 MATE efflux family protein;
FT                   TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73010"
FT                   /db_xref="GOA:D7E5Y8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Y8"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ADI73010.1"
FT                   /translation="MNDRRELLNNEKISNLLLKLSAPAIAGMVIQALYNIVDTIFVGKA
FT                   LGEASAQGIGGLTVAFPVQMIMAGLGLIIGIGGASIISRNLGSNNIDRAEKTLGNVIFL
FT                   IFVFSALITVAVSLYINPIMKAFGATDTILPYAVDYLRIITYGCIFFIFAMATNNVVRA
FT                   EGNANMAMFTMVIAGVTNIILDPIFIFGFGWGVKGAASATIISQLIGSLFLVYYLFSGK
FT                   SILKLHIKNLIPQYDIIKENITIGLSPFARQSSSSLMVVVLNNVLAIYGGDVSIAVFGI
FT                   INRLFMFIFMPMIGIVQGLQPIVGFNYGARNFERVMESVRLSIIVTTVMASIGFAIFYA
FT                   FPEQLFGVFSNDPNLINSGKSAIRIMVLVVPLASFEFIGATLYQAIGKAKPSFVLSVSR
FT                   QILFLIPLVIILPGFFDLKGVWIAFPIAGFLSFMLSIFMMNREFKVLKGHIPDNGYEYE
FT                   IPQGTR"
FT   gene            complement(86982..87284)
FT                   /locus_tag="Metev_0079"
FT   CDS_pept        complement(86982..87284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73011"
FT                   /db_xref="GOA:D7E5Y9"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Y9"
FT                   /inference="similar to AA sequence:KEGG:Mbur_1855"
FT                   /protein_id="ADI73011.1"
FT                   /translation="MEMITITSILIFGIFSLLALLLLINVSSMMAILLLVSAPVVLVLL
FT                   IPETVIGFLTYQHMVLANGLVPVNNFHILLIIWSTLIGLILYTEFLTWYLSRNKA"
FT   sig_peptide     complement(87171..87284)
FT                   /locus_tag="Metev_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.595 at
FT                   residue 38"
FT   gene            complement(87300..89057)
FT                   /locus_tag="Metev_0080"
FT   CDS_pept        complement(87300..89057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0080"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; KEGG:
FT                   mbu:Mbur_1856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73012"
FT                   /db_xref="GOA:D7E5Z0"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Z0"
FT                   /inference="protein motif:TFAM:TIGR01451"
FT                   /protein_id="ADI73012.1"
FT                   /translation="MIKASRIIILLMLVFLIFQLVPAVSAYSFQDELIWEYGGEYKLSK
FT                   DERAKVGPYTIKIHEINPGTNPPSANVLIYQNNVYKEKLFFDTKANSENTYEDDLKIKI
FT                   HDINRNNVSVELYRHVYKKAWVKDTERKGFHKGDELKNGNYTVQVKEFKKKEVVLEVSN
FT                   PYKKNIFTDNYKEAESRKYYNEFMVRVASLYPEKGIVYLETYRPGNPDFSIDILNNKDS
FT                   YNPNKTIEYKVLVENIGNIPVQEVKLESSSNNGKIAQPVMVRNVIDQNKSKIFPVMIDP
FT                   PNNPIGENMATSFVVSGRDYRGNTYTDSKTVSTHINSYMKIEKEISKEDVTLYRENKND
FT                   TVQVSLIIHNMGKSKKLLDVTDEIPDSFTLIGNDSLEKSVVVNSDSTKKVTYQIKPTKP
FT                   GRYTLKPAVLEWVDEGNKYTTESSEKEIDVHSSWVQVDKSLSSDSINISNNVEVTINIE
FT                   NTGNRIANISFTDSIPEGLNLVSGDLQWSGKVGPKADKEITYTITTNESGRYVLPELEV
FT                   DINNNQTKAISNSAILYVDKGVVTEQKHEEPIITRIDATKFMVTAFMAILALLSLAPIS
FT                   AYINIKRKE"
FT   sig_peptide     complement(88977..89057)
FT                   /locus_tag="Metev_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.637) with cleavage site probability 0.496 at
FT                   residue 27"
FT   gene            89193..90008
FT                   /locus_tag="Metev_0081"
FT   CDS_pept        89193..90008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0081"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   mac:MA1827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73013"
FT                   /db_xref="GOA:D7E5Z1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Z1"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADI73013.1"
FT                   /translation="MGNGLLSQNIPYTELFVSDLVFAIAVLLAGFIFARILISLFNKGL
FT                   KKTHLPGLVIEFLSRFLSILLYVLVILAFAGALGFAVGSVFLGLSAVIGLILGFGMQDT
FT                   LTNLTAGIWIATLRPIDKDDYVTINGMFGKVEAVGMMATEILTPDNQFITIPNQLVWGS
FT                   AVINDTRMPIRRARVDVGVSYDTDLDKAIQVAFDVMKNNSMVLDDPAPAVITSELGDSS
FT                   VNLQLRAWANNEDVWTVKWDITSEIFKAYRKEGIEIPYPQMDVHLDKEG"
FT   gene            complement(90043..91179)
FT                   /locus_tag="Metev_0082"
FT   CDS_pept        complement(90043..91179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0082"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: mma:MM_1489 3-isopropylmalate dehydrogenase;
FT                   PFAM: isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73014"
FT                   /db_xref="GOA:D7E5Z2"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Z2"
FT                   /inference="protein motif:PRIAM:1.1.1.85"
FT                   /protein_id="ADI73014.1"
FT                   /translation="MTQYKVPVIPGDGVGPEIIAEGRKVIDAAGEKHGFDVDWIEFPNG
FT                   ADHYLETGELLSEDTLKELSNYKSIYLGSIGDPRVAPGVLEKGILLKARFYFDQYINLR
FT                   PVKLLDGVWTPLKNKNPKDIDFTVVRENTEDFYIGIGGRAKKGISEEELEVTRSMYSTK
FT                   FGLDIETDSEEIAYQIGMISKEGTRRVIKYAFDLAMKRNKDKHVASVDKANVLSDIYGF
FT                   WREQFNDISENYPEIDTDFNYVDAITMWFAKNPEWYDVVVTPNMFGDIITDLGAMIQGG
FT                   LGLAPGGNINPEGTSMFEPIHGSAPKYKGQDKVNPIATIWAGSMLVDQLGETEASNDIL
FT                   SAIEKSIAENKIKTYDMGGSSKTSEVGDNIARIIREDL"
FT   gene            complement(91234..91716)
FT                   /locus_tag="Metev_0083"
FT   CDS_pept        complement(91234..91716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0083"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="KEGG: mma:MM_1490 3-isopropylmalate dehydratase
FT                   small subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   small subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73015"
FT                   /db_xref="GOA:D7E5Z3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Z3"
FT                   /inference="protein motif:TFAM:TIGR02087"
FT                   /protein_id="ADI73015.1"
FT                   /translation="MKGKVWKFGEDIDTDAIIPGRYLIFNTPEELAKHAFEGIRPDFAE
FT                   NVKENDIIVAGSNFGCGSSREHAPLALKGTKIGCVIAKSFARIFFRNAINIGVPLLECS
FT                   ETDKIEEEDEIEVELSTGVIENKTKNEKYQATPLPDFVREIVDAGGLIEYTKKLVN"
FT   gene            91913..93109
FT                   /locus_tag="Metev_0084"
FT   CDS_pept        91913..93109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0084"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bbe:BBR47_32500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73016"
FT                   /db_xref="GOA:D7E5Z4"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Z4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADI73016.1"
FT                   /translation="MTAPIPKFSRKRQMFLLSIGTFCVFLGILSLIPLLPDISEDLNIS
FT                   KSHLGWVAGTFLIFMALLQVPFGLISDRFGRKVLIFSGIFIFGTGVGILSFASNFITLL
FT                   FARAVSGTGAAIFFQTSFTMVGDMFKYQERGRAMSVLAVATGFGTISGYSVGGIFGGIY
FT                   GWREVFMALAGIAFFVSFLSLFMRETRVEITERKTTSNVLQFSFDMFRKRTIVFITLIA
FT                   MLCDMAAIGASYVVPFFAKDAGITTAITGLIFIPHAAVSSLGASFSGWVSDIVGRKKPL
FT                   VIIAILGGCALFLLSQIPPISLIIAFNFAFVGLCFGPVVTLTSTLLVDEVVKVDSSIIA
FT                   TTMGTFNMVRWLGSAAGPVMAGIFLEFYGTRIAFILLSVTVFVSVLLAVGIKEKREYY"
FT   gene            complement(93106..94524)
FT                   /locus_tag="Metev_0085"
FT   CDS_pept        complement(93106..94524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0085"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; KEGG: mma:MM_2611
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73017"
FT                   /db_xref="GOA:D7E5Z5"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Z5"
FT                   /inference="protein motif:PFAM:PF03486"
FT                   /protein_id="ADI73017.1"
FT                   /translation="MNLDKEEIDPDVEYDVIIIGSGPAGMFAANELSDQNLKVLVVEMG
FT                   QDIENRQCSMDSVQQCTHCAPCDIMCGVGGAGTYSDGTLNLRPDIGGNLAKLTGDQDSA
FT                   WKLVDYVDDVFLKYGAPEIIPSYKTQEIEELKRRAASVGAQFIEIKQRHIGSDNTPALI
FT                   SRFKKGLDDKGVSFLLNTKVQDILVENNECRGIVLDNDKIIKSRYTMLAPGRVGGEWVN
FT                   NIVSKHSISAKYGGIDIGVRVEVPAIIMDPVTNINRDPKFHIQTQRYDDFVRTFCTNEH
FT                   GFVVKEEYEDFIATNGHSLRKKTSENTNFAFLVHIELTHPIENTTKYARSIAKLATTIG
FT                   GGKPVLQRMGDLRRGRRSTDGRLARNPVVNTLKDVTPGDISMAMPHRIVMDIIEGLETL
FT                   NQIIPGVASDSTLLYAPEIKFYAMQVQINQNMESSIKNLYAAGDGTGLSRDIVNAAATG
FT                   VMAARGILKTEEMV"
FT   gene            complement(94577..95644)
FT                   /locus_tag="Metev_0086"
FT   CDS_pept        complement(94577..95644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0086"
FT                   /product="IMP biosynthesis enzyme PurP domain protein"
FT                   /note="PFAM: IMP biosynthesis enzyme PurP domain protein;
FT                   IMP biosynthesis enzyme PurP; KEGG: mbu:Mbur_1626
FT                   5-formaminoimidazole-4-carboxamide-1-(beta)-D-
FT                   ribofuranosyl 5'-monophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73018"
FT                   /db_xref="GOA:D7E5Z6"
FT                   /db_xref="InterPro:IPR009720"
FT                   /db_xref="InterPro:IPR010672"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023656"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Z6"
FT                   /inference="protein motif:PFAM:PF06973"
FT                   /protein_id="ADI73018.1"
FT                   /translation="MVTEEQISEILQNYDFDNLAIATVCSHSSLQIFDGARKEGFKTIG
FT                   ICVGNPPKYYDAFPKAKPDEFIIVDSYKDIPNMTDKFIEKNAILVPHGSFVEYVGADNF
FT                   ANLKIPTFGNRDVLDWESNRTKEREWLERAGIHMPRVINPQDINGPVMVKYQGAKGGRG
FT                   FFIAKNYEEFKENVDPNENYVVQEFIVGTRYYFHFFYSPLREEGYKLSKGTLEMLSMDR
FT                   RVESNADEIFRLGSSKELEDAGINPTYVVTGNVPLVARESLLPHVFSLGEKVVEESLSL
FT                   FGGMIGPFCLETVVTDKLEIKVFEISARIVAGTNLYPSGSPYSDFIESDLSTGRRIAQE
FT                   IKLAKSMDKLEKILS"
FT   gene            95805..96638
FT                   /locus_tag="Metev_0087"
FT   CDS_pept        95805..96638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0087"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="KEGG: mbu:Mbur_1625 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: Pseudouridine
FT                   synthase I, TruA, alpha/beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73019"
FT                   /db_xref="GOA:D7E5Z7"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Z7"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ADI73019.1"
FT                   /translation="MKKRMALKLAYIGTEYHGSQVQPELPTIEGELFKSLKNLEIIDDP
FT                   KSANFVSSGRTDTGVHSLGQVVTFDTDNPRLAVPRVINSQLPESIWAWAYAVVPDEFNP
FT                   RHGAFSRRYLYIMSGEEYDISRIRTASKYLIGTHDFANFCTPVKGKSTVRTVQRINIRV
FT                   KGTLTLIDIQADSFLWKMVRKIVTALMMVGYGTRDTEWLEQMLNPEYYEEGIEPAPSYG
FT                   LILKDVDYLQPIEWEVDDYSIQKARNQLHQHLIRYRVMAEVLEHLVPQEKRYHEL"
FT   gene            complement(96839..97888)
FT                   /locus_tag="Metev_0088"
FT   CDS_pept        complement(96839..97888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0088"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; THUMP domain protein;
FT                   KEGG: mbu:Mbur_1623 putative RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73020"
FT                   /db_xref="GOA:D7E5Z8"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Z8"
FT                   /inference="protein motif:PFAM:PF01170"
FT                   /protein_id="ADI73020.1"
FT                   /translation="MLYAFELSGEHESLPVFEIFACLDVEELEYSEYAHFDQCLVVDIS
FT                   ENNKEVINKLDSVSNRLAMSHSILKVAGICDTDFDDIIKTTENLNINKHITPEQTYAVR
FT                   VNKVKHYTSINGEQLEKKVGGCIYRKGNEKSYRVNLRNPDIEFRLILTDKCIMGSVVAK
FT                   VDRSCFEDRAPHKRPFFYPGVLMPRTARTVVNLSKVKSGETLFDPFCGTAGILMETGLV
FT                   GINCIGLEVQYKIMAGACMNLDDLNLDYSLLMGDACRLPFVDESMDAIVTDPPYGKSAL
FT                   IKAESMNYLYAMSFKEMYRVLKKGKYAVIVTGNPVRELVKDAGFVLHKEHHQRVHRSLT
FT                   RVISVLYKK"
FT   gene            complement(97919..98206)
FT                   /locus_tag="Metev_0089"
FT   CDS_pept        complement(97919..98206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0089"
FT                   /product="Domain of unknown function DUF1805"
FT                   /note="PFAM: Domain of unknown function DUF1805; KEGG:
FT                   mma:MM_1497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73021"
FT                   /db_xref="InterPro:IPR014931"
FT                   /db_xref="InterPro:IPR036493"
FT                   /db_xref="UniProtKB/TrEMBL:D7E5Z9"
FT                   /inference="protein motif:PFAM:PF08827"
FT                   /protein_id="ADI73021.1"
FT                   /translation="MIIEQVNLHNGTGLGLNFNMHNAPIIVIKADKGFVMCGYLDINAA
FT                   NKLGDAAAKVKGVNSFEDVLNAKIIEASQPAKEMGIDTGMTGKEALEKMF"
FT   gene            98359..99072
FT                   /locus_tag="Metev_0090"
FT   CDS_pept        98359..99072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA0156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73022"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:D7E600"
FT                   /inference="similar to AA sequence:KEGG:MA0156"
FT                   /protein_id="ADI73022.1"
FT                   /translation="MYFRPYIKKSLEWLKKQKIDNVKDLSRLTVACDLWGIENHYAAKL
FT                   IHKKHNSSWNNSIRDTSRACSALANIGIIFPDAKEWLLNQKTDDSWNKDVYDTAYALIA
FT                   LSDMDVSENIGCDWLIENYDTNWEHVGTTSLVITALVKQEKLLSSNHYQNFIQNRAEWI
FT                   LSQSDKGGGWSYISTSNLAIQALMLAGYRNQLKPHIQWLLDNFNENGYWGYNNKKVIAT
FT                   AWSLMTLALYNSHEF"
FT   gene            complement(99087..99263)
FT                   /locus_tag="Metev_0091"
FT   CDS_pept        complement(99087..99263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0091"
FT                   /product="preprotein translocase subunit SecG"
FT                   /note="KEGG: mbu:Mbur_2117 preprotein translocase subunit
FT                   SecG"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73023"
FT                   /db_xref="GOA:D7E601"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="InterPro:IPR023531"
FT                   /db_xref="UniProtKB/TrEMBL:D7E601"
FT                   /inference="similar to AA sequence:KEGG:Mbur_2117"
FT                   /protein_id="ADI73023.1"
FT                   /translation="MPKKKSSNEGGMMSSAGLMRYYEADKRAIHLDPKPIVIFGLAVGV
FT                   GILALNASFGLWP"
FT   gene            99522..100526
FT                   /locus_tag="Metev_0092"
FT   CDS_pept        99522..100526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0092"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: tac:Ta0475 transposase related protein;
FT                   TIGRFAM: transposase, IS605 OrfB family; PFAM: transposase
FT                   IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73024"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D7E602"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADI73024.1"
FT                   /translation="MILTYKIKHDQDFSDELAKAKQVAEYGIKYRTRSSKDVKHIGLKS
FT                   AISNQILKKYANDKSAKKVTNVKLTIPNQGITLKKKERKIRITPLNLTLKYHFPDNFEK
FT                   INQIEVGEKYVYVSVTVPEREQIEPENYLGVDLNTTGHIAVMSNPKTGKIWKLGKKAQH
FT                   IHLKYKNDRRKLQVKGKYKKVKQVNDRESRIVRDLNHKISSKIVETAAANNCGIRMENL
FT                   EGIRDSAKCKKSFKYSLHSWSFYQLQFMLEYKARLLGVKIEFVEPEYTSQDCSRCGYLG
FT                   IRNGEAFKCPHCGHVDHADANAAFNIAMRSGDQCGADRDASYGSTGAPQVATV"
FT   gene            complement(100572..101591)
FT                   /locus_tag="Metev_0093"
FT   CDS_pept        complement(100572..101591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0093"
FT                   /product="translation initiation factor, aIF-2BI family"
FT                   /EC_number="5.3.1.23"
FT                   /note="TIGRFAM: translation initiation factor, aIF-2BI
FT                   family; eIF-2B alpha/beta/delta-related uncharacterized
FT                   protein; KEGG: mma:MM_1371 translation initiation factor
FT                   IF-2B subunit alpha; PFAM: initiation factor 2B related"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73025"
FT                   /db_xref="GOA:D7E603"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:D7E603"
FT                   /inference="protein motif:TFAM:TIGR00512"
FT                   /protein_id="ADI73025.1"
FT                   /translation="MRTIDWNDESNTIKLIDQTLLPSEYKVIECKTIESLCESIKSLRI
FT                   RGAPALGAAGGYGIALAAVLSKTDNMDNLTKDLQSAAETIKATRPTAVNLAWGVERVIK
FT                   ATSDAYDFEGMKNIAIEEAKQIADEDVAINKKIGEHGSKLLEDGDTVLTHCNAGKLACV
FT                   DWGTALGVIRSAIESGKNIKVVACETRPLNQGSRLTTWELMQDNIPVTLISDSMAGHVI
FT                   RHEAIDKVIVGADRITEDAVFNKIGTYTHSVLAKEHEIPFYVAAPTSTFDFKGWEGSVK
FT                   IEQRNADELRYFGNVQIAPENVNVYNPAFDATPMENISAIITENGVFHPPFLLDEVLI"
FT   gene            101737..102489
FT                   /locus_tag="Metev_0094"
FT   CDS_pept        101737..102489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0094"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: mbu:Mbur_2122
FT                   putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73026"
FT                   /db_xref="GOA:D7E604"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7E604"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADI73026.1"
FT                   /translation="MEIGEIVLLKTEYMGKSREYVATVSYDSFHTDLGIIDMDILLDKE
FT                   PGDTVTSHLNHEFHIRKLRTPDIFNHAKRTGAPMMPRDIGIIITNTGINKNDVVLDVGT
FT                   GTGILAMYLGSVAKRVVTYESNEEFFKVSRKNINSLGSDNIELRHGNFVDEIEHINEQF
FT                   DVITLDTVDAGKIVPYTVNLLRPGGYLAAYSPFFEQTKQIREAADNTNFIEVSTVECIE
FT                   RNISFTERGTRPASSRVGHTGFITIART"
FT   gene            complement(102500..103168)
FT                   /locus_tag="Metev_0095"
FT   CDS_pept        complement(102500..103168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0095"
FT                   /product="DNA repair and recombination protein RadB"
FT                   /note="SMART: AAA ATPase; manually curated; TIGRFAM: DNA
FT                   repair and recombination protein RadB; KEGG: mbu:Mbur_2123
FT                   DNA repair and recombination protein RadB; PFAM: Rad51
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73027"
FT                   /db_xref="GOA:D7E605"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011939"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E605"
FT                   /inference="protein motif:TFAM:TIGR02237"
FT                   /protein_id="ADI73027.1"
FT                   /translation="MSVRLPSGCKPLDNLLGGGFETGIVSQVYGEPGSGKTNLCIQLSV
FT                   ECVKQEKKVIYVDTEALSPDRFKQIAGDNSKEIAQNIIIYEPFNFEEQYSAIKDTEKIS
FT                   EENIGLIIVDSATAFYRFELENEDSSIQTRRELSNQIGYLHGLARKHSLSVVITNQIYT
FT                   DASTGEVKPIGGSGIEHLSKTILQFERTGNNKRRAILQKHRSRPEGETCEFMIGPDGLK
FT                   "
FT   gene            103523..103774
FT                   /locus_tag="Metev_0096"
FT   CDS_pept        103523..103774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0096"
FT                   /product="glutaredoxin"
FT                   /note="PFAM: glutaredoxin; KEGG: mbu:Mbur_2124
FT                   glutaredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73028"
FT                   /db_xref="GOA:D7E606"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7E606"
FT                   /inference="protein motif:PFAM:PF00462"
FT                   /protein_id="ADI73028.1"
FT                   /translation="MSEIIIYTTETCPKCEQLKKLLKSNNISFKEADMSTPEALTELRV
FT                   NGVFDVTAPILQIDDKFLTNDELFDGGEVDSNAISDIL"
FT   gene            103797..106127
FT                   /locus_tag="Metev_0097"
FT   CDS_pept        103797..106127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0097"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; KEGG: mbu:Mbur_2125 ribonucleoside-triphosphate
FT                   reductase, anaerobic"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73029"
FT                   /db_xref="GOA:D7E607"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:D7E607"
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /protein_id="ADI73029.1"
FT                   /translation="MEAYKLKSKTEDSESFSRGQQQGVQQTLDGDIVPEMPKVRTTEGY
FT                   MVDWDKNVIIKQLTKETKLAEKFFNISQVSYEDAKEIADLAEDRIRSMNIQFLSGPLIR
FT                   EIVNTLLIEKGHVEWRNICTRVGTPVYDAFEIDTGAGFEANDNANLQDNAETSHKKKAD
FT                   KISKEQYTLMLPPKLADLHLNGDLHIHDLEYFGTRPFCQDHDLRYFFYYGLMPDGSGTK
FT                   ASVAGPAKNAEVAVLHAVKALGSAQTNFAGGQGFYNFLTFLAPYMENKDYNEIKQLMQM
FT                   FVYEMTQMMVARGGQLVFSSVQLSPGVPELWVDKPVVSHGTVHDGYYAEHRTYGEFERE
FT                   VRLTFKALMEVMLDGDYWGKPFNFPKPEISIEPQFMEEDEEFNKQHPELPTYEDLYDLS
FT                   FELAAKFGTPYFDNQLPPYRGAGKGISCYQCCAYQFSADEDNDADFEDKLYFKEGKHFS
FT                   MGAWQVLTLNCPRSAYRANGDYDALISDLKRLMNRSVEVFLAKKQWMDYIIDNNRMPFA
FT                   SQRPKDPITGEKGSILVDTDSLVYTIGIIGINEMVQYYTGNQLHESKEAFRLAVRVMTE
FT                   LEMYAKDLSNKYGMQIALARTPAETTGQRFAVADLLQKDFASKAEQVIKGDVESAKQKL
FT                   SKDHDLPVYYTNGTHIPPSADISIIDRINYEHTFFPIVDGGNIMHIWMGEAHPDPKGLK
FT                   QFALNIAKNTQTGYFAFTKDMTVCMDDFHVADGLKDNCPNCGSDNVEFLSRVTGYIQAV
FT                   GGWNEAKKQELEDRKRYASVDML"
FT   gene            106142..106897
FT                   /locus_tag="Metev_0098"
FT   CDS_pept        106142..106897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0098"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="KEGG: mbu:Mbur_2126 ribonucleoside-triphosphate
FT                   reductase, anaerobic-like protein; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein;
FT                   PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73030"
FT                   /db_xref="GOA:D7E608"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7E608"
FT                   /inference="protein motif:TFAM:TIGR02495"
FT                   /protein_id="ADI73030.1"
FT                   /translation="MQFNHGATVPISTIDWHGKVSIVISFRGCPFRCPYCHNYELLTGS
FT                   NFVDISEIESQINKSKIFVDNVVFTGGEPFMQPDALKHLVGFAKQNNLLVGINTNGFYP
FT                   ERIKEIICEGKVDKFFVDLKAPLDNVDLYRKISGYNSSDYPEPVNRVAESLKILYENGV
FT                   EFELRTTVVRDFIGNSDDITKISGWISKHLSKDVPYVIQRGIPEHSKDSDLHGIKPLER
FT                   EEILGLSEYACNYLNDVRINTDLGYEKVC"
FT   gene            complement(106894..107325)
FT                   /locus_tag="Metev_0099"
FT   CDS_pept        complement(106894..107325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A2967 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73031"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7E609"
FT                   /inference="similar to AA sequence:KEGG:Mbar_A2967"
FT                   /protein_id="ADI73031.1"
FT                   /translation="MTELEQEKFWNYDNFVVITDKTKPAMKLTIKELGNRNKNINVVDL
FT                   SDKPDPDTLKNISDIPDGMENAVIGTTKYNPADFINTLQDKGVKRVWVHWRTSTPELDE
FT                   ASRKSEMEFITDKCPMMYMGSPFSIHGLHRSIAKLTGKY"
FT   gene            complement(107365..108054)
FT                   /locus_tag="Metev_0100"
FT   CDS_pept        complement(107365..108054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0100"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDB_0214836 Rab GTPase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73032"
FT                   /db_xref="UniProtKB/TrEMBL:D7E610"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73032.1"
FT                   /translation="MTEDSDNKNNTDSNNENMYKNVNTSDLCNFGNGLDTIASPFTGLI
FT                   AGIEYTPHKAQGLQSPSEMWIDKNNLYDNIGYSNPNENEDTDKTGECNKLNGLFTIGRG
FT                   LETLESPVTGIVTGFDDIHAQGLHSASDMRLDSDGVTNVTEQNPYINQKHPEHSETKNN
FT                   DLKDRDINQFDSLGSQENITSNTIDRVQHKSSGLQSPSEMWIDKSKLLSDGIKHDKITE
FT                   KYLENLD"
FT   gene            complement(108095..109588)
FT                   /locus_tag="Metev_0101"
FT   CDS_pept        complement(108095..109588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0101"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="KEGG: mbu:Mbur_2361 cobyric acid synthase; TIGRFAM:
FT                   cobyric acid synthase CobQ; PFAM: CobB/CobQ domain protein
FT                   glutamine amidotransferase; Cobyrinic acid ac-diamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73033"
FT                   /db_xref="GOA:D7E611"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D7E611"
FT                   /inference="protein motif:TFAM:TIGR00313"
FT                   /protein_id="ADI73033.1"
FT                   /translation="MKSKTNGDTKSLLILGTASHVGKSAIVTALCNVFSRNYRVAPFKA
FT                   QNMSLNSWITKDGKEIGIAQAIQAKAAGVEPTADMNPILLKPKGDRQSQVIILGEPYAD
FT                   KTAGEYYDSIEDTHEILKGSLDRLSDEYEIIVMEGAGGAAEINLYERDVVNIGTARATN
FT                   APIILVGDIERGGVFASLYGTIELLPEDVRKRVSGFIINKFRGDPEILNPGLEELEKRT
FT                   GIPVLGVLPFSSINIPSEDSVSINDKSNNNDSSNDVEIAIIRLPRISNFTDFEPLEKLA
FT                   KVNYVDLEDNLGNPDAVIIPGTKNTISDFVDLRESGMYDQIKKLHGKIPIIGICGGYQM
FT                   LGTKIHDSGVEGEQKAEYEGLGLLDIETIFDAYKKTTVQTTKTITCGGPLLEPIKGEKI
FT                   SGYEIHMGDTTSQNFVFDDDGCMDDTGLVFGTYLHGLFENENIRNSFVRYLCEKKGLEF
FT                   KPQKIISQQEAYNMLGDMVSDGLDMEKLYDILGIGSGKV"
FT   gene            109676..110242
FT                   /locus_tag="Metev_0102"
FT   CDS_pept        109676..110242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0102"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /note="TIGRFAM: precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; KEGG: mbu:Mbur_2360
FT                   precorrin-8W decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73034"
FT                   /db_xref="GOA:D7E612"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR023475"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7E612"
FT                   /inference="protein motif:TFAM:TIGR02469"
FT                   /protein_id="ADI73034.1"
FT                   /translation="MSNLLYISGGPTKPEVISVSLSKLDLHDGDTFVDLGCGTGAVSIE
FT                   ASKMRQGLKIYAIDSRSEAIDTAAQNFETYQLQDVNLIHGESSKVLTENADIDSIDCAF
FT                   IGGTKNINQVLEILVDKGVNNLVINAVRMETVVKAMQKMRNMDIFDEVLHLSVSHGTPI
FT                   AGETMFKPDNPVYIIVGKSQSRLNQ"
FT   gene            110269..110901
FT                   /locus_tag="Metev_0103"
FT   CDS_pept        110269..110901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0103"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: mbu:Mbur_2359
FT                   cobalt-precorrin-2 C(20)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73035"
FT                   /db_xref="GOA:D7E613"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D7E613"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADI73035.1"
FT                   /translation="MLIGVGLGPGDPELLTLKAVNTLKKSSKVYVPGRLAAELVEPYAD
FT                   PEILEFPMLKDYDVLNDVWKQNAEIVAEDARDDLVSFGLIGDPNFFSTFSHLERVLNRL
FT                   YPEVETDTIPGISSITAFASRTRTPVYSSFEVNDGSDIDSKVVLKAKKPREIMGEMRKE
FT                   GFNDFAFAQRLFMDNEVVIKDVDKIPEKGNYFSIMYGRKSNQVNNNE"
FT   gene            110894..111625
FT                   /locus_tag="Metev_0104"
FT   CDS_pept        110894..111625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0104"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="TIGRFAM: precorrin-4 C11-methyltransferase; KEGG:
FT                   mba:Mbar_A0627 cobalt-factor II C20-methyltransferase /
FT                   precorrin-4 C11-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73036"
FT                   /db_xref="GOA:D7E614"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D7E614"
FT                   /inference="protein motif:TFAM:TIGR01465"
FT                   /protein_id="ADI73036.1"
FT                   /translation="MNDNKVYFVGSGPGDAKLITVKGKELLENADTVIYAGSLVNPEIL
FT                   DYSNGEMMDSYGMTLDEITSKIVDDVKSDKMVVRLHSGDPSLYGSILEQMDELKKHDID
FT                   VEIVPGVSSVFASASSLKTQMTLNGVSDSLIITRPAGKTLDEDKINELSKHHETMAIFL
FT                   GTQKIDQIMEKVDYPSDTPVAVIYHASWDDEKVIKGTVSDISQKVKDAGVKRSAMIIIG
FT                   GVVDPIEFRRSYLYGVPQEPL"
FT   gene            111598..112493
FT                   /pseudo
FT                   /locus_tag="Metev_0105"
FT   gene            112462..113256
FT                   /locus_tag="Metev_0106"
FT   CDS_pept        112462..113256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0106"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /EC_number="2.1.1.131"
FT                   /note="TIGRFAM: precorrin-3B C17-methyltransferase; KEGG:
FT                   mbu:Mbur_2356 precorrin-3 methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73037"
FT                   /db_xref="GOA:D7E615"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D7E615"
FT                   /inference="protein motif:TFAM:TIGR01466"
FT                   /protein_id="ADI73037.1"
FT                   /translation="MAESQSQSQNKHGKLYVVGIGPGSVEYLTIHARDVIQNSDYVIGN
FT                   GTYLDQIESLLNGQEIIRSSMGKEVDRASRAVELAQSSVVSMVSGGDANIYGMAGLVLE
FT                   VAENAKQDVEVEIVPGVTAITASASILGSPIVNDFAVISLSDLLTPWDMIEKRLDSAAS
FT                   TDFVISLYNPKSRKRNSNFARAIEIIKQYRDGSVPVGLVKNALRDEKQDYIVTTLDNVL
FT                   DYEDWVDMRTTVLVGNSESRIWSQSGSDRIITPRGYHRKYEY"
FT   gene            113246..113977
FT                   /locus_tag="Metev_0107"
FT   CDS_pept        113246..113977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0107"
FT                   /product="Precorrin-8X methylmutase CbiC/CobH"
FT                   /note="PFAM: Precorrin-8X methylmutase CbiC/CobH; KEGG:
FT                   mbu:Mbur_2355 precorrin-8X methylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73038"
FT                   /db_xref="GOA:D7E616"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:D7E616"
FT                   /inference="protein motif:PFAM:PF02570"
FT                   /protein_id="ADI73038.1"
FT                   /translation="MNTKSKNSQEDSGDDNLDEFVEFTTDIDPELVEICNDSGAQTKEA
FT                   KAIYMTSRNIARKIVGDETPEDRIRQRCVISTGDPSVAEIMKFKNDPINSGVDAIKKGS
FT                   PIFVDIRMVKAGITTKGHNCDVICVLDRDENAEIAHKYGITRTAAGFLKCKDEIEGAII
FT                   AIGNAPSAAITVCRLIEHGVRPALVVGTPVGFVNSAESKEMVRNMDVPSITCEGTRGGT
FT                   PIAVACVNELVSIAHEKQECE"
FT   gene            complement(113978..114646)
FT                   /locus_tag="Metev_0108"
FT   CDS_pept        complement(113978..114646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0108"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: mba:Mbar_A1715 cytochrome c-type biogenesis
FT                   protein CcdA"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73039"
FT                   /db_xref="GOA:D7E617"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:D7E617"
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /protein_id="ADI73039.1"
FT                   /translation="MDFITSASTAGPAAAFVAGIASIISPCVLPLLPAILAYSSNNGKY
FT                   RPIAIILGLSISFTLMGIITSAFSAGFQAYRDYIYLVAEIVIIGLGLVMLLEFNIFNNA
FT                   LLDKFSSKRLNNNGLLGGLVLGISLGIIWIPCVGPILGAILTMVAVGSNIIQGGFLLFI
FT                   YSMGFAVPMLIIAYSANITTSKLGKISKYGIYVKKAAGIVLISIGLWMIYTNHISTYML
FT                   "
FT   gene            complement(114649..115143)
FT                   /locus_tag="Metev_0109"
FT   CDS_pept        complement(114649..115143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0109"
FT                   /product="Thioredoxin domain protein"
FT                   /note="PFAM: Thioredoxin domain; KEGG: mba:Mbar_A2577
FT                   thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73040"
FT                   /db_xref="GOA:D7E618"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7E618"
FT                   /inference="protein motif:PFAM:PF00085"
FT                   /protein_id="ADI73040.1"
FT                   /translation="MKKLVLFTILSIFILSTIGCIESDTGAENNNNGYTSGGSDRVTSI
FT                   QQINNTVENKSVLIEFGAEWCSACDRQRPIIEDIANEYKDKAEVMYVNVDMTPDIAKRF
FT                   NIRSIPDSVVVVDINSGGEYVYMTENGDTTIQREKARFLGVTQKQRLVKTLEYAIENRT
FT                   G"
FT   sig_peptide     complement(115084..115143)
FT                   /locus_tag="Metev_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.638) with cleavage site probability 0.202 at
FT                   residue 20"
FT   gene            complement(115281..115985)
FT                   /locus_tag="Metev_0110"
FT   CDS_pept        complement(115281..115985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0110"
FT                   /product="2,
FT                   5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine
FT                   1-reductase"
FT                   /EC_number="1.1.1.193"
FT                   /note="TIGRFAM:
FT                   2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine
FT                   1-reductase; KEGG: mbu:Mbur_2352
FT                   5-amino-6-(5-phosphoribosylamino)uracil reductase; PFAM:
FT                   bifunctional deaminase-reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73041"
FT                   /db_xref="GOA:D7E619"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR006401"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D7E619"
FT                   /inference="protein motif:TFAM:TIGR01508"
FT                   /protein_id="ADI73041.1"
FT                   /translation="MNEKQTNTINRPFIFLNAAVSADGKISTKERKQVKISGDNDFERV
FT                   DELKKESDGVMVGIGTVLADDPSLTIKSENRKKYRKNNGLDENPARIVVDSNGRTPIDA
FT                   DIFKKGEGKRVIAVSKCAPEKKIKTLKEKADIIVAGNDKVDLKILVEKLKDMGIEKLMV
FT                   EGGSNLNWSLLSLKLVDEIHAFIGNIIIGGSTAPSLVGGSGFPETDMLKLKLVDFEQMD
FT                   DGLLVRWQVEKQ"
FT   gene            complement(116011..116865)
FT                   /locus_tag="Metev_0111"
FT   CDS_pept        complement(116011..116865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0111"
FT                   /product="CBS domain containing protein"
FT                   /note="KEGG: mbu:Mbur_2351 CBS domain-containing protein;
FT                   PFAM: CBS domain containing protein; SMART: CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73042"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D7E620"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADI73042.1"
FT                   /translation="MPKNTKIRDIMIKDVAYATIPGSREEVLEILKDKQVSGVPVIKEN
FT                   KVVGIVSRNNLLKYPEEEQLALLMTRDPVTISPDVDITVAARLLLDHDVRRLPVVDGDQ
FT                   LVGLVTIADVVGSMADLNITDQIDMYLNGGLVPVWDETPLPVVAKIMEFSNVNVSPVLD
FT                   KSLGFVGLISDRDIISASIIEDSVEVSDMSATAEDEDEWTWESIRDTMSIYYSVSRIKA
FT                   PNVATSEIMVTDLITATPMSGVSECALSMKRHDIDQIPVINGNGDLLGLLRDRDLLKAL
FT                   LEH"
FT   gene            complement(116899..117354)
FT                   /locus_tag="Metev_0112"
FT   CDS_pept        complement(116899..117354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0112"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mbu:Mbur_2350
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73043"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7E621"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADI73043.1"
FT                   /translation="MNSDLYKKILIATDGSEQNQKAIEYGVDLAKISNAKVYPVYVVDT
FT                   AAFSSIPMDSGWEMMYDLIKKEGREATDQVVKLAEEAGLESEPTVLEGHPSHEIIDFAK
FT                   NNDIDVIVMGTLGKSGLDKFLLGSVAEKVIRNSPAPVLVVRGEEKKE"
FT   gene            complement(117368..118474)
FT                   /locus_tag="Metev_0113"
FT   CDS_pept        complement(117368..118474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0113"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: mba:Mbar_A0486
FT                   chlorohydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73044"
FT                   /db_xref="GOA:D7E622"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7E622"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADI73044.1"
FT                   /translation="MSGEQVISGTILVGDELEPVDGYICVKEGVIKEIGEEKRETDNII
FT                   APCFVNSHTHIGDSVFKDPPLGKYRGYRLERDLDLLVKPPDGLKHQILRRTSYNKLVES
FT                   MKSSIKDMINTGTGAFADFRESGVTGIQALKEAIDDTDIDNIILGRPTDTEGPESNTIS
FT                   EIDRILKNAEGLGISGVNDMDMKLLEKISDYTRKNRGLFAIHAGEKQRSDISEALSLKP
FT                   DLMVHLTHANRQDLKEVSDENIPVVVCPRSNFTTGVGMPPVADMLEEEINVAVGTDNVM
FT                   LNSVNMFAEMETLSKLFGIEDRQVFKMCTLKGATALGLEKNGSIQEGNFASLMVLNGKS
FT                   NNLSNINNPISGIVRRGRPDDILSIIRA"
FT   gene            complement(118587..118862)
FT                   /locus_tag="Metev_0114"
FT   CDS_pept        complement(118587..118862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0114"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ehi:EHI_109980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73045"
FT                   /db_xref="UniProtKB/TrEMBL:D7E623"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73045.1"
FT                   /translation="MSVSVNKKPKNIETILTNTKRVYNKNGIISVSCRTVKPHSPTTPI
FT                   RLSQDLVLFLLSRNPNCIDYIDEYKINVDEILLDLSDLTPFFLWNK"
FT   gene            119356..119685
FT                   /locus_tag="Metev_0115"
FT   CDS_pept        119356..119685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0115"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   mac:MA4097 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73046"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:D7E624"
FT                   /inference="protein motif:PFAM:PF02594"
FT                   /protein_id="ADI73046.1"
FT                   /translation="MSLEDAVRKSDNLVVIDISVTPNSKTINVPDNYNQWRNRIEVKLT
FT                   QKAESGKANNQLIENFSEFFGVNKSSIKITSGEKSSQKSVSVKGLSYDDAVSILKSGLN
FT                   DLNDL"
FT   gene            complement(119724..120929)
FT                   /locus_tag="Metev_0116"
FT   CDS_pept        complement(119724..120929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0116"
FT                   /product="ketose-bisphosphate aldolase class-II"
FT                   /note="PFAM: ketose-bisphosphate aldolase class-II; KEGG:
FT                   mbu:Mbur_1969 fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73047"
FT                   /db_xref="GOA:D7E625"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7E625"
FT                   /inference="protein motif:PFAM:PF01116"
FT                   /protein_id="ADI73047.1"
FT                   /translation="MTDEDFEPICEISEQFRNYCNQMLESEYDPKPSKYIFNILQNQKT
FT                   IVMAANPRIGLVTRGILRAAKDADAPIILELARSECNLENGYTGLYPSDFSEQCYQAAK
FT                   DVGYDIWALHADHIGIKKGDREDIEKTKELVKAQIDAGYTSFAIDASHLFNFQGGDLRE
FT                   ELKDNIDATTEIAKFIEEQMDDREYGLEVEVGEIGREDEHGRVLTNPEEAVTFIKALNE
FT                   NGVYPQVLAIANGSAHGNTYDSQGRLIEQVSIDIPQTIKVAQALKENNLKVRIAQHGIT
FT                   GTPRELIHDHFPHGEIIKGNVGTFYMNLVWDAFKLFEPELYNDIWNWTVENYKQKSPDK
FT                   TDSEIFGKYSKFAIKQFFDRIYSVNEDTKRAIDAMAYAETLYFLKSFNAERTASIVRDG
FT                   IK"
FT   gene            complement(120979..121461)
FT                   /locus_tag="Metev_0117"
FT   CDS_pept        complement(120979..121461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0117"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   tko:TK0711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73048"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:D7E626"
FT                   /inference="protein motif:PFAM:PF01980"
FT                   /protein_id="ADI73048.1"
FT                   /translation="MKYEPIGVIHTDLKERERSPIQPAGAKGIKGYIEIYPEYEKGLED
FT                   LEGFSHIYLIYHFHLSNDYSLSVKPFMDSKKHGLFATRAPKRPNPIGISVVRVVDVDEN
FT                   IVHIKDVDIVDGTPLLDIKPYVPDMIVDDKKDIKIGWLENNIHKVKTKKSDSRFTE"
FT   gene            complement(121504..122085)
FT                   /locus_tag="Metev_0118"
FT   CDS_pept        complement(121504..122085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0118"
FT                   /product="formylmethanofuran dehydrogenase subunit E
FT                   region"
FT                   /note="PFAM: formylmethanofuran dehydrogenase subunit E
FT                   region; KEGG: mba:Mbar_A0795 formylmethanofuran
FT                   dehydrogenase, subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73049"
FT                   /db_xref="GOA:D7E627"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="InterPro:IPR026328"
FT                   /db_xref="UniProtKB/TrEMBL:D7E627"
FT                   /inference="protein motif:PFAM:PF02663"
FT                   /protein_id="ADI73049.1"
FT                   /translation="MSFEKAAEFHGHQCPGLAIGYRVAQIALDKFKNRSEDEELVAIVE
FT                   NNSCAVDAIQALTGCTFGKGNFVFKDYGKHVYTFIKRGDEKGIRISLKPQNDPASERHL
FT                   EIFKKIQNNRATEEEIREFRKIHEQKTVNILEAPENEIFHVENVSDKAPQKAQIFETII
FT                   CDECGEGVMSSRTKTINEKYVCIPCYEKLC"
FT   gene            122276..122767
FT                   /locus_tag="Metev_0119"
FT   CDS_pept        122276..122767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0119"
FT                   /product="TOPRIM domain protein"
FT                   /note="KEGG: mbu:Mbur_1322 hypothetical protein; PFAM:
FT                   TOPRIM domain protein; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73050"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR022972"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:D7E628"
FT                   /inference="protein motif:PFAM:PF01751"
FT                   /protein_id="ADI73050.1"
FT                   /translation="MHNQNNLKNSIFEYRKHLEQIEQILDVLFQHSEEGDILVVEGKRD
FT                   ICSLEKLGIDGDIETVSNKSLLDFSENVAYTGKSVVILTDWDRRGEILASKLSEYLQTL
FT                   DTDYDIEIREQLKSLVKKEIKDIESLYTYVVKLRSITGSTSDFADIADEFEYYYHRSYR
FT                   "
FT   gene            complement(122771..123145)
FT                   /locus_tag="Metev_0120"
FT   CDS_pept        complement(122771..123145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0120"
FT                   /product="Protein of unknown function DUF356"
FT                   /note="PFAM: Protein of unknown function DUF356; KEGG:
FT                   mac:MA4099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73051"
FT                   /db_xref="InterPro:IPR007154"
FT                   /db_xref="UniProtKB/TrEMBL:D7E629"
FT                   /inference="protein motif:PFAM:PF04009"
FT                   /protein_id="ADI73051.1"
FT                   /translation="MKSFAVIRGDNTDKVKIALHDLEQYGKFQFQAKPKQIEPDYADHL
FT                   LVSVLRVPLKARCKSAALVELDDNAGAVISRLKKIHPPAHIVIVSPRHEAYNELINKSK
FT                   NYPVFDRGFNNKHESKPINM"
FT   gene            complement(123271..124086)
FT                   /locus_tag="Metev_0121"
FT   CDS_pept        complement(123271..124086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0121"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="TIGRFAM: pyrroline-5-carboxylate reductase; KEGG:
FT                   mbu:Mbur_2111 pyrroline-5-carboxylate reductase; PFAM: NADP
FT                   oxidoreductase coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73052"
FT                   /db_xref="GOA:D7E630"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7E630"
FT                   /inference="protein motif:TFAM:TIGR00112"
FT                   /protein_id="ADI73052.1"
FT                   /translation="MGLKNKNIGLIGTGKMGSSLIRGILKSNIVDSSNVYASDIYNQSL
FT                   ENLQNELGINVSNDNKQTVMNSDIIILAVKPQVIRKVIAGFKDEMTEDKLVISIAAGVP
FT                   ISEIEDELNSGSKLIRVMPNIAATVGESSSAICPGGNTTNEDVENALEIFKTVGTARVV
FT                   SEYLMDAFTGVSGSGPAYIFPVIEAMADGAVYEGLDRKNALTFAAQTVLGAAKLVLETD
FT                   SHPAELKDMVTSPGGTTIRGFHELEEHGIRSAFMDAVIESSKRSRELGK"
FT   gene            complement(124173..124682)
FT                   /locus_tag="Metev_0122"
FT   CDS_pept        complement(124173..124682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0122"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: mac:MA4267 hypothetical protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73053"
FT                   /db_xref="GOA:D7E631"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004451"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7E631"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADI73053.1"
FT                   /translation="MQTTQVQCEICGTEIKGKPTKVNIEGSELEVCSICAQYGTSVETR
FT                   TQTKQQTNTGKKSATKKPEKKPATKKTRFEGPAYDLVEDYDQIIRDTRERLEWTLEELA
FT                   AKIKEKESLIKKIERGEITPEDSVRKKLEHTLNIKLTEKVEDVDTGEDNKSKNTTLGDI
FT                   VKIKRE"
FT   gene            124892..126232
FT                   /locus_tag="Metev_0123"
FT   CDS_pept        124892..126232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0123"
FT                   /product="26S proteasome subunit P45 family"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: 26S proteasome subunit
FT                   P45 family; KEGG: mbu:Mbur_2113 proteasome-activating
FT                   nucleotidase; PFAM: AAA ATPase central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73054"
FT                   /db_xref="GOA:D7E632"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR023501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D7E632"
FT                   /inference="protein motif:TFAM:TIGR01242"
FT                   /protein_id="ADI73054.1"
FT                   /translation="MSETTNEDIDENKYEITEENMNENNYKYNINKDRFDENENSYEYL
FT                   ADNEGDFSKYLLDRMKQLEHRNSRLNEQYNQIESEKRYVENQKLKYEREVRKLQAEIDR
FT                   LKSSPLIIGTVMDVLDNGKLMVRSSTGPQFMVSMSKYLEDEEIEPGTTVALNQQTFAVV
FT                   DVVQSTEEPMVSAMEVIESQQVDYDQIGGLDEQIKEIIESVEYPLTKPESFARIGISAP
FT                   KGILLAGPPGTGKTLLAKAVAHRTDASFIRVVGSELVQKYIGEGAKLVREVFEMARKKA
FT                   PSIVFIDELDAIAAKRLNDTNGADREVQRTLMQLLAEMDGFDERGDVRIIAATNRSDVL
FT                   DPAILRPGRFDRVITVPMPDVESRENILQIHTRNMAVSDNIDFKKLANLTEGASGADLS
FT                   AIAMEAGMLAVRNDKGSVETDDFLKAVDKVMNSGNESIEIQPEGMFG"
FT   gene            126428..126745
FT                   /locus_tag="Metev_0124"
FT   CDS_pept        126428..126745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM_2950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73055"
FT                   /db_xref="InterPro:IPR020501"
FT                   /db_xref="UniProtKB/TrEMBL:D7E633"
FT                   /inference="similar to AA sequence:KEGG:MM_2950"
FT                   /protein_id="ADI73055.1"
FT                   /translation="MDSLQLKIKHRLQKFIEKDEDGVRSNILCVFLNKNKLTIDDLYSI
FT                   ITTKYNISRNSVASMVGYIQSKLGIIQSYKKDYKSPTVYYLKDKYAFIIKMVLKQKFTV
FT                   S"
FT   gene            complement(126763..127014)
FT                   /locus_tag="Metev_0125"
FT   CDS_pept        complement(126763..127014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA0624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73056"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="UniProtKB/TrEMBL:D7E634"
FT                   /inference="similar to AA sequence:KEGG:MA0624"
FT                   /protein_id="ADI73056.1"
FT                   /translation="MSNVYININYSPETCGWCRGTGNDRSTHERPCRICEGLGSVLVAQ
FT                   PANSCAWCNGNSVDRIDTDKPCRSCDGTGWAHSLANEM"
FT   gene            127185..127286
FT                   /locus_tag="Metev_0126"
FT   CDS_pept        127185..127286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73057"
FT                   /db_xref="GOA:D7E635"
FT                   /db_xref="UniProtKB/TrEMBL:D7E635"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73057.1"
FT                   /translation="MASDEVSPATLRSVMWVMFAMWIITIIVGLLIF"
FT   gene            127383..127997
FT                   /locus_tag="Metev_0127"
FT   CDS_pept        127383..127997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0127"
FT                   /product="protein of unknown function DUF99"
FT                   /note="PFAM: protein of unknown function DUF99; KEGG:
FT                   mac:MA4269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73058"
FT                   /db_xref="InterPro:IPR002802"
FT                   /db_xref="UniProtKB/TrEMBL:D7E636"
FT                   /inference="protein motif:PFAM:PF01949"
FT                   /protein_id="ADI73058.1"
FT                   /translation="MGNISDKNTRLHIKSEIRVLGIDDSALLSDRIMIVGAVFRGGDWL
FT                   DGVLRSEITRDGMDGTDTIIQMVKPSKHFVQLRVIMLDGITFGGFNPIDIVKLNEETGL
FT                   PVVAIMRKYPDFEKIESALKYLPEPEKRMDIIKKAGKIAEVTTYADQRGSPLYIQWSGL
FT                   EEEDARRIVQQTSTRSNIPEPLRVAHLIATGIVFGESRGKA"
FT   gene            complement(128003..129352)
FT                   /locus_tag="Metev_0128"
FT   CDS_pept        complement(128003..129352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0128"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase; KEGG: mbu:Mbur_2115
FT                   phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73059"
FT                   /db_xref="GOA:D7E637"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D7E637"
FT                   /inference="protein motif:PFAM:PF02878"
FT                   /protein_id="ADI73059.1"
FT                   /translation="MGLFGTNGVRGIANEEITPELAVDIAKSLGTYLGNNATVAIGRDT
FT                   RVSGNMIKYAAISGSLSSGLSVIDVDMVPTPSIQYYIKNTRTDAGIIITASHNPREYNG
FT                   IKLIDGDGTEFSREGEKEVENIYYSKQYNNAGWENTGNLQTDHNVNDYYIKGIINSVDA
FT                   EKIQKQNFKVVVDTGCGAGSLTLPFLLRKLGCEVITINAQIDGTFPWRNPEPTPDVLEE
FT                   LSEIIRLSGADMGVAQDGDADRAVFTDENGNFVDEEVLLSLVAKNILNQKKGPIVTPVS
FT                   SSQRMADVAKEAGVELIWTAVGSINVARKMMEMNAVFGGEGNGGLIFPEHQYCRDGAMS
FT                   CAKLLEIMASGTPLSKLAEDVPEYYNSKTKIPCNNLEHTMECIKKKVHEDNVGIKIDTI
FT                   DGVKVWFEDGWVLVRPSGTEPIIRVYAESKTMSRAEKLMENGALWIKNCE"
FT   gene            129521..129910
FT                   /locus_tag="Metev_0129"
FT   CDS_pept        129521..129910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0129"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mma:MM_1519 amino-acid acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73060"
FT                   /db_xref="GOA:D7E638"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7E638"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADI73060.1"
FT                   /translation="MDSDIRIREATNVDLLSVRLLLSTCFLEMDDVAIDDFIVAETIDR
FT                   TKIIGIAAEVNQNHPEIHTVAVHPNYRAKGIGSKLVRYILNRQPEQRERIYVHTVAPEF
FT                   FNKLGFLRADEVYYRGYITMYYPLI"
FT   gene            130250..131005
FT                   /locus_tag="Metev_0130"
FT   CDS_pept        130250..131005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0130"
FT                   /product="Protein of unknown function DUF166"
FT                   /note="PFAM: Protein of unknown function DUF166; KEGG:
FT                   mbu:Mbur_1481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73061"
FT                   /db_xref="InterPro:IPR003745"
FT                   /db_xref="UniProtKB/TrEMBL:D7E639"
FT                   /inference="protein motif:PFAM:PF02593"
FT                   /protein_id="ADI73061.1"
FT                   /translation="MKISVLYTGAFGEKVIGNLINNTNFCTSCGELLCDHCRSVRKGIS
FT                   HLIVQTYEFQEDLPELIDDPAEYIPENLSETDLILAIDLHPDLLTVLPEIARRTKSSAV
FT                   ISPVERPQLAPPGLVEQVKHELENAGVEAEFPKPFCSLEKTGKKIIDQFVDLGFGRPLL
FT                   KIELNTDNDTFRFVRVLRDAPCGSTWFVAKQLTGTDVDNYKETVSKAHHSYPCTASMEK
FT                   DVELGDTILHQAGFIIRKSVEEGMSENNG"
FT   gene            130998..131375
FT                   /locus_tag="Metev_0131"
FT   CDS_pept        130998..131375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_0495 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73062"
FT                   /db_xref="UniProtKB/TrEMBL:D7E640"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73062.1"
FT                   /translation="MDNRTNNIDKGLEIIAALDVNQLQPIELRDILYYTVAKNYEVVDE
FT                   ILSSAIGEGIVEKRDDIYHLNPEASSLEFEKPRIIKQDDKSRCKLCGKSLNTSYYIEFE
FT                   SDTIGPYGSTCVRKIHLNYID"
FT   gene            complement(131385..131804)
FT                   /locus_tag="Metev_0132"
FT   CDS_pept        complement(131385..131804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0132"
FT                   /product="nucleoside 2-deoxyribosyltransferase"
FT                   /note="PFAM: nucleoside 2-deoxyribosyltransferase; KEGG:
FT                   mba:Mbar_A2000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73063"
FT                   /db_xref="GOA:D7E641"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:D7E641"
FT                   /inference="protein motif:PFAM:PF05014"
FT                   /protein_id="ADI73063.1"
FT                   /translation="MDTSKKVYIAGPLFSEGELDFNKKLRDAVAKKGFPVYLPQEHTED
FT                   TVDMRHEHKQNYIFQNNVEIIDDSDIILAVLDGADVDSGTAWEIGYAYAKGKMIFGLRT
FT                   DFRTMGSEGMVNLMIDQSADAIAFDIPGVLEIFEQ"
FT   gene            131959..133410
FT                   /locus_tag="Metev_0133"
FT   CDS_pept        131959..133410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0133"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: mma:MM_3279
FT                   dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73064"
FT                   /db_xref="GOA:D7E642"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:D7E642"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADI73064.1"
FT                   /translation="MINYDLIIIGTGSGMNFVNAIIDSNPEIKIAVIDKDAPGGICLTR
FT                   GCIPSKLLIYPAELIRDIESAERFGINVDIQNIDFKNIMDNMRDKISSDINMIRQGLSE
FT                   SKNVDYYPESAEFVEPYTMKVGNETIYSDMIFICTGSKPVIPPVKSLNEVGYLTSDTVL
FT                   EMDNLPGSIAVIGGGYIAAEYGHFFSAMGSNVTLIGRNPQFVPEEEPEISALATNKMSG
FT                   YMNLYTNHEAVEVQNEDNKKKVIFKDRGSGEHKEITVDDILVATGRGPNTDILRPEKGG
FT                   IETDEKGWIKVDDHLETSKPNVWALGDANGKYLLKHVANYESNVVYQNAILNRNIEVDY
FT                   HAVPHAVFSHPEIASVGLKEKEAVEIYGEDNIIIGFYSYEETAKGQAMKVQDDFVKIIM
FT                   EYSSEKILGAHIIGPYASILIHQIIPLMYTPDQSAAPIMDSMTIHPSLSEVVTNAFYFL
FT                   MPVHHYHHILEHLGLDEYTGYRTGQ"
FT   gene            complement(133539..134468)
FT                   /locus_tag="Metev_0134"
FT   CDS_pept        complement(133539..134468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0134"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: mac:MA3941 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73065"
FT                   /db_xref="GOA:D7E643"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:D7E643"
FT                   /inference="protein motif:PFAM:PF03773"
FT                   /protein_id="ADI73065.1"
FT                   /translation="MVFEIIADYIVSLTGLTGNAAEALHFWIYDSLKIITILLLVIFGI
FT                   GFLRTYLAPEKLRDYLKGKHSIFGYGIAALLGIVSPFCSCSTIPLFLGFVSAGVPFGMI
FT                   ITFLFVSPMVNEAAIVVLLGTLGWKITGLYVLGGVVVGSFGGFLLNNLGFDKYVEKFDF
FT                   GAQTYCEEDVSIRERCNIAYTEAKNIVKQIIPYVLIGVGLGALIHGFVPQEIITSYLTG
FT                   SLAVPGAVIVGIPIYTNIMGVIPVIESLVGKGLPVGTSLAFMMSVAALSFPEFVMLKKV
FT                   MKKQLIIAYAGIVGLGITLMGIVFNFIF"
FT   gene            134695..136632
FT                   /locus_tag="Metev_0135"
FT   CDS_pept        134695..136632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0135"
FT                   /product="Hydantoinase/oxoprolinase"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG:
FT                   mba:Mbar_A2490 hydantoinase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73066"
FT                   /db_xref="GOA:D7E644"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:D7E644"
FT                   /inference="protein motif:PFAM:PF01968"
FT                   /protein_id="ADI73066.1"
FT                   /translation="MEYSLGIDAGGTYTDVVIMRNHDGVIVDFYKSLTTYPDLVEGVKN
FT                   AIDGLDCSYLKGVNIVSVSTTLATNTVLENTGYPVGLVLVGDYEVPEDLDVEHYIVVSG
FT                   GHTTRGDEASKLDEEKVEDFIKNVKDKVSAFAVSSYFSVRNPDHELRVKQKIKELTDYP
FT                   VVCGHELSQDLGVYERGITAYLNAQLLPITTKFIDSVKYEIERRGIDAKMRMLKCDGSI
FT                   VGINEALEKPIELIFSGPSASLMGAAYLTNLDSCAVVDIGGTSTDVSLMENGLPELVDT
FT                   GAVVGGWQTKVRALRMETSAMGGDSHVWVKNQTIRIGPRRVTPLCVAAETYPGLVNKLK
FT                   KERISSSKQLTENIQPTKFYVKTREKPVNLTESESRILELIENNEPASINEIFRETFTP
FT                   DIYLNSLIQKRLIQPIGFTPTDALHILGDYEYWNINASHIGATLLSRLVNTLNYKFCGQ
FT                   VKDKVTHNLALNLTSFVLKNVDRSEIDKILHDSHLSKIKILIPLILIGASAQVYQNNLK
FT                   KSIDADIRVPEFAEVGNAVGAIAGKGVKRVYILIKSVYDYENNMMKAVVFSPGRRDEFY
FT                   DYDEALEFTKKRGHELIFNYMDEAGLDKNGVKIEMNRDDISMDGSSRTPVETNLVFVGV
FT                   WNINYKKSKK"
FT   gene            complement(136645..137781)
FT                   /locus_tag="Metev_0136"
FT   CDS_pept        complement(136645..137781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0136"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   hau:Haur_4322 DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73067"
FT                   /db_xref="GOA:D7E645"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7E645"
FT                   /inference="protein motif:PFAM:PF01041"
FT                   /protein_id="ADI73067.1"
FT                   /translation="MSAEIYYKSIPITKPIVPEFETIAPDISEILEEGKTTNAKHVEEL
FT                   ENTVAEYLGVEHAVAVSSSTAGMMLTIKSMGLNGEVILPGFDFHSSADTVLWNGLKLKF
FT                   VDIDPETWTIDPDKVEENITENTSAICGAHIFGNPCDIEKLQQIAEDNNLKLYFDAAHA
FT                   LGSKYHNEYIGNFGNAEIFSLNPSTSNFVGEGGIVTTNDDDLKDYLLAGRNYGDENELS
FT                   SRFPAFNARMSEFNAVLANYSLQNIEKNIRSRNGVVTKYRNVLGNIPGISFQKITEHSR
FT                   SAYNDFAISINPDEFGMTRDELSDKLSEVNIETKKNYYPPVHRQQAYSEHAQSETDLPV
FT                   TDELSEHVLSLPIWSQMSSNLAGKVCTNIQKIRMDVLK"
FT   gene            complement(137970..139202)
FT                   /locus_tag="Metev_0137"
FT   CDS_pept        complement(137970..139202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0137"
FT                   /product="glucoamylase and related glycosyl hydrolase"
FT                   /note="KEGG: mbu:Mbur_0734 glucoamylase and related
FT                   glycosyl hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73068"
FT                   /db_xref="GOA:D7E646"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:D7E646"
FT                   /inference="similar to AA sequence:KEGG:Mbur_0734"
FT                   /protein_id="ADI73068.1"
FT                   /translation="MNRMEAHKLYENSVKILKKNQHENGGFYASPPGTRYPFIYPRDHS
FT                   IAILGAISAELMDQARLGLEFILSAQKPLGEFSQRYDIDGNDASYKDLQIDGTGLVLYT
FT                   LGKYFEATGGSFFEEMADRDFVLKYWSTIRNAVEFILMNKNEEVDLIHTINSIHEYPAY
FT                   EHGFEIYANSACCAGILSAVEMGKAIGADDNELDRWKNEAEKVKNAILTRMYSPRRRSF
FT                   IKCIRVKDKNSKPIAYDAFASSVIDVDAAEYAPAYFELISNHDMKTQATVKRIHRHLWD
FT                   DEIGGLNRYPEHWNRNNGGYGPWCHFTCELANHFIENNDQELAEKYLGWVVDMAHDYQM
FT                   PEHISTIQRFELWVEDYTNAEILRDSKIKMIEQTRNHPKWQDGLAYITIPLIWPHAEYI
FT                   RAYNNYMSKFE"
FT   gene            complement(139208..139744)
FT                   /locus_tag="Metev_0138"
FT   CDS_pept        complement(139208..139744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_0735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73069"
FT                   /db_xref="UniProtKB/TrEMBL:D7E647"
FT                   /inference="similar to AA sequence:KEGG:Mbur_0735"
FT                   /protein_id="ADI73069.1"
FT                   /translation="MIRLENMLPKALLTGVLKMVDLDGPEKTLKWLEDIGKDLAEIEGA
FT                   GFEGGRDDNILYLPICPFGGELIEFIEIYGEQPAQFKQVIEVSDKKRDNSDNPWDYPAL
FT                   SNILGVLHYSYVKRRAEMAGFKIFNLGCRSPMKDYDYIAYNEQAIEKVNMTREEVDKYL
FT                   EKAYCVFKIEPANTE"
FT   gene            complement(139802..140611)
FT                   /locus_tag="Metev_0139"
FT   CDS_pept        complement(139802..140611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0139"
FT                   /product="mannosyl-3-phosphoglycerate phosphatase"
FT                   /EC_number="3.1.3.70"
FT                   /note="TIGRFAM: mannosyl-3-phosphoglycerate phosphatase;
FT                   mannosyl-3-phosphoglycerate phosphatase family;
FT                   HAD-superfamily hydrolase, subfamily IIB; KEGG:
FT                   mbu:Mbur_0736 mannosyl-3-phosphoglycerate phosphatase;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase type
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73070"
FT                   /db_xref="GOA:D7E648"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006381"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR033980"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7E648"
FT                   /inference="protein motif:TFAM:TIGR02461"
FT                   /protein_id="ADI73070.1"
FT                   /translation="MNYVVYTDLDGTLIDHDTYSYEPAKPALELLEKHNIPLIICTSKT
FT                   RAEIEVYVKKLNSPHPFISENGGAIFIPKGYFDVDYDYTITYKNYNIIELGTEYPKLRQ
FT                   VLEDIKSSVDVEILGFGDLDDENVSKDTGLDIESARLAKMREYDEAFKVKGEEKNVADR
FT                   IIEIIKSHGLNYTRGGRYWHLIGDNDKGKAVEILSDIYEKQFGNLQTVGLGDSLNDYPM
FT                   LKSVDIPYLVQKPGGKHDDSITDSKINRIEGIGPKGWNQAIINLISR"
FT   gene            complement(140608..141516)
FT                   /locus_tag="Metev_0140"
FT   CDS_pept        complement(140608..141516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0140"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   mbu:Mbur_2331 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73071"
FT                   /db_xref="GOA:D7E649"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D7E649"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADI73071.1"
FT                   /translation="MVLEEYIPEWLMKNLANLVFVLAVIIASFIIAKIVDRALKTYFGI
FT                   VSKKMVIDETVYGLVRRISVALVYFAGIIVIILSVPFLRNISLALFAGAGFAGIVVGMA
FT                   AQSTLSNVIAGVSLATFRPFRVGDRVNINNEYGTVTDITLGHTVVNTWDNRRLMIPNHI
FT                   ISDQSIINWTIEDSTVLWPIDMGISYDSDIDHAKSIMIEEARKHPNVMRYEDIINYHPM
FT                   SSKDEGIEVYVTECGDFAVNLRLFVWIVTRGIAYTTGCELREAIKKRFDAEGIEIPFPY
FT                   RTIVYKKDIMEEKEQLYRENK"
FT   gene            complement(142026..143174)
FT                   /locus_tag="Metev_0141"
FT   CDS_pept        complement(142026..143174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0141"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: mac:MA3794 integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73072"
FT                   /db_xref="GOA:D7E650"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:D7E650"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADI73072.1"
FT                   /translation="MTFHGEDKKLKNMEKQIRGETYCEENKNLILKYKNILFAKSSSPH
FT                   TVLNYLNNLNQISKMCEKPIENFDKDDIISLLGKIEQSGYKPSTKNLYRVNLKKFIKDM
FT                   ELDVPTDIIKTGKNSNQHKLPEDLITEHEAKMMIDSTSSLRDKALMSVLYESAARVGDL
FT                   SELRIKDIDFNKRDGTYLRLDGKTGARRIKLIASTPYITSWLNNHPEKENQNAPVWLSK
FT                   IKNQPLKYQGVRRVLKIAAEKAQIQKDIHPHLFRHSRSTFLANHLTPSQLESYMGWEHG
FT                   SRMPAIYVHLSGQDLDHAIDKIHGKEDEEDEKDDSEFTNRYCPRCGKMNETTAKFCNVC
FT                   GAALDITNAIEIDEKRNEVINKLMEMIANNPELAEMLKEYNG"
FT   gene            complement(143252..143488)
FT                   /locus_tag="Metev_0142"
FT   CDS_pept        complement(143252..143488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pyo:PY05757 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73073"
FT                   /db_xref="UniProtKB/TrEMBL:D7E651"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73073.1"
FT                   /translation="MKNDCKNNKNRKHSQENKKIRFVDEDGHKRSLNILESDQISIAQY
FT                   CEDNQEWIEFMEKFGNDWERKAVKILKLVANSN"
FT   gene            143794..144348
FT                   /locus_tag="Metev_0143"
FT   CDS_pept        143794..144348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0143"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfh:PFHG_01171 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73074"
FT                   /db_xref="UniProtKB/TrEMBL:D7E652"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73074.1"
FT                   /translation="MTDIGSDIPEAPLGRNPTLRKEALKYYVEKNDIIANNDLLKHLNS
FT                   KNISTDYKNLHKLHLKKMQYLLEGPLPAGISDSGRAVVGYKLKKNLTTLRFLLTYVYDE
FT                   SNYYMLMNSDFYHEMIPQVIEHLDKKLVEMEDTGVYEHEVNILEKQLKYTVLGLNFILS
FT                   STDNYIKCLRQFDEDLEYDLS"
FT   gene            144397..144612
FT                   /locus_tag="Metev_0144"
FT   CDS_pept        144397..144612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdu:CD36_50200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73075"
FT                   /db_xref="UniProtKB/TrEMBL:D7E653"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73075.1"
FT                   /translation="MILGQYDDEYIGNMRIKLREYISNNKIIYLMYRFMNIDAYSGYIY
FT                   SDDYKSDNETIKEQLLEPFEMMTNMK"
FT   gene            complement(144914..148747)
FT                   /locus_tag="Metev_0145"
FT   CDS_pept        complement(144914..148747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_1720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73076"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:D7E654"
FT                   /inference="similar to AA sequence:KEGG:Memar_1720"
FT                   /protein_id="ADI73076.1"
FT                   /translation="MTKSNLNPSLIARYFYHDCERYLRYHATPLDERNNEGIPKIEQDQ
FT                   NPIMRVLLKAGIEWEEEVITEKLVDNVIVPDGEGALNERAHTFDETLKIIKDIKSGHNI
FT                   YQPTIHVPEQFLKKYNLSSDLCRFPPCRPDLIRLVENNGKYVLQIIDIKASEDITPSHR
FT                   VQTALYSLMLQESLKEQGYDIEVDLKQAGIWLYEQDEPELFDLHFDIKMVEDFLRNHLP
FT                   VILESPIDKLSWHLYHRCELCEFYRHCKSEAEKNESVSMIPYLSSNGKKYLCNDRLSVN
FT                   SLSELESFLKNDDAENYLEDCGSLRNQKHKLLTTTQALKNNEPVLTGRVSLNLPINESV
FT                   ALFITIQNDPVSSRIYSIGYRRFKGKQVYENTSNEKIYIASYPDECTEIQKKFLIDLYD
FT                   ELKTLHDYNREREWTEQKSLQTYVFDSYELQLFYDLLNEFTKESEMAPIALRLLFYFQN
FT                   TNLAGQVEHPPTEIKHPIVILTNEIDQLVSLPVPFSLRLPEISKVLQSPDFNYDFEPSD
FT                   LFWFEQSNVMKSDTITMVWDGTRPEAVDWIKNELSKRLLATSSVLEGLRYIAKDKLITW
FT                   SQKFKIPDSYYFENKELSQLSFITRYESYMTAMDIREKRSLPKPERIREGISVPVECMG
FT                   LNIWRVTKPIDYTLFEKNEEFSHILVPDNEEGEKAQISFDDYTFRSEINDSRNTGVNFA
FT                   IIDEKKVDPKDGKLKLLYLDVKYNKNQEHFNTGDKAVLHPRFTDFTSRRIMRKLSELDE
FT                   QDDSGFLELIRTPQTFNKPMYEADNLLNEALCLSDSSGFTSSQMKAFEHMVKNRLTLVW
FT                   GPPGTGKTYFLAKSVLNILKTWKNNGYRFHIAITASTHAAIENLLLKIQEISKDYDFDN
FT                   LPVYKLKSAKTAPSKESLQVCQEYEVDDLLNFQHLVVGGTVNSLDKVGRKIPTIDMLIV
FT                   DEASQVKPAEIALGMSIIDYGKRLVLAGDDLQLPPIINVDYPESDEGLPSLHDSIFSYL
FT                   RRRDNENNPYTQQLLENWRMNKTLSRFSAETLYGLDYIPATDNIGLQKLELGTPLQANG
FT                   LPDSYEKLLESIVDSEYPLTVCILENVQASVENEIEAEIVARLSVLLRNNLLSEDWRYY
FT                   PNNEEGDRKFWKDGLFIVSPHHSQIKTIHNHLDSLRSWSHYPFVDTVDKMQGQETQAVI
FT                   VSYGVSDVETALNEAEFIYSLNRLNVSVTRAKSKCVLFLPRPLLEPSVELLQNEDASNG
FT                   LHHMLNLVDFCRKYGKEKSFDLDFGSRNGVNLTVLKASINFPFMKEFSFKIS"
FT   gene            148977..149837
FT                   /locus_tag="Metev_0146"
FT   CDS_pept        148977..149837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfh:PFHG_05169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73077"
FT                   /db_xref="UniProtKB/TrEMBL:D7E655"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73077.1"
FT                   /translation="MQQCIKCGYKKRGSESNYICEDCQKFSEIFDKLWNEVNYIFNNLE
FT                   IINPETDKVLKFLSDTAFVTKDNPQTRIYYKISSLIINKAWNREDTINEVEVNKYTNTT
FT                   KNLLEALKVFEELGIVKIEYSGYERILKIQNKAFKVANAWRSSESLDNQLIERVAQIFA
FT                   GYVLFYILQLMNNISDVSDLDNLPYNKRQRTLWVTLMSLLSKPYDGDAKINENDISKYL
FT                   RKRGIASGTDLKIKQSLHNMTENPTGLIKNVKTDDDGYRVYEYSDYVVNEFERIRNGRT
FT                   RHRVE"
FT   gene            149840..150622
FT                   /locus_tag="Metev_0147"
FT   CDS_pept        149840..150622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0147"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: mvu:Metvu_1206 AAA family ATPase, CDC48
FT                   subfamily; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73078"
FT                   /db_xref="GOA:D7E656"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E656"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADI73078.1"
FT                   /translation="MNNDDSENKITLQTSKDINGIELLSQLKPTKEKIRKTCSYFFKGK
FT                   YEGNDVPFRGFILLGPPGTGKTEVIRQVAKEIDKNLQVHNIITYFALVDGANIAAPKWG
FT                   DAEKNLKDVFQKINYLNQGEGNSNKIILLFDDIESLVLKRGADLAKEWHYSINSILFHE
FT                   LDKINPSNVIMCATSNKPELVDDAILTRLYPIDVPSLPIDQLIVKVENILNNSGVTGDD
FT                   FELVKSNIQKRLETLENPTIRDAQHFTIVECIENEVWK"
FT   gene            150619..151380
FT                   /locus_tag="Metev_0148"
FT   CDS_pept        150619..151380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pyo:PY00055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73079"
FT                   /db_xref="UniProtKB/TrEMBL:D7E657"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73079.1"
FT                   /translation="MKHVEDLPPFGNLGIYVYFENYTNNHPYKTQQLLDGTYPEYNELI
FT                   DLIKSILNNVNLELKPKTYSLLRTMIGNRGRTFGASHTYKYNLNDNSELKQILNLVNEW
FT                   FQNQNLYWIRDFDVVYCKNAQKRIDDLPLFGYLKVSIYFDGYGQYYQNETRKKLMGVEG
FT                   ESHKVRGLSDYVYNKTSPKNYTLTPKTFSLLRYTIGNKGRSFGAAHTYKYSVNNSKELE
FT                   EIINKINEWFNNTGINWWDDLDIETCETIKW"
FT   gene            151515..153419
FT                   /locus_tag="Metev_0149"
FT   CDS_pept        151515..153419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0149"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: sto:ST2117
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73080"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E658"
FT                   /inference="protein motif:PFAM:PF02463"
FT                   /protein_id="ADI73080.1"
FT                   /translation="MICNLDLKDVGGLRGENNFSFESGKANKILGSNAVGKTSLIKGMV
FT                   SVLSIPPSGTFLKYGDDAERLGIKGDELSVHEGFVNIYSDSAQVKLSYDSIEDTYTVEP
FT                   DGTVIESPDGNEKFLLTGVVMDNSRVVQQLKYGENSHFGWFINQLSFADNYEELYNLAQ
FT                   SYINDITSKKTSLNKRKSKAKELASELEKVKKQKEEIDQDREEISKKVNDNDIREIVEE
FT                   RKSIFEKIQNFHRDLNDIYNRINNKKTKIQKKEEIVNELNENLSNLNKEIEGLDVSNYK
FT                   KKFDQKVNENTSKIESLKEDKAEVNASINLFQSAKLKLKNENKSETTCILCEQGNLNIN
FT                   VIDKTLESLNDKKRNIESEIQSLNEEIAIMKNKLNNLESEKNKKEQEIFRLEHELEDTK
FT                   SDLKTLRNEVKNDDDLKNEKEQTLKELENEYERLKELAKGDIVKKIDELEAKSSELQEE
FT                   IGSINEKIRSTTGEEVIYGENVDTDTALAIYNDWLYYLEELKEFANEMYSSHRNEARKK
FT                   FNEKISVLIEDLGFEGIKSIWLNNEDRLMVERENEQPQPVGSLALSEKCMVAILLQLSM
FT                   KEAYLPDIPFFVVDDILQDFDDNKKKKVINYLGNVAQEKNMFIVMSLLDETQPEVVIN"
FT   gene            153466..154269
FT                   /locus_tag="Metev_0150"
FT   CDS_pept        153466..154269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: baf:BAPKO_0675 exodeoxyribonuclease V, alpha
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73081"
FT                   /db_xref="UniProtKB/TrEMBL:D7E659"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73081.1"
FT                   /translation="MPKCQLCNGTISNGKYHDICDLTIFQLDEIKSLYRNGGAPDWLSE
FT                   ALGELSWIYENNTRTSPYFNVASEIAEMFIIGGYDKLNRVEIKELDLTVSAEREILELL
FT                   KKGEILDYDDVNIYSGEMINKSKNIVNKGEKLSDQDSEVSRKEMYGFLAVCLTSSLIES
FT                   STYGLPKKALAIFYLLSGQMIYSNQGDLKVSNEAFKYAFKVLTPTQRNRITRILAGFHP
FT                   SGSSRIIDNIDINGNVYLKPKMINYIDRMRELYRSRSRDSRDREY"
FT   gene            154327..155460
FT                   /locus_tag="Metev_0151"
FT   CDS_pept        154327..155460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0151"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase;
FT                   KEGG: fsu:Fisuc_1665 phosphoadenosine phosphosulfate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73082"
FT                   /db_xref="GOA:D7E660"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7E660"
FT                   /inference="protein motif:PFAM:PF01507"
FT                   /protein_id="ADI73082.1"
FT                   /translation="MDLLSKEVEAISFLYQQSENRKLAVSFSGGKDSLVVLDLCTRVGI
FT                   EKVVFSDTTIEFKENLNFIKTVEKVYGIKIDVVSSNNDFFDVVDRVGFPSRRLRWCCDV
FT                   FKFGPLAKYAIDKNLDGYVTGLRRAEAKTRADYFDVDNNQMVPISQINPILNWEEDDVW
FT                   EYINEHNLPINPLYEYFDRIGCWCCPFQSMTEWDTLEKYFPELMEKLEAKLDQFADQIG
FT                   IKDKEQFIKEKKWTGWATAQSKSPAGTRKLCDSGEKNTIDLGFFGNSEKEVKKISKLLP
FT                   ILTDDYFTIGKSLRITVDKNKKQRVNTLIEKCMNCVGCGACTALCPLGALYVENGLITV
FT                   DENLCTKCEKCLSTKVLRGACIVRNYAPNRKTITSYH"
FT   gene            155868..156710
FT                   /locus_tag="Metev_0152"
FT   CDS_pept        155868..156710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0152"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfh:PFHG_02407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73083"
FT                   /db_xref="UniProtKB/TrEMBL:D7E661"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73083.1"
FT                   /translation="MTAGIGEIVHESLKLGSNEYYNYLKKASNKTNINYWPEPSVNRWT
FT                   LKMDIEMAKAMSEGYIDDGVNVFPCIMSSHSNSIALQNEFEKYPKLITYSNINNTNERT
FT                   YIPVNNPNESRPLSKIGFNIKKDIISKIKSGIIPFKYKYLASLVSIYHIRNDIKVWDDI
FT                   CNSGLFDIWSPTAPFSNIYGKKDPIILLIRVYELENEYPHKHIDFKASPYFGKLMGDTV
FT                   FENIKPVIDNDNFLNKTKKLDTILLKNDALRYKEIFLNEEATEDYEEGYYVKNLHVTI"
FT   gene            157125..157256
FT                   /locus_tag="Metev_0153"
FT   CDS_pept        157125..157256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgr:MGG_12088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73084"
FT                   /db_xref="UniProtKB/TrEMBL:D7E662"
FT                   /inference="similar to AA sequence:KEGG:MGG_12088"
FT                   /protein_id="ADI73084.1"
FT                   /translation="MSKKNNMDKKAASRIQSNLDKKGKDQEGKRRTQSSADRNAKQK"
FT   gene            157367..158944
FT                   /locus_tag="Metev_0154"
FT   CDS_pept        157367..158944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00558530 cyclic nucleotide-binding
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73085"
FT                   /db_xref="UniProtKB/TrEMBL:D7E663"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73085.1"
FT                   /translation="MHNDYRLTAKELQVLKHFVLNESNNIDDVHFEYRSFYSYPGRIEN
FT                   DINSWSNIKVSRVHAKEICEKFIVMNLLAFEDVSESKRYYFLKPGIETLRNVIHLFYRN
FT                   LDDKEYFTLFRQSYIQSKINDKLVIYELNKRGITFRKKLDIIDWPEDEAKELLQKNPEL
FT                   SSISFEKYMQKKLGAKDKFGKQLKGPHDIKFDIKFPVLDISNKNMIHNINDIEHFNKDL
FT                   FSIYPDLKQYPSAIYNHYQAKQENYLILPILLFIKVSHNALKYFLCDEWPSDKTEFFWY
FT                   ADDSLDHKFLFFMNDLMVLSFKDMAFNKGSAGMLLINNACFNGILTLINGEEENKLCFF
FT                   ELHNDFRKYYFDSILYQPGGLRPMDIGITINNKLYIYKINSIIDNFKLKSSNVSHAKDE
FT                   LSDMILNYLKNDNNPIIKTIKSYLPNQLNNAINYCDTSNISRTAKTMIKRAIENELRWV
FT                   LIKEDWNHLSYNDLSETSIKKLSDYRSVLEANKEHMDSGIDTVPYKLDAGGSIFHDVFG
FT                   EDHPFFEN"
FT   gene            complement(159004..160839)
FT                   /locus_tag="Metev_0155"
FT   CDS_pept        complement(159004..160839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kpu:KP1_5381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73086"
FT                   /db_xref="UniProtKB/TrEMBL:D7E664"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73086.1"
FT                   /translation="MYMNEPPKGPNQRYAEWLEDVTFHRRDEKKSKQSWNYIGSVTRQL
FT                   MKNQDNFDILEFIPAEPYMPVVARIASKKKGKKITTEQYSRARLDLINARIINYVKMSF
FT                   KKHDGTTYKITPHFLNPLGKYYYGNTFATSPDTMSMGFYHNNTESREFSVRHIEFLKNY
FT                   YKNKGYDVELGSYPFDLIIDGKHGFVLTEMHENSIGIEIRLAEAMKECVNKNMTLYCPA
FT                   ISMGMMKRVSAIIAGLIYYSEKVDHFAYVTYHEAEICSDVKTENWSYYLTRTNDGDTAE
FT                   LPEVIEFPKIDVNSHNLVLSQLKNTSEKRKKKNLSNWYSYMYEPVYINNLKNYEIAPHI
FT                   KVTVGLDYFGMTWRRHAMKSSAILTGKCRQTMTDYIREFPDLLVADNKADEQHNKTIDI
FT                   FKEHGSEVIYADRNHAKAVLDSENLIIHSMATTSYMGNKRESYIIINFEDHPLKDMIHS
FT                   TFYNMIYYLGQGKQSSFIHEWKKIKPLFKNRLGILANFHGKTTKWPYYGLIKSAARQKG
FT                   IKIYTSHLDIKKLASLSAEIRIQGVSRLDNHKSLMVAKCPIYKERMWHPRLIFNSDFVA
FT                   LGSWDMAHIKDQKELQAIVYLNDELIPGKKKKKKK"
FT   gene            complement(161501..161740)
FT                   /locus_tag="Metev_0156"
FT   CDS_pept        complement(161501..161740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0156"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dgr:Dgri_GH24142 GH24142 gene product from
FT                   transcript GH24142-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73087"
FT                   /db_xref="GOA:D7E665"
FT                   /db_xref="UniProtKB/TrEMBL:D7E665"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73087.1"
FT                   /translation="MVFLYGIKKNPEVIVNLKTKLKYPDYIQKLSIRNSELLNDCVLST
FT                   AYSYIVVKKYSKHLKIIIFSSFTIIIIVVTLTLI"
FT   gene            161780..162928
FT                   /locus_tag="Metev_0157"
FT   CDS_pept        161780..162928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0157"
FT                   /product="restriction endonuclease"
FT                   /note="PFAM: restriction endonuclease; KEGG: mba:Mbar_A1622
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73088"
FT                   /db_xref="GOA:D7E666"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D7E666"
FT                   /inference="protein motif:PFAM:PF04471"
FT                   /protein_id="ADI73088.1"
FT                   /translation="MYRKEKIKTLIVEPLTEEILDESFDQISTSDSLKQLSKFETEALE
FT                   CLLVKYDQEPDKRDKIIEALNSGFNNTASDFIVSKILEIDPDTDNNSIEHQQNLEILQN
FT                   LSEISVTNAIIKAIYHNHYKFENNNRANDLIDLLTDRSFLTVSLLIDFIYNNSKYLDLL
FT                   IIDKFTMIFHSVGSLSVRSLLHSLDDYDWSERCLEYIKGIIVDFGDESVIPLLTYMKTC
FT                   SYENKLIAAEIMDMIGHVSAMRIVEALNDTEPTMKLPHFHKLQDLKSHELEKVVYNLYE
FT                   AMYYHVDFTEYQDQGGDIIATKLGKERIIIQVKSHKNNKDGNRISNFAVQQVKTAQNVY
FT                   FATKCVVVANNYFSPAAVELARANNVELIDIDSLQALVDNYL"
FT   gene            complement(163556..164149)
FT                   /locus_tag="Metev_0158"
FT   CDS_pept        complement(163556..164149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0158"
FT                   /product="transposase"
FT                   /note="KEGG: mma:MM_3344 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73089"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D7E667"
FT                   /inference="similar to AA sequence:KEGG:MM_3344"
FT                   /protein_id="ADI73089.1"
FT                   /translation="MEMVLDVYKRSYSELFPVVCMDESPKQLISETRNKIQASAGKPEK
FT                   YDYEYRRKCSCNIFMACEPLTGERIVQITKRKTKKDWVQFIEKIATKYNSAKRITLIMD
FT                   NYNTHTPGSFYEAFHPEKAKQLLDRFELVFTPKHGSWLNMAEIELNVLNKQCLNRRIGD
FT                   IQVSLTKSEHGNHIEMRNTAKSIGNLLHLMQELN"
FT   gene            complement(164194..164670)
FT                   /locus_tag="Metev_0159"
FT   CDS_pept        complement(164194..164670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0159"
FT                   /product="transposase"
FT                   /note="manually curated; KEGG: pph:Ppha_1467 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73090"
FT                   /db_xref="UniProtKB/TrEMBL:D7E668"
FT                   /inference="similar to AA sequence:KEGG:Ppha_1467"
FT                   /protein_id="ADI73090.1"
FT                   /translation="MYVYAKKFIITLSKEERKELEAIVSKGKHKSQKYQNALILLNCDE
FT                   GEYQKQKHTNEVVSSVLNIGMRKIDRVKKRFVEDGLDMALNGKEYERTYEKKIDGDMEA
FT                   HIIALSCSDPSQGHSQCSLRLLADKVVELEYIDSISYESIKRVLKKTNLNPGKK"
FT   gene            165311..166051
FT                   /locus_tag="Metev_0160"
FT   CDS_pept        165311..166051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fma:FMG_0557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73091"
FT                   /db_xref="UniProtKB/TrEMBL:D7E669"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73091.1"
FT                   /translation="MEYFDELDKNLNDSIGSDDLKNTIDSYPCSLYNKLLNTSKYYFYN
FT                   LFTQWMKDLEESGFWDESKGSINGHKIRYNLANKAFDAGTKTFSSRGLYVWGVGEKPRY
FT                   VGKTDKTLRKRFKSRYLWGDGVPKQCELFRLILNKYTNKDVKKKYDIFRDKSKNKEIID
FT                   DELSTLKNDLEITSVNSFSRLVGALDFATYADKEDDLWFAVLPIEEKNKDYLDVMETFM
FT                   ILAANEYNYENGYPYLLNRDKVVK"
FT   gene            166204..166620
FT                   /locus_tag="Metev_0161"
FT   CDS_pept        166204..166620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73092"
FT                   /db_xref="UniProtKB/TrEMBL:D7E670"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73092.1"
FT                   /translation="MKPEENNLSYYNMVLEYQEKERKRLHDIIENKKLTRNTADSLHEL
FT                   VDEFLTKNYRGISQNERWKLHYSLKERISYKKVFSPVSKIEESEFDDITEQLEICFNTF
FT                   LDQSVEKQKKDSLFDEIKFYLRDFNFLNFNFLKK"
FT   gene            complement(166751..168199)
FT                   /locus_tag="Metev_0162"
FT   CDS_pept        complement(166751..168199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0162"
FT                   /product="DNA methylase-type I restriction-modification
FT                   system"
FT                   /note="KEGG: wsu:WS1649 DNA methylase-type I
FT                   restriction-modification system"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73093"
FT                   /db_xref="GOA:D7E671"
FT                   /db_xref="UniProtKB/TrEMBL:D7E671"
FT                   /inference="similar to AA sequence:KEGG:WS1649"
FT                   /protein_id="ADI73093.1"
FT                   /translation="MQKSIISFLNVKSSSKHFRFDAEYFHPEFLSTERLIKSNNYKELR
FT                   DLIKVLTDYHANGSYKTLRKNVELKSEPDYAHMIRTVDIEKDDFENDIIYINKHAYEFL
FT                   EKTKVYGGEIIINKIGNAGKAYLIPPIEKKQSLGMNQFMIRTNEKINNYYLYSYLAGKY
FT                   GQNQLMQRVTGAVPLSIDKESTRSVLVPIFSHNFQKNVAKAINLYIEYSKYSKKVFKEC
FT                   KKNLLEELGLDKWKPKHKLTFVKNFSDTIKSERIDAEYYQPKYEEIVNAIKNYKGGWDI
FT                   LGNVVTLEKGLEVGRNEYLDEGIPFVRVSDISPFEIKEEKYISESLYSDIKHCQPQKDE
FT                   ILFTKDATPGIAHYLTEQPKKMIVSEGVLRLKNITIGSKNKHKEINNEYLTLVLNSIIL
FT                   KEQINRDVGGSVIIHWRPKQVKNVLIPILPEEKRLKIQQKIIKSLNSHKQAKKMLNCAK
FT                   RSVEIAIEQDEKTADGWLKSQINN"
FT   gene            complement(168200..170260)
FT                   /locus_tag="Metev_0163"
FT   CDS_pept        complement(168200..170260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0163"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; protein of unknown function
FT                   DUF450; KEGG: syp:SYNPCC7002_F0089 type I restriction
FT                   modification system, N-6 DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73094"
FT                   /db_xref="GOA:D7E672"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:D7E672"
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /protein_id="ADI73094.1"
FT                   /translation="MNHEDIIQTILNDSNYSLSLFEEEEVNDLKGRIYTKVVNGNEKPY
FT                   ITCIIRDREIQLKPEEIVRQLYAKRLMDKYEYPKNRFAFEYPVSFGRETKNSDIVIFDR
FT                   DSPETPYIIVELKKPKLKDGKDQLRSYCNATGAPIGIWTNGEQISHYHRKEPNYFIDIT
FT                   DIPNVNQTLGDITRERFTLKDLIINDKIANERKSLKDIILDMEDEVLANAGVDVFEEVF
FT                   KLIFTKLYDETLSQHDKNRIEGFLDNELNDEERANYELVKQTLENFNDRNCRVMEFRNT
FT                   GQTEIELYNKIQSLFDSAKEKWRGIFQDSSRFELSSSHLSVCISSLQDVKLFNSNLLVI
FT                   DEAFEYLVNKSAKGEKGQYFTPRHVIDMCVKMLNPKRGEYMIDPAAGSCGFPVHTIFHL
FT                   TGHLFENTEISDEDQEDILKVFGIDFDEKTVRVARTLNLIAGDGETNVLHLNSLDYERW
FT                   NEYVNNHNWSQTYGSGYNRLEKLRESRNSNKDFDFDVLMANPPFAGDIKESRIIHKYEL
FT                   GFKNNGKAYSKIGRDILFIERNLDFLKSGGRMAIVLPQGRLNNSSDERIREFISEHARI
FT                   LAVVSLDQNTFKPHAGTKTSILFVQKWDNELCPVVEDYPIFFAVSEKTGKDNSGDYLYV
FT                   HDENGQYKLDKNGHLIVNHDLHNHGGELPDGIAEEFISWAKDERLSFWEGD"
FT   gene            170524..170730
FT                   /locus_tag="Metev_0164"
FT   CDS_pept        170524..170730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pvx:PVX_091515 GTP-binding nuclear protein
FT                   Ran"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73095"
FT                   /db_xref="UniProtKB/TrEMBL:D7E673"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73095.1"
FT                   /translation="MVKIIQNYLYSILWKIGSMISRKILQRQVNNKLEIKIDPYKSTEI
FT                   QILRKQNLTFLQMNLPSNINYQS"
FT   gene            complement(170772..171719)
FT                   /locus_tag="Metev_0165"
FT   CDS_pept        complement(170772..171719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0165"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   mpl:Mpal_2493 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73096"
FT                   /db_xref="GOA:D7E674"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:D7E674"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADI73096.1"
FT                   /translation="MCLCNKHTGNISSNKYLNFIDTALAVSGNSRLEIYSCKYSKRTYT
FT                   QHQLLALVLLKEYLNEDYRDIVELVELMDKVQTKLGLKQIPHFTTLHKFVTRIRTILLN
FT                   RLLHQTIKLFYSHGERIEVTAVDSTGFTSGHCSYYYSLRTDKKRHSFLKTSIAVDTSNL
FT                   VIIGVKVSGRPVHDTKHAVTLLKQCHRIRKSEFYVMDKAYDSEDIHKLVRDELGSIAII
FT                   PVKDRKRKRIKGRYRRLMIEDFDVALHRKRSMSETSNSVLKRKYGEEIRARIYRNQVKE
FT                   IILKVVVYNLDRFVKVKIIVYLRISTEPNYYFIY"
FT   gene            complement(171840..172067)
FT                   /locus_tag="Metev_0166"
FT   CDS_pept        complement(171840..172067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0166"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0780 DEAD/H associated domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73097"
FT                   /db_xref="UniProtKB/TrEMBL:D7E675"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73097.1"
FT                   /translation="MQNSDYYKQISVEKTSEYEIYFYILHEYLKENNIVLSNKSVVLNE
FT                   VDGDYLILDYVLKSVWIPKSQIKHEYIIHK"
FT   gene            complement(172711..172815)
FT                   /locus_tag="Metev_0167"
FT   CDS_pept        complement(172711..172815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73098"
FT                   /db_xref="UniProtKB/TrEMBL:D7E676"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73098.1"
FT                   /translation="MRSKFIKDFTKNNISKYMNYRIAAISHIVKSHRL"
FT   gene            complement(173388..174251)
FT                   /locus_tag="Metev_0168"
FT   CDS_pept        complement(173388..174251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0168"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   mja:MJ1515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73099"
FT                   /db_xref="GOA:D7E677"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D7E677"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ADI73099.1"
FT                   /translation="MCELLGLSFNISIKPSISFTGFRSKGEQNPDGWGIAYYPVANNKN
FT                   KSEKSAQIIKEPINSKKSNLSSFLTDYQKLESKLIISHVRKSSKKNFGHKNTHPFSREL
FT                   NGCEYIFAHNGTFNNNKDDFNKGRFIPMGVTDSENIFCHILGCIEENGITQWDSGNGKE
FT                   NFEWLSNKLNEVNENGKLNCIFSDSEYLFCYQDNNGHHNNLYYLHRKPPYDKANLSDEE
FT                   LKIKLDEEKYDDQTGYVVATKRLTNEYWESFEPGELIVFKDGEIIYSNKRDFDHPTETN
FT                   KGILEY"
FT   gene            complement(174393..175475)
FT                   /locus_tag="Metev_0169"
FT   CDS_pept        complement(174393..175475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0169"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   mja:MJ1515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73100"
FT                   /db_xref="GOA:D7E678"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D7E678"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ADI73100.1"
FT                   /translation="MCELLGLSFNISIKPSISFTGFRSKGEQNPDGWGIAYYPVAYTKN
FT                   KSSGKYVPNKYKSEKSAQIIKEPIKPENSKLSRFLINHQKIESKLIISHLRKSTKGKKN
FT                   HTNTHPFSRELYGKEYVFAHNGTIQNKRLSSTGKFTPIGSTDSENIFCYLLNCIEEHGI
FT                   AQWDFESFEWLSNKLNEINENGKLNCIFSDSEYLFCYQDNNLFNKLCYINRKPPNGTIR
FT                   LSDNDLEIDLDEEKDDNQTGYVIATKKLTDENWIDFEPGELLVFKNGSLIYSNKCYIEH
FT                   PNKNPISIEREILAVLRSHSHRVSLNHISQLSSGSIHEVKRAINSLLFDGYIRQDRRDR
FT                   VSCNHEKATFYTNPIKRNYI"
FT   gene            complement(175535..175828)
FT                   /locus_tag="Metev_0170"
FT   CDS_pept        complement(175535..175828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0170"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tad:TRIADDRAFT_52674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73101"
FT                   /db_xref="UniProtKB/TrEMBL:D7E679"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73101.1"
FT                   /translation="MECEICGHEKETVIVPSKEADAKPINCCKGCALESSISNVFYDGF
FT                   PVFHFKSENGRWYYVFVDHNDDVPYIYPYDNPKTRIRSSAGEIVFKSSKSRR"
FT   gene            complement(176075..177523)
FT                   /locus_tag="Metev_0171"
FT   CDS_pept        complement(176075..177523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0171"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: rci:RCIX973 type I
FT                   restriction modification system, methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73102"
FT                   /db_xref="GOA:D7E680"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:D7E680"
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /protein_id="ADI73102.1"
FT                   /translation="MEEDFTNNFEKNLNKKFGKNLHNKLGLKTEYLPISNPINHVLSLM
FT                   LLKKLSEQYEHGVKHIVLPASAYWTNIKSSYNDIGNLLNNAFEELEMKNPEIKGVFDSL
FT                   DFESNELGNVHHKNEIWKSIIDSLSSIELYNENLEPNYDFERLFDVFTPRKLAYLVVKL
FT                   LNIDKDMTVYEPFCTLGTFLVRSGNYIKECTGEFDEPYLYGQSPNKEYRLTTMLNLYFN
FT                   DFFKAQVKSGNLIFNPQFLTEDGDGVRKFDRVLGSYPIIKDWGYEFAKYDPYRRFSYGV
FT                   PPQKKGDYAYIEHMVASLKKDGMMGVLVPNNSLSRTNEKETKIKQLMLKRDDLIESVIS
FT                   LPPKVLRSTATSYSLLIINKNKREERRNQVLFIDASREYRPRKTEVTRNVIKYKHIDNI
FT                   VSTYQSFKDEDNFSSVVPIEKIEKHNFSLDVSSYILPEPIESDVINPNDALSRLREIQN
FT                   DKNELINNIHDTYSALNLDKGYDD"
FT   gene            complement(177524..178138)
FT                   /locus_tag="Metev_0172"
FT   CDS_pept        complement(177524..178138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0172"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: rci:RCIX974 type I restriction
FT                   modification system, specificity subunit (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73103"
FT                   /db_xref="GOA:D7E681"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D7E681"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ADI73103.1"
FT                   /translation="MRCSDITETIKLKNLLESNKLIRGIAKTREDNSNDTEKINVFMVN
FT                   IKNLEDGIVDLKSTEECNVKKSDFEKPKPKKGDVIIPIRGSDFKSAVAPSGIENKGYVI
FT                   SLNLVALRVNNKILPRVLSEYFNSPQGQISLERISKGTKIKSIPIKELKELDIPVPNLD
FT                   DQNKFDKYLEAIQDYKLRLREEKEFTEKMKKSVAFKYFRGY"
FT   gene            complement(178401..179039)
FT                   /locus_tag="Metev_0173"
FT   CDS_pept        complement(178401..179039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0173"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="SMART: protein phosphatase 2C domain protein; KEGG:
FT                   mvu:Metvu_1000 protein serine/threonine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73104"
FT                   /db_xref="GOA:D7E682"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D7E682"
FT                   /inference="protein motif:SMART:SM00331"
FT                   /protein_id="ADI73104.1"
FT                   /translation="MLAVADGVGGNNAGEVASNLAVHEITNMMYSYPVGEMETEDVINF
FT                   LKVAHQKVREVINKESVGEKVGMDTTLVSSVIKDDIAVIANTGDSKAFVIDKGGNVKLK
FT                   TKEHTYPQYLFDEGIINKDDVKNHPLNNMLTCSITGNFTVDTYKVDLISGDSIILTSDG
FT                   IHDYIYKEDIISSIKDNIFGNNPREVVAEISEKAFMSSKDNFTVLLYKH"
FT   gene            complement(179279..179467)
FT                   /locus_tag="Metev_0174"
FT   CDS_pept        complement(179279..179467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73105"
FT                   /db_xref="UniProtKB/TrEMBL:D7E683"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73105.1"
FT                   /translation="MTNLEKFKETDKILAEWEEQFEDDFMEICINPGQRINKGDSESGD
FT                   HGQLKQNLGKGEYGNSK"
FT   gene            complement(179559..179732)
FT                   /locus_tag="Metev_0175"
FT   CDS_pept        complement(179559..179732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73106"
FT                   /db_xref="UniProtKB/TrEMBL:D7E684"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73106.1"
FT                   /translation="MSIMIWAYDAELRATYILLKETVKRNLNRFLDDGEGRRYVPLDIF
FT                   VNAIEIGQYQPV"
FT   gene            complement(179804..179899)
FT                   /locus_tag="Metev_0176"
FT   CDS_pept        complement(179804..179899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73107"
FT                   /db_xref="UniProtKB/TrEMBL:D7E685"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73107.1"
FT                   /translation="MLGEKANEFNYVNNDNINENCQIIMAVVVVT"
FT   gene            180357..182558
FT                   /locus_tag="Metev_0177"
FT   CDS_pept        180357..182558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0177"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: mbu:Mbur_1102 ski2-like helicase; PFAM:
FT                   DEAD/DEAH box helicase domain protein; helicase domain
FT                   protein; SMART: DEAD-like helicase; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73108"
FT                   /db_xref="GOA:D7E686"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7E686"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADI73108.1"
FT                   /translation="METGKLELPEYVIQFYLDTGIEKLYPPQAEAVEKGLLDNKNLLAA
FT                   IPTASGKTLISELAMLKSISNGGKCLYIVPLRALASEKFERFKQFSSIGVNIGISTGDF
FT                   DSTDEWLGSNDIIVATSEKADSLLRNETSWMKDITTIVVDEIHLLDSADRGPTLEITIA
FT                   KLLRLNPNSQIIGLSATIGNAEEIAGWLDAELVQSQWRPIELYEGVFLEDNINFKQSQK
FT                   PIKNIVKDTAVNLVLDTIDENGQCLVFESSRRNCAGFAKKAKSKVGKSLDKGLLAELNN
FT                   IAEEVLETSDTETTKELASCIKRGTAFHHAGLNSAQRKIVEDNFRNNKIKVISSTPTLA
FT                   AGLNLPARRVIVRNYKRYDPNFGMQPIPVLDYKQMAGRAGRPSLDPYGESVLISHTYNE
FT                   FTDLLDRYIDAEPEDILSKLGTENALRTHVLSTIVNGFATTRQGMVDFMGSSFFAYQQQ
FT                   KWSLIDVVDDCIEFLQDNEMIKDDGERLYATRLGQVISTLYIDPLSGAIIIDKLKKADK
FT                   VTDMTMLHIICSTPDMRQLYLRSKEYEKINEYVMTHSDEFVEVPNPFKSIEYEWFLGEV
FT                   KTALLINEWIDEKTLDDITAEFGVGEGDINALSDISEWLMHSAVNLANLTDLDADKAQE
FT                   LEKRIHHGVNKDLIQLVSISNIGRVRARKLYEAGIQSVSDIKNTKLHILSNYLGRKTAY
FT                   KVLEQLGVEPEDNQQIDEEPESIKSYSGNDQGQKTFNDF"
FT   gene            182580..183860
FT                   /locus_tag="Metev_0178"
FT   CDS_pept        182580..183860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0178"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="TIGRFAM: histidinol dehydrogenase; KEGG: mma:MM_0424
FT                   histidinol dehydrogenase; PFAM: Histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73109"
FT                   /db_xref="GOA:D7E687"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:D7E687"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ADI73109.1"
FT                   /translation="MLYKHLKDVTDDEKKKIFSRGGELANVEDKVSVILDEIHNHGDEA
FT                   LKKYTKQFDNAEIENIEVSRQEIDEAFYNVDEAFIKHLETAAYNIRKYHESQLPAQKWM
FT                   SETLPGIELGQKVTPLKNIGAYVPGGSASYPSTALMTVIPAKVAGVENVSVCTPPRYDG
FT                   TVHPITLASARIAGADHIYRLGGVQAIGALAYGTSSVKKVDKIVGPGNVFVTTAKMQVR
FT                   NRVEIDFPAGPSEVLIIADESADAKMAASDIVAQLEHDPNAVSILITTSKSLAEKVNQE
FT                   VLYQAKSTPRNDIVKKSLKNVVILIADTVDSCIEFSDEFAPEHLEIMVYDDEYVLNRIE
FT                   NAGSIFVGNYSPVAAGDYASGTNHVLPTSGYAKIYSGLNVNHFIKYSSIQKISKEGLEN
FT                   IKDTIISISEEEGLYAHSDSVKTRFDE"
FT   gene            183967..184377
FT                   /locus_tag="Metev_0179"
FT   CDS_pept        183967..184377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0179"
FT                   /product="Protein of unknown function DUF1699"
FT                   /note="PFAM: Protein of unknown function DUF1699; KEGG:
FT                   mbu:Mbur_1104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73110"
FT                   /db_xref="InterPro:IPR012546"
FT                   /db_xref="UniProtKB/TrEMBL:D7E688"
FT                   /inference="protein motif:PFAM:PF08004"
FT                   /protein_id="ADI73110.1"
FT                   /translation="MKIRVVSSRDEIPKIDSNENVIHFAFRPSNKDIFSLVKRCPNVEV
FT                   IQIPSSYRSTLSKSIEMFLDMQNIKLIEGDVWGHRKDINEYYSIPPAVVDKIKELKSEG
FT                   KSNEDIADKLSREGKMNKEMLKYVLSKEQLNQ"
FT   gene            complement(184409..185638)
FT                   /locus_tag="Metev_0180"
FT   CDS_pept        complement(184409..185638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_0737 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73111"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7E689"
FT                   /inference="similar to AA sequence:KEGG:Mbur_0737"
FT                   /protein_id="ADI73111.1"
FT                   /translation="MDFSQERITTIHDYSINGQNVTERINRLSLVRPGVVIIPMLYDEI
FT                   KSDSLQLIVDQLNKSSYLKQITIALSAENSAQYREVLDFFGQLEIPHIVVWCNGPRIQN
FT                   ILEDMKEKELDITSFSGKGKDVWIAIGVASLYGYAIAFHDADIKTYDKYLPAKLLYPII
FT                   EPELDFFYNKGYYSRIDTESSQMFGRVHRLFVEPLIETVIKDIDRSSSLLNYLQSFRYP
FT                   LSGEFAMTRDLAMNIRIPSDWGLELGLLGEVYRNTAMKRISQVDLGFYNHKHQSMGSDV
FT                   SEGLSKMVNDIFTTFIRLLGENTNIQISVPFLHSISVRYKRFSQDLIRQYHADAIFNDL
FT                   KYNRHQEEIYVDTFAKIIQQSKNDYFKDTSEVLLPDWKRALSAIPNLNKRFRNAALEDC
FT                   IEHSKYNSVK"
FT   gene            complement(185857..187161)
FT                   /locus_tag="Metev_0181"
FT   CDS_pept        complement(185857..187161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0181"
FT                   /product="pyridoxal-phosphate dependent TrpB-like enzyme"
FT                   /note="KEGG: mbu:Mbur_1100 tryptophan synthase subunit
FT                   beta; TIGRFAM: pyridoxal-phosphate dependent TrpB-like
FT                   enzyme; PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73112"
FT                   /db_xref="GOA:D7E690"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006316"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7E690"
FT                   /inference="protein motif:TFAM:TIGR01415"
FT                   /protein_id="ADI73112.1"
FT                   /translation="MEQTKILLDENEMPKQWYNILPDLPTPVEPPLNPETKEPIKPEEL
FT                   ESIFPKSLIEQEMSSDNYIDIPEEIRDIYKLWRPSPLHRAHRLEELLDTPAKIYYKNEG
FT                   VSPAGSHKPNTSIAQVYYNMKEGNERVTTETGAGQWGSALSLACNYFDLECKVYMVRSS
FT                   FEQKPFRKSLINLWGATVIPSPSKETKFGQQFLEQYPDTTGSLGIAISEAIEDASENDN
FT                   TKYALGSVLNHVMLHQTVIGLESQKQLEKVDEYPDIVIGCCGGGSNLAGISFPYIKDKI
FT                   NKKHDPEIIGVEPSACPTLTEGSFKYDSGDTAMMTPLLKMYTLGHDFVPPSIHSGGLRY
FT                   HGCSPIISRLYDDGLMKGRNYHQVEIFDSAVKFARTEGIVPAPESSHAIKCAMDEATKC
FT                   RETGEEKTILFNLSGHGHFDMSAYDKYFNKKLGNE"
FT   gene            complement(187244..188572)
FT                   /locus_tag="Metev_0182"
FT   CDS_pept        complement(187244..188572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0182"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="KEGG: mbu:Mbur_2182 phosphomethylpyrimidine kinase;
FT                   TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1;
FT                   Phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73113"
FT                   /db_xref="GOA:D7E691"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D7E691"
FT                   /inference="protein motif:TFAM:TIGR00097"
FT                   /protein_id="ADI73113.1"
FT                   /translation="MDKLPVAFTIAGSDSGGGAGIEADIKTFAALGVYGTCAITSVTAQ
FT                   NTEGVISSYDLPKNIVSEQIDAVCKDMNVGWTKTGMLGSNEIVKTVADSIKKHNLSIVL
FT                   DPVMAAQAGGTLLKEDAMPLLTDELLPLCKIVTPNTEEAYKLSGIYIKDLNDARDAARK
FT                   IAEKGKCHVIITGGHLEACDLVYDYEKDDFTVIYGSFVEGGTHGSGCTYSSAIVSYLNK
FT                   GFSLEDAAKYAKQFVENAIKESLHIGNGVNPVNQLADLHDNSERYKVIQNSMDALDLLQ
FT                   NNQAFTNLIPEVGSNIAMAIPNASEISDVAAVEGRIVHLKKYPKPVGSIDFGASSHVAR
FT                   IVLAAMKFNPEIKSAINIKYTPRILDICNEIGYDISSFNRADEPEETSTMDWGVTFAIS
FT                   TYGTVPDAIYDKGGIGKEPMVRLLGKSAVDVVNKAIKIAEKCV"
FT   gene            188814..189032
FT                   /locus_tag="Metev_0183"
FT   CDS_pept        188814..189032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0183"
FT                   /product="Like-Sm ribonucleoprotein core"
FT                   /note="KEGG: mba:Mbar_A3500 small nuclear
FT                   ribonucleoprotein; PFAM: Like-Sm ribonucleoprotein core;
FT                   SMART: Sm-family ribonucleoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73114"
FT                   /db_xref="GOA:D7E692"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="InterPro:IPR022901"
FT                   /db_xref="UniProtKB/TrEMBL:D7E692"
FT                   /inference="protein motif:PFAM:PF01423"
FT                   /protein_id="ADI73114.1"
FT                   /translation="MGNRPLDILNNALNTPVIVRLRGSREFRGELQGYDVHMNLVLDNA
FT                   EELNDGEIVRKLGSVVIRGDNVVYVSP"
FT   gene            189086..189247
FT                   /locus_tag="Metev_0184"
FT   CDS_pept        189086..189247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0184"
FT                   /product="Ribosomal protein L37e"
FT                   /note="PFAM: Ribosomal protein L37e; KEGG: mac:MA3194 50S
FT                   ribosomal protein L37e"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73115"
FT                   /db_xref="GOA:D7E693"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018267"
FT                   /db_xref="UniProtKB/TrEMBL:D7E693"
FT                   /inference="protein motif:PFAM:PF01907"
FT                   /protein_id="ADI73115.1"
FT                   /translation="MSKGTESFGKRQKRTHTKCRRCGSMSFNVRDKECKSCGFGKTKRM
FT                   RSYNWNKN"
FT   gene            189297..190712
FT                   /locus_tag="Metev_0185"
FT   CDS_pept        189297..190712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0185"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="KEGG: mma:MM_0341 amidophosphoribosyltransferase;
FT                   TIGRFAM: amidophosphoribosyltransferase; PFAM: glutamine
FT                   amidotransferase class-II; phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73116"
FT                   /db_xref="GOA:D7E694"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:D7E694"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ADI73116.1"
FT                   /translation="MKEECGVVGVVLPEAEPQSNSSAFQIYYGLYALQHRGQESTGITI
FT                   HNGCSANSIKGMGLVPEVYVKDDLKNLTGNVGIGHVRYSTSGNSGIENCQPLVVNFKGG
FT                   TVAIAHNGNLVNACELRDELESEGRIFITDSDTEVIAHLLVKQLLKHNIFDSIRQVMQR
FT                   LVGSYSLTILIDGQLIAVRDPLGIKPLCIGEVEGGYAVASESVAIDTLNGKLLRDVYPG
FT                   EVLFFNDGEIESYQLDNEKRSAHCVFEYIYFARPDSIIDGKLVYKVREKIGRVLADEHP
FT                   VESDVVSPVPDSGITSAIGYSKESGIKYSEGLMKNRYIGRTFILPGQEMRDIAVRLKMN
FT                   TISDNIDGERLILIDDSIVRGTTSKRIVNMIRDSGAKEVHARIGSPPIIAPCYLGIDMA
FT                   TREQLIASQNTIEGIRDMIGVDSIGYLSIDGLVEAIGINKNELCLGCLTGRYPVEIYGE
FT                   ECCAHLQSRLSEY"
FT   gene            190934..191407
FT                   /pseudo
FT                   /locus_tag="Metev_0186"
FT   gene            191485..192627
FT                   /locus_tag="Metev_0187"
FT   CDS_pept        191485..192627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0187"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: mac:MA3361 transposase; TIGRFAM: transposase,
FT                   IS605 OrfB family; PFAM: putative transposase
FT                   IS891/IS1136/IS1341 family; transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73117"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D7E695"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADI73117.1"
FT                   /translation="MLNHNNYGMLKAYKYRMYPNQIQQELIAKHIGACRFIYNWALENK
FT                   IKSYEQDGKAISRFELNKQIRVLKQDHEWLNEINSQSLQGATLNLENAFTKFFREKSGF
FT                   PKFKSKKNPVQSFSVPQYYKVDFENNKVYIPKIGWIKTRLHRSFDGKQRTATITRTPTG
FT                   KYYISILVDDDKQLPQKQTFYEVNTIGVDVGIKDFAVTSDGEKIDNPRYLKNSIERLKV
FT                   LQKRLSRKKKGSNNHRKLKHQIAKYHEKIANQREDFQHKLSSRLISENQAVALECLNVK
FT                   GLLKNHNLAQHITDASWSSFVQKLEYKAEWYGKNIIKIGRFDPSSKICHVCGYYHQDLE
FT                   LKDREWECPDCKTEHDRDINASVNIKKFALDKQNLISPSG"
FT   gene            complement(192821..192892)
FT                   /locus_tag="Metev_R0006"
FT                   /note="tRNA-His1"
FT   tRNA            complement(192821..192892)
FT                   /locus_tag="Metev_R0006"
FT                   /product="tRNA-His"
FT   gene            complement(192985..193761)
FT                   /locus_tag="Metev_0188"
FT   CDS_pept        complement(192985..193761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0188"
FT                   /product="thiazole biosynthesis enzyme"
FT                   /note="KEGG: mbu:Mbur_2109 ribulose-1,5-biphosphate
FT                   synthetase; TIGRFAM: thiazole biosynthesis enzyme; PFAM:
FT                   thiamine biosynthesis Thi4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73118"
FT                   /db_xref="GOA:D7E696"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="InterPro:IPR022828"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7E696"
FT                   /inference="protein motif:TFAM:TIGR00292"
FT                   /protein_id="ADI73118.1"
FT                   /translation="MELDDITITKAIVDDFSKTFIDYTEVDVALVGGGPANMIAATRLA
FT                   QEGYKVALFEKKLALGGGMWGGGMMFPRIVVQDEARKILEEFDINHYEYDNEKGYYIAN
FT                   SIESVSRLINKTVTSGVQVFNLVNFEDVMIREDDRVTGIVINWTAVSIANLHVDPLTIR
FT                   AKVVIDGTGHEAVVCNTVQRKIPNAKFEGVVGERPMWADAGEKSLKETTREVYPGLIVT
FT                   GMAANAVAGAPRMGPVFGGMLLSGEMAAKIAMSKLD"
FT   gene            194013..195095
FT                   /locus_tag="Metev_0189"
FT   CDS_pept        194013..195095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0189"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: mbu:Mbur_2106 AAA ATPase; PFAM: AAA ATPase
FT                   central domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73119"
FT                   /db_xref="GOA:D7E697"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E697"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADI73119.1"
FT                   /translation="MTLNSDADFMDNIAEKIILKPVGYPLSGIFEDYPEIENPEVFECY
FT                   AREQWEEHLARKGEYLFDRRMYPDFAYKIIDVDPPESVIGPYTTIIVMEDNNNVETSEL
FT                   NTDINFDDVIGQDNARKKCKLVEKFLENPDKFGKWAPRNILFYGPSGTGKTMLAKGLAN
FT                   KTDVPIITIKATELIGEYVGEGAKQIHQVYDRAENMAPCIIFIDELDAVALDRRYQELR
FT                   GDVAEIVNALLTEMDGIIERKGVCTIGATNRKDTLDSAVSNRFEEEIEFVLPDENERLK
FT                   IIETNIKTFPLPIKNVNISKIAKLTQGFSGRDIVEKVLKVSLHQTIIDDKEEVNGRYLE
FT                   DTVSRLQKKNNSKTENRMYI"
FT   gene            195138..195410
FT                   /locus_tag="Metev_0190"
FT   CDS_pept        195138..195410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_2105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73120"
FT                   /db_xref="UniProtKB/TrEMBL:D7E698"
FT                   /inference="similar to AA sequence:KEGG:Mbur_2105"
FT                   /protein_id="ADI73120.1"
FT                   /translation="MSEPSPRYLKCRVVNVVDNPLGFKGIVVEDIDTEGRIYFGRTKPK
FT                   DCTLQQGDTAYVYVNPVNMVFEDDERTMEVTLYDENNNKLDWTII"
FT   gene            complement(195417..196331)
FT                   /locus_tag="Metev_0191"
FT   CDS_pept        complement(195417..196331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0191"
FT                   /product="ribonuclease Z"
FT                   /note="TIGRFAM: ribonuclease Z; KEGG: mac:MA3031
FT                   ribonuclease Z"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73121"
FT                   /db_xref="GOA:D7E699"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7E699"
FT                   /inference="protein motif:TFAM:TIGR02651"
FT                   /protein_id="ADI73121.1"
FT                   /translation="MLKITFLGTAGSLPTPYRNPPSILIKKDSELLMFDCGEGAQQQMM
FT                   RARTGMMSLSSIFITHFHADHVLGIPGLLQTMSFQGRTEPLYIYGPEKIDVFIQILTAL
FT                   GYCQLGYEIKTVELKPGDIIEKNGYHIKALKTEHGVKSIGYSLVENKRPGKFDRDKAVS
FT                   LGVPPGPLFSKLQKGNPVEVDGRTVHPEEVVGEPRPGRTVVYSGDTRPCEDVFNASLEA
FT                   DVLIHDGSLDDSQSEWAAESMHSTASEAAELAKKAGVIKLVLTHISSRYTEDESPLLND
FT                   ANEIFENVVIADDLMEINIPYKK"
FT   gene            complement(196431..196742)
FT                   /locus_tag="Metev_0192"
FT   CDS_pept        complement(196431..196742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0192"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcb:PC000317.02.0 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73122"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6A0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73122.1"
FT                   /translation="MTWIKASTTGCKDLSGLNIPYFINSKHIMHIELNLNRRNLAVEVS
FT                   TIDGCRHYIFDANDYFDIPYSKLKCDDIENLLMKIISIIKDADNRNIETLDLQKSLDT"
FT   gene            197001..197378
FT                   /locus_tag="Metev_0193"
FT   CDS_pept        197001..197378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0193"
FT                   /product="ribosomal protein S8e"
FT                   /note="KEGG: mba:Mbar_A3465 30S ribosomal protein S8e;
FT                   TIGRFAM: ribosomal protein S8e; PFAM: Ribosomal protein
FT                   S8E"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73123"
FT                   /db_xref="GOA:D7E6A1"
FT                   /db_xref="InterPro:IPR001047"
FT                   /db_xref="InterPro:IPR018283"
FT                   /db_xref="InterPro:IPR020919"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6A1"
FT                   /inference="protein motif:TFAM:TIGR00307"
FT                   /protein_id="ADI73123.1"
FT                   /translation="MKWQGRSKRTPSGAKITPVRGKRKHEIGRESTETYVSETKRKNIA
FT                   SRGCNRKYRLLRCNEANVTNPADGTTQKSTIENVVENPANVHYMRRNIITKGSVIKTGL
FT                   GNAKVTSRPGQDGVVNAVLIE"
FT   gene            197429..197920
FT                   /locus_tag="Metev_0194"
FT   CDS_pept        197429..197920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0194"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: mac:MA0924 leucine responsive regulatory
FT                   protein; PFAM: Transcription regulator, AsnC-type-like;
FT                   SMART: Transcription regulator, AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73124"
FT                   /db_xref="GOA:D7E6A2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6A2"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADI73124.1"
FT                   /translation="MDKHTWHILEILEENARATPEDIASQTGLPVTEVNDIISKLEKDK
FT                   IIRKYKTIIDWEQAGEDYVYAIIELKVVLERKQGYQAIAERLYKFPEVRSVRLISGDHD
FT                   ISITVRGRSMKEVAFFVAEKIATLEQIHSTSTHFVLKTYKEDGFIFDEPEKIKRLPVSP
FT                   "
FT   gene            197943..199118
FT                   /locus_tag="Metev_0195"
FT   CDS_pept        197943..199118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0195"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   mbu:Mbur_2099 aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73125"
FT                   /db_xref="GOA:D7E6A3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6A3"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADI73125.1"
FT                   /translation="MRPQCDPSCFVADHLKKVPPSGIRRFFDIVCEADDVISLGVGEPD
FT                   YITPWHIRESCIHSIEQGETSYTSNYGLLELREQISELFSKKYNVEYNPESEVLVTTGV
FT                   SEALDIAIRAIVNPGDEVIVVQPSYVAYVPSIIFAGGVPVTVSTKMSNNFKITPEELKN
FT                   VITENTKAVVLNYPNNPTGATMDKADLEAIADVVVDNDLMVISDEVYDCLTYEGEHTCF
FT                   SSLEGMRNRTILLNGFSKSYAMTGFRIAYALGDSEIINSMMLIHQYTMLCAPIVAQLGA
FT                   MEALRNGNDELDKMIREYDRRRNLIVDGLNRIGLECFEPKGAFYAFPSIQSTGMTSSEF
FT                   AENLLDDQKVVTIPGDVFGEAGQGFLRCSYAASKDEIQEALERIETFVNKT"
FT   gene            complement(199128..199502)
FT                   /locus_tag="Metev_0196"
FT   CDS_pept        complement(199128..199502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0196"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   mbu:Mbur_2097 transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73126"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6A4"
FT                   /inference="protein motif:PFAM:PF01978"
FT                   /protein_id="ADI73126.1"
FT                   /translation="MAHSIPEMLRANFNCDDVAKCILGLKELDLQAYKLLLVNGPMTAE
FT                   KLGKLLDRERSTSYRSLQNLISCGLVYRESRSIDVGGYYYEYVAISPESVKKMMQDNID
FT                   DWYKKVSSLIDNIDEELAVD"
FT   gene            199613..200296
FT                   /locus_tag="Metev_0197"
FT   CDS_pept        199613..200296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A3462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73127"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="InterPro:IPR040777"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6A5"
FT                   /inference="similar to AA sequence:KEGG:Mbar_A3462"
FT                   /protein_id="ADI73127.1"
FT                   /translation="MEPIIPEDERSDKPLDTDEIIYHPDMKRANDWILDEYEPPERDVC
FT                   IFVPCAKKKPYHESPSHQTFDKVIFGLLNPEQVHVVVFGTCGVTPRELDNQYPFMHYQF
FT                   MLGKCDVPKIKRDFIKMESERLARYLEKTRYKYKHRIAYCIGDFRKAMEKAVEMVDIDV
FT                   KIVPKEDTIQKNIHLDKKFIYGSLNQKDYLQDFSDAITTKMGLEKKTVAIDKEHSENDN
FT                   DWYLF"
FT   gene            complement(200325..201065)
FT                   /locus_tag="Metev_0198"
FT   CDS_pept        complement(200325..201065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0198"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /note="PFAM: Circadian clock protein KaiC central region;
FT                   KaiA binding; KEGG: mbu:Mbur_2095 KaiC"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73128"
FT                   /db_xref="GOA:D7E6A6"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6A6"
FT                   /inference="protein motif:PFAM:PF06745"
FT                   /protein_id="ADI73128.1"
FT                   /translation="MAETPQEETSQPERVSTEIPGLDDMLHGGFFTETVNVVSGNSGTG
FT                   KTIFGSQFLYEGAKKGEKGMLIITSEESKSLVREMKTSFGWDLKEMEQQGYISFVDITD
FT                   PSLRLQKSVEIAPSELIKSFKKLVESKIEKEKPERVFVDSIEALFLAIESNYKLRTMVD
FT                   DVFSVFRSHGVTSVVTVGTLFELNDVVEYGADSVIKLERFKTGNTLQRSIYVMKMRGSK
FT                   TINEIRVLNISDNGMGVLAQSPYL"
FT   gene            complement(201236..201862)
FT                   /locus_tag="Metev_0199"
FT   CDS_pept        complement(201236..201862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0199"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /note="PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase; KEGG: mba:Mbar_A3457 putative
FT                   nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73129"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6A7"
FT                   /inference="protein motif:PFAM:PF01128"
FT                   /protein_id="ADI73129.1"
FT                   /translation="MDVVVMAGGRGTRLGMGEKPCVQLLGSPLISYVIDALEKADNIDN
FT                   IYVAVSQATPNTEIYVSNQYQNRVNVIETAGGDYVGDMIYAVENAGIKEPVMIIMSDLA
FT                   LITPELIDKIVDEYRECGKPALSVHIPISVCKNLGIRPDTVFHRDGNLIVPTGVNILDG
FT                   KYIRQEQDDHNLIMDHPELALNINTADDLERCKKKLLERSGQTSQ"
FT   gene            complement(201847..202665)
FT                   /locus_tag="Metev_0200"
FT   CDS_pept        complement(201847..202665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0200"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /note="KEGG: mbu:Mbur_2092 cobalamin-5'-phosphate synthase;
FT                   TIGRFAM: cobalamin 5'-phosphate synthase; PFAM:
FT                   cobalamin-5-phosphate synthase CobS"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73130"
FT                   /db_xref="GOA:D7E6A8"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6A8"
FT                   /inference="protein motif:TFAM:TIGR00317"
FT                   /protein_id="ADI73130.1"
FT                   /translation="MNSYLLAVKSGFGFLSTIPFGLTMEGLDELVKRIYLFPFVGIVIG
FT                   LIIGTFAYLFGFVFPPVISAVAIIITVYYFTGFNHLDGLADFGDGLTAHGSREKKINAM
FT                   KDVSLGIGGAAFCVLGLVSLYAVITTLLDESLVQNINLSTSLLIFSSLVVAEISAKQSM
FT                   LTIAAFGKSIHEGLGSMVIDNTTFPKFIIGLAGGGFFCWLVLGIFGIVGFIAAMISALI
FT                   ILNITNRHFGGVTGDGLGTSNEVGRIITLLAVFLMIKGGYTGGVMIWTLL"
FT   gene            complement(202687..203244)
FT                   /locus_tag="Metev_0201"
FT   CDS_pept        complement(202687..203244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0201"
FT                   /product="alpha-ribazole phosphatase CobZ"
FT                   /note="KEGG: mba:Mbar_A3455 hypothetical protein; TIGRFAM:
FT                   alpha-ribazole phosphatase CobZ; PFAM:
FT                   phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73131"
FT                   /db_xref="GOA:D7E6A9"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR017577"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6A9"
FT                   /inference="protein motif:TFAM:TIGR03161"
FT                   /protein_id="ADI73131.1"
FT                   /translation="MKLSDVDEKDLKGEQPEELEEEKYDNEIYNVMEKNGVSKKDIIDT
FT                   AMELYFSHPGLETKEKAESIFIRELDIAFSDPNLCILVYSGILLEKEGKEGSLPNLSKS
FT                   SYEKDLSFIIADEVLGMSISKYISGDKGMFEYVRFDKEKPGILSKLGPFMDDVVAGIVG
FT                   GVSANMYTRAIAEMDNNNDSSE"
FT   gene            complement(203274..204266)
FT                   /locus_tag="Metev_0202"
FT   CDS_pept        complement(203274..204266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0202"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="KEGG: mma:MM_2059 CbiB protein; TIGRFAM: cobalamin
FT                   biosynthesis protein CobD; PFAM: cobalamin biosynthesis
FT                   protein CbiB"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73132"
FT                   /db_xref="GOA:D7E6B0"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6B0"
FT                   /inference="protein motif:TFAM:TIGR00380"
FT                   /protein_id="ADI73132.1"
FT                   /translation="MIGFLTPDAEFFISVLIIATVFDLLVGEPPASIHPVVWIGKFIAF
FT                   MDKSSPDKSRKLYGIFLAAICIVFASAIGYIITLFTAASYIPETVAILISAYFLKSTFA
FT                   IRSLITPGQDIYNDLIQNRLDDVRSKLKIFVSRDPSELNSSQMSSAVIESTSENFTDGI
FT                   LSPIFYYSILGPFGLVAVYAYKAVNTLDSMIGYKNDAYKELGYVSAKLDDILNWIPARI
FT                   SVVFIALSAFVVNIFVEKKLSIIDSLKCAYYEGGLTSSPNSGYPMAAVSGALRVKLEKP
FT                   DTYTLGDSFPGPEPSDIKRVSQIIISAAIISIIIFSLIIYGIMNLIGYI"
FT   gene            complement(204263..205750)
FT                   /locus_tag="Metev_0203"
FT   CDS_pept        complement(204263..205750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0203"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; cysteine-rich
FT                   small domain; KEGG: mba:Mbar_A3453 L-threonine
FT                   O-3-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73133"
FT                   /db_xref="GOA:D7E6B1"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005860"
FT                   /db_xref="InterPro:IPR007212"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6B1"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADI73133.1"
FT                   /translation="MSSENTGLPVRSEILQLQPCVHGGLVRETAQKYNLDESDLLDFSA
FT                   SLNPLGTPFQYYNCSLEELVSNNTEKLTRYPDNRYLEFRDAAAGFIGNQDRENIIPGNG
FT                   SCELIRLVAECVVEKGDQVIIPQPTFDEYELQCRIFGARPVYINYSEIPQISDELLNSS
FT                   KILFVCNPNNPTGELLSRSILKDLADRCAETSTLLFVDEAFIELSDPEQSVAELVKDNN
FT                   FVFVMRSLTKSFAIPGIRVGFGVASQKLANVLDNARLSWNMGFVSDVVGTKLLKMKGGV
FT                   YSSYFRDSRKMIDRERKYLIDRISRIHGFTPLDSSVNYILVDVSESVMDSKELSQRLAA
FT                   RGILVRDCSSFCSLGDEFIRVAVRNSEDTDKLAKNIGELLTEWGQEQGNKYLESKLESA
FT                   STGNHSGRSTCEYYPCHYPGQDCTFCFCPFYPCEDERTGGQYIKSTGGGKVWSCSDCHI
FT                   IHREKIVEQVLDVLMDENGDTKQNLNKAWERIVEPLL"
FT   gene            206035..207261
FT                   /locus_tag="Metev_0204"
FT   CDS_pept        206035..207261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0204"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="TIGRFAM: histidyl-tRNA synthetase; KEGG:
FT                   mbu:Mbur_2348 histidyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73134"
FT                   /db_xref="GOA:D7E6B2"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6B2"
FT                   /inference="protein motif:TFAM:TIGR00442"
FT                   /protein_id="ADI73134.1"
FT                   /translation="MKLSKPRGTRDFLPGETARRRYVENTIRDVVIKWGYSEVMTPTFE
FT                   TLELFTLKSGDDIIGELYNFTDKGGREIALRPELTAPVMRMYVNKLQSEPHPLKLFYFE
FT                   NCFRYERPQKGRFREFWQFGTEVIGSDKPEADAEVIALAVNILDSVGVNGALHVGDLRI
FT                   IRHILSGLDNEQQTKVMRYVDKNDDKGLDDYLEEIEVPAETRRNLFELISLQGNDALEK
FT                   AREITGDIPELDNFEELLKLLDVYGLDYTIDFGIARGLDYYTGMVFEIYAEGLGAQNQV
FT                   CGGGSYQLIKLFGGGEVPSTGFGIGFDRIMEVASIEPEETKKLVVVSTDSTRFEAIDIA
FT                   NRLREVYPTHVDIMERNFKSQLSFANMVEADYAVIVGEREIESGKLTLKNMHTGEQCSM
FT                   TVDEILNMD"
FT   gene            207458..207916
FT                   /locus_tag="Metev_0205"
FT   CDS_pept        207458..207916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0205"
FT                   /product="Ribosomal S13S15 domain protein"
FT                   /note="PFAM: Ribosomal S13S15 domain protein; ribosomal
FT                   protein S15; KEGG: mbu:Mbur_2345 30S ribosomal protein
FT                   S15P"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73135"
FT                   /db_xref="GOA:D7E6B3"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="InterPro:IPR012606"
FT                   /db_xref="InterPro:IPR023029"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6B3"
FT                   /inference="protein motif:PFAM:PF08069"
FT                   /protein_id="ADI73135.1"
FT                   /translation="MAKMHTRRKGQSGSTRPMRNEVPEWSPLDVNEIEQKVIELWKNGY
FT                   SSSEIGMILRDIHGVPDVKLATGKKITSILVENNEEFHVPEDLYNLVVKAIRIRKHLDI
FT                   NPHDIHNKRSLQNIEAKIRRLAKYYRSNNVLPSDWKYKPETAEMLITR"
FT   gene            208021..209373
FT                   /locus_tag="Metev_0206"
FT   CDS_pept        208021..209373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0206"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: mbu:Mbur_2340 phosphoesterase,
FT                   RecJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73136"
FT                   /db_xref="GOA:D7E6B4"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6B4"
FT                   /inference="protein motif:PFAM:PF01368"
FT                   /protein_id="ADI73136.1"
FT                   /translation="MTGNSESLDELISTAKQVSETILKYSNVRVVSHNDTDGITSAAII
FT                   CQALLREKIRYHATIVSRLDESVIEDVNNTISEGDLVIFCDMGSGQPDLISNVSEDTVV
FT                   IDHHNPEGESTAKAVLNPHFSEIDGSTYLSASGSTYMVAREMDSSNVDLSGLAVTGAIG
FT                   DKQVFESANEFILDESVKNSVISVKKGLKIGEGDIAQLLENVPEPYLDISGDREKIDEF
FT                   LSSLNVHGNINDLDSEDFKKLASAITLKIIKNASTEAVESVIGDVYTLNKEPVQDIYEF
FT                   IRILNACGKVKKGGLGLTLCLRDTSVLDEARQISLEYNRNIVDQIKKAESLIQCGSNIR
FT                   YLNAESMDSIGIVAGVIIRYMYPDMPVIATNEVEDVVKVSARATHHLIEKGVDLNYAMR
FT                   EAAKLTVGSGGGHNIAAGAAIEKGQVENFINIVDDIIGKQLNPDTESSDED"
FT   gene            209363..209599
FT                   /locus_tag="Metev_0207"
FT   CDS_pept        209363..209599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_2339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73137"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6B5"
FT                   /inference="similar to AA sequence:KEGG:Mbur_2339"
FT                   /protein_id="ADI73137.1"
FT                   /translation="MKINCRIIFEDDESTGIAKFAAYSLQPDNLPSMCTEVDEYGATTY
FT                   FYTEKITTLISTLDDFLMNTKIAEDVYTSLKKN"
FT   gene            209678..211189
FT                   /locus_tag="Metev_0208"
FT   CDS_pept        209678..211189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0208"
FT                   /product="Serine--tRNA ligase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: mbu:Mbur_2337 seryl-tRNA synthetase; PFAM:
FT                   tRNA synthetase class II (G H P and S)"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73138"
FT                   /db_xref="GOA:D7E6B6"
FT                   /db_xref="InterPro:IPR004503"
FT                   /db_xref="InterPro:IPR041293"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6B6"
FT                   /inference="protein motif:PRIAM:6.1.1.11"
FT                   /protein_id="ADI73138.1"
FT                   /translation="MELKFNIKGSFKTSDDASPATEAIDEFINEANETILKKGAPEGEG
FT                   ANVVDWNVDGSKINITIESGRYVRAHDALLRMRKPLAKKLGKDYRIGIRGIEIDSFNIS
FT                   IPSENQDLGELKIPYVTDIDYNDSVIKLSLDVGESELQNRVPDRILTLMEDKIAALRYG
FT                   GKAEHWEVLWQSGKKEPKFFDDPTKEMMNRGWIKRGASRGQWIHGPQLAKLFRTFEKIV
FT                   IEEMLEPLGYKEMMFPKLIPWDVWKKSGHAKGVYPEIYYVCPPKSRDPEYWEEVTDYYN
FT                   VTHEVPTEKIKEKIGEPIGGLCYAQCPPFWIYLQGETIPTNEFPLKVFDHSGTSHRYES
FT                   GGIHGIERVDEFHRIEIVWLGTHDQVVSESKALQDKYRHIFDDILDLEWRKAGVTPWFM
FT                   AQEGLTGTSEQTDVGTIDYEAPLPYRGDDGEWLEFQNVSINGNKYPKGFNVKSQSGDEL
FT                   WSGCSGVGLERWASVFLAQKGLDPENWPDEFVKRFGELPEGIHFL"
FT   gene            211331..211921
FT                   /locus_tag="Metev_0209"
FT   CDS_pept        211331..211921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0209"
FT                   /product="ribosomal protein S3Ae"
FT                   /note="PFAM: ribosomal protein S3Ae; KEGG: mbu:Mbur_2336
FT                   30S ribosomal protein S3Ae"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73139"
FT                   /db_xref="GOA:D7E6B7"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR030838"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6B7"
FT                   /inference="protein motif:PFAM:PF01015"
FT                   /protein_id="ADI73139.1"
FT                   /translation="MARKVQKKLDKWKSKNWYNIEPPEFLSSSYIGVTPAENTKDLLGR
FT                   VVETTVGQLTNDITKEKTKLRLQIDNVVGDSAKTRFIGHEITTDYLRSIVKRQTSRIDN
FT                   NVVVTTNDGNKVRVKPICFTVKRAHSSQIKAIRKVMKDVVKARASEVDYGQFIDEAISG
FT                   KLAANIYRNTKKVYPIRRAEIRKTEVQAEPITA"
FT   gene            complement(211927..212130)
FT                   /locus_tag="Metev_0210"
FT   CDS_pept        complement(211927..212130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtp:Mthe_1094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73140"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6B8"
FT                   /inference="similar to AA sequence:KEGG:Mthe_1094"
FT                   /protein_id="ADI73140.1"
FT                   /translation="MTEEEYIEVCPVCGSSHWYYEAGGYTGKLYHCKNCGYIGPLIVEA
FT                   NQEMIDAIKQDYKRKKESKEGS"
FT   gene            complement(212149..213096)
FT                   /locus_tag="Metev_0211"
FT   CDS_pept        complement(212149..213096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0211"
FT                   /product="protein of unknown function DUF523"
FT                   /note="PFAM: protein of unknown function DUF523; KEGG:
FT                   mac:MA4104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73141"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6B9"
FT                   /inference="protein motif:PFAM:PF04463"
FT                   /protein_id="ADI73141.1"
FT                   /translation="MEGFITPNIVISKCIEFEVCRYNGQIIKCPFIEKTKPYMNFIPVC
FT                   PECAIGMGVPREPIDIIIEGNKKRLIQTSTGKDFTEKMHRFNYSYFKSLNNIDGFLLKS
FT                   KSPSCGIGNVKAYADSKKLKLITTTENGFFGDEVVNYYPSLAREDENSLTDMYRREHFL
FT                   IKIFTLAKFRKICSFKNLIDFHKNNFLLFKAYNPDEKKIMDNIISKIESNNPVNVVEEY
FT                   RNHLYKLFVHPPKPNDYIEFMIEIFNQFSNLISNQEKLLFMENIQRYKEGKITLSTNRK
FT                   LLKSLIQRAGNTSYADQSFFNPYPGKLMETDYII"
FT   gene            complement(213147..214856)
FT                   /locus_tag="Metev_0212"
FT   CDS_pept        complement(213147..214856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0212"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; KEGG:
FT                   mbu:Mbur_2335 glutamyl-tRNA synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain; Glutamyl/glutaminyl-tRNA synthetase, class Ic,
FT                   anti-codon binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73142"
FT                   /db_xref="GOA:D7E6C0"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004526"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6C0"
FT                   /inference="protein motif:TFAM:TIGR00463"
FT                   /protein_id="ADI73142.1"
FT                   /translation="MTLNEEDKLTIRKYALQNAVKYSQPPKTGAVMGKVMSESPHLRQM
FT                   AKEVKPLVEDVLNEVSEGTPDVWKEELNKIAPELLQELYTKKEPTKGLKPLDVEEGEEV
FT                   VMRFAPNPNGPPTLGSTRGIVVNSEYVKKYNGTFIIRFDDTDPQTKRPMMEAYDWYIED
FT                   CKWLGAEPDKVVYASDRIPVYYEYAEKLIEMGNAYVCFCKGDEFKKYKDNKKACPHRNQ
FT                   SPEDNLYYWNNMLNGEYGEKEAVLRIKTDIQHKDPALRDFGAFRIIKTSHPRPEVDGKY
FT                   VVWPLLDFEGAIEDLECEVNHIIRGKDLRDSERRQRYIYEYFGWKYPKTTHWGRVKIHE
FT                   FGKFSTSSIAKSIENGEYLGWDDPALPTIRALRRRGIQPEAIRKFMIDMGVGETDISIS
FT                   LESLYAENRKLVDSNANRYFFVWNPVELEITGVEPRNVKLSLHPKEKRGYRELEIGSKL
FT                   YVCQEDIDSINVGDKLRLKDLYNIEVTSLNPLKARYLDDSVERIKKANLPIIHWIPVNG
FT                   VSVKVIAPDGQYEGFGEHGIADEVDSVVQFERFGFCRIDSVDDKIIAFFAHK"
FT   gene            complement(214955..215260)
FT                   /locus_tag="Metev_0213"
FT   CDS_pept        complement(214955..215260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_2334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73143"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6C1"
FT                   /inference="similar to AA sequence:KEGG:Mbur_2334"
FT                   /protein_id="ADI73143.1"
FT                   /translation="MLLDQVNKELELTERHLLVLKKVIEKGPIGILRLAEETEMPTHKV
FT                   RYSLRILEQENLIKPSIHGATEGDMVDKFLSEFEQKTKSIQEKTARIREIRNSIEH"
FT   gene            complement(215260..216003)
FT                   /locus_tag="Metev_0214"
FT   CDS_pept        complement(215260..216003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0214"
FT                   /product="Ureidoglycolate lyase"
FT                   /EC_number="4.3.2.3"
FT                   /note="KEGG: mba:Mbar_A1468
FT                   2-hydroxyhepta-2,4-diene-1,7-dioate isomerase; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73144"
FT                   /db_xref="GOA:D7E6C2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6C2"
FT                   /inference="protein motif:PRIAM:4.3.2.3"
FT                   /protein_id="ADI73144.1"
FT                   /translation="MFGRFKYKNEIFYGDVDNDKEHVTGRGECNRLIFKLSDIEVLPPV
FT                   NPSKIICVGLNYQDHANELGLDIPNKPLIFLKPSSSIIGNCDKIVHPKTSNHIEYEAEL
FT                   GVVIGKKCKHVKADSTNNVIAGYTCFNDVTARDLQKQDGQWTRAKSFDTFAPVGPFIAT
FT                   ADDINLHNANIKCRVNGITCQNSNTSNLIFGVPHLIEFISDIMTLQPGDIIATGTPPGV
FT                   GKIHSGDIVEIEIEGIGTLSNEVVE"
FT   gene            216127..216768
FT                   /locus_tag="Metev_0215"
FT   CDS_pept        216127..216768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0215"
FT                   /product="Ribosyldihydronicotinamide dehydrogenase
FT                   (quinone)"
FT                   /EC_number="1.10.99.2"
FT                   /note="KEGG: mac:MA0326 quinone reductase; PFAM: NAD(P)H
FT                   dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73145"
FT                   /db_xref="GOA:D7E6C3"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6C3"
FT                   /inference="protein motif:PRIAM:1.10.99.2"
FT                   /protein_id="ADI73145.1"
FT                   /translation="MNVLYVYAHQEPKSFNSSMKDTALEAFEERGDSVKVSDLYAMNFD
FT                   PVLDENDFKNRKYTDIFNPFLEQLHANKTDGFAPDIKAEMDKINWADMLIFQFPIYFTG
FT                   FPAIMKGWIDRVFSPGFAFNPLTQSAYETGLLKGKKSMLVTTAGADKDWYSKGGMHGDI
FT                   HELLKSITHCTLEFTGLEVLPTHVVYGASNLSEDDAKKELERYRELILSL"
FT   gene            complement(216765..216881)
FT                   /locus_tag="Metev_0216"
FT   CDS_pept        complement(216765..216881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0216"
FT                   /product="zinc finger C2H2-type domain protein"
FT                   /note="KEGG: rno:311764 zinc finger protein 217; PFAM: zinc
FT                   finger C2H2-type domain protein; SMART: Zinc finger,
FT                   C2H2-like"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73146"
FT                   /db_xref="GOA:D7E6C4"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6C4"
FT                   /inference="protein motif:PFAM:PF00096"
FT                   /protein_id="ADI73146.1"
FT                   /translation="MGDKSEKKENKFECKVCEMTFPTRQDYERHMKKHHESG"
FT   gene            complement(216902..218881)
FT                   /locus_tag="Metev_0217"
FT   CDS_pept        complement(216902..218881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0217"
FT                   /product="glycoside hydrolase 15-related protein"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   bbe:BBR47_37840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73147"
FT                   /db_xref="GOA:D7E6C5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6C5"
FT                   /inference="protein motif:PFAM:PF00723"
FT                   /protein_id="ADI73147.1"
FT                   /translation="MTRHIVLGNQSLLVNIDKWFQVRDIYYPYVGLENHVLGHAHKIGI
FT                   FVDGIFSWINEDDWIKLPAYKNDTLITENKATNKNLGLKLILEENVYCEDNIFLRKITI
FT                   KNERSYKRNIRLFFNQDFHLYGTGIGDTAVYQMDHNVIIHYKRSRYFLVGALKSDEKNG
FT                   FASDIEDYAIGESETGYLEGTFRDAEDGVLSRNPVAQGSVDSTVGVSLEVPGNSSNTAY
FT                   YYMTVGQNFDDVYRLHDYLMDVGAEAILDHSEECQRSWVNHTSTDLSNLDSRLATLYKR
FT                   SLLIIKTQYDTHGAIIAANDSDNLQFNRDTYSYMWSRDGALVAITLINAGFAEFTKPFF
FT                   RFCRDVLWWEGCMLHKYNPDKTLGSSWHPWVEDGKPALPIQEDETALVIYALWKYYEST
FT                   GDLDFIKQLYEPLIKKAVFFMDDYRYPNSLPRESYDLWEERRGIYTFTSATVYAGLASA
FT                   EKISYLFNDTEICNICRSRYFPLRNAILKELFDRDKEIFIRGLKYQKSNPDQKEIDHTI
FT                   DSSIYAIFEFGLLSADDEKVKNTMKNIESKLWVNKSGGVARYENDHYHKVSDKSTGNPW
FT                   IICTLWLAKWYIKKSENFAELDKALNLINWVADCSFETGIMPEQVNPLTRESISVAPLT
FT                   WSHAEFVDTVTKYIDKTKKLESKT"
FT   gene            218989..219426
FT                   /locus_tag="Metev_0218"
FT   CDS_pept        218989..219426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0218"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   mbu:Mbur_0249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73148"
FT                   /db_xref="GOA:D7E6C6"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6C6"
FT                   /inference="protein motif:PFAM:PF07366"
FT                   /protein_id="ADI73148.1"
FT                   /translation="MSSEDTVETGNPSTENNKALIRQVVEKAWKPSVIKEVCASDYVIH
FT                   FGRETLTRDDLIEFMSMLHSALMDLRFTADDIIAEGDKVVTRWTASGTHQGVFQGIQPT
FT                   GNHVVFTGITISRIENGIIVEDWEEVDQLNFTQQFGVFPEV"
FT   gene            complement(219423..220202)
FT                   /locus_tag="Metev_0219"
FT   CDS_pept        complement(219423..220202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0219"
FT                   /product="Dihydroorotate dehydrogenase, electron transfer
FT                   subunit, iron-sulfur cluster binding domain protein"
FT                   /note="PFAM: Dihydroorotate dehydrogenase, electron
FT                   transfer subunit, iron-sulphur cluster binding domain;
FT                   oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   Oxidoreductase FAD-binding domain protein; KEGG:
FT                   mma:MM_1746 dihydroorotate dehydrogenase electron transfer
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73149"
FT                   /db_xref="GOA:D7E6C7"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR023455"
FT                   /db_xref="InterPro:IPR037117"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6C7"
FT                   /inference="protein motif:PFAM:PF10418"
FT                   /protein_id="ADI73149.1"
FT                   /translation="MYPLNTRLIDIVQESPSTKTFFFDRYFDANAGQFLMVWVHGVDEI
FT                   PMTLSYNSGITVQKVGDATSRLFELEKGDTIGLRGPFGNGFTLPEKSDKILLVAGGLGA
FT                   APLAPLAEYSFKNGVDVTTILGARSSTELIFGERFSSAGDLYITTDDGTSGTCGFVTDI
FT                   LTNLNLSDYDRIYTCGPEVMLRCIFNMLQDEKYVLEKTEFNLHRYFKCGIGVCGACCID
FT                   PKGLRVCKDGPVFKGTELIDSEFGEYKRDASGKRVKI"
FT   gene            complement(220209..221117)
FT                   /locus_tag="Metev_0220"
FT   CDS_pept        complement(220209..221117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0220"
FT                   /product="dihydroorotate dehydrogenase family protein"
FT                   /EC_number="1.3.98.1"
FT                   /note="TIGRFAM: dihydroorotate dehydrogenase family
FT                   protein; KEGG: mbu:Mbur_1225 dihydroorotate dehydrogenase
FT                   1B; PFAM: dihydroorotate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73150"
FT                   /db_xref="GOA:D7E6C8"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023359"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6C8"
FT                   /inference="protein motif:TFAM:TIGR01037"
FT                   /protein_id="ADI73150.1"
FT                   /translation="MVAKKSLYPHPKNPVILASGIMGTTGASLTRMAYNGAGAVVTKSI
FT                   GPVPKKGHSNPTMIELENGFLNAMGLPNPSYTEFVQEIENAKNNTSTPIIASIFAGDTE
FT                   GFVKVAEELSSANPDGFELNVSCPHAEGYGATIGCDSCLVEEITASVCDVIDVPVWVKL
FT                   TPNVTNIVDIGKAAERGGADAVVSINTVRGMSIDINTGYPILGNRYGGLSGRAIRPIAV
FT                   KCVYDLYASLDIPVVGVGGVSCWQDAVEMIMAGASAVQVGSAVSQSMDVFKSISSGIED
FT                   YLSANEYSTIDEIIGFSHKMG"
FT   gene            complement(221127..222053)
FT                   /locus_tag="Metev_0221"
FT   CDS_pept        complement(221127..222053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0221"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="TIGRFAM: porphobilinogen deaminase; KEGG:
FT                   mbu:Mbur_1226 porphobilinogen deaminase; PFAM:
FT                   Porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73151"
FT                   /db_xref="GOA:D7E6C9"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6C9"
FT                   /inference="protein motif:TFAM:TIGR00212"
FT                   /protein_id="ADI73151.1"
FT                   /translation="MDLIIGTRGSSLALTQTRRVSQMLKEEGVNTFLKIIKTSGDSFTD
FT                   RPLHELGGVGAFVREIDERMLSGELDIAVHSMKDLPTERPEELPTSAVLKRDSPFDALL
FT                   TRDGSTLDELPEGAVIGTTSLRRKSQVLRYRPDFDVQSLRGNIDTRLKKLESGIYDGII
FT                   LAEAGLRRMGWDIPVHQLDTDHFCPSANQGAIAVVAKSGDESENVVSRINHPQTKIETE
FT                   IERILIGNVGGGCIVPIGAYAEFVNDEKIHIRSEVLALDGSHYVAVDDVISADNYKEEA
FT                   NELGEELVRKGGKKLVQEALDKMANAE"
FT   gene            complement(222075..223352)
FT                   /locus_tag="Metev_0222"
FT   CDS_pept        complement(222075..223352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0222"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="KEGG: mma:MM_1743 glutamate-1-semialdehyde
FT                   aminotransferase; TIGRFAM:
FT                   glutamate-1-semialdehyde-2,1-aminomutase; PFAM:
FT                   aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73152"
FT                   /db_xref="GOA:D7E6D0"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6D0"
FT                   /inference="protein motif:TFAM:TIGR00713"
FT                   /protein_id="ADI73152.1"
FT                   /translation="MEGENTKSKQLYEQAKKIISGGVSSPVRAIQPYPFYTESAQGSRI
FT                   KDVDGNEYIDFCMGYGPNLLGHAHPEIKQAIAEQLDNGWLYGTPLENEVKLAEKVTDAY
FT                   PSMDMLRFVSSGSEATMSAIRTARGYTGKNKILKIEGGFHGTHDSVLVKAGSGATTLGK
FT                   PNSKGVPEEVTKHTLQAPFNDIESMTELIEKNRDDMAAVIMEPVMGNIGPILPKENYLK
FT                   EVRKVTEENDVVLIFDEVITGFRLAMGGAQEYYNVTPDMTTLGKIVGGGMPVGVFGGKR
FT                   EIMDMVAPNGNVYQAGTFSGNPATLSAGIATMDVLENENVHDTLNKKGDEIRSCLSDII
FT                   SDAGLDYEVSGISSMFKVFFGKAPTNYQETLKCDKSGYFDFFKRMLNDGIFLPPSQFET
FT                   NFLSYAHSDSDIQKLLNAYESNLKQS"
FT   gene            complement(223424..224401)
FT                   /locus_tag="Metev_0223"
FT   CDS_pept        complement(223424..224401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0223"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="KEGG: mba:Mbar_A1463 delta-aminolevulinic acid
FT                   dehydratase; PFAM: delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73153"
FT                   /db_xref="GOA:D7E6D1"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6D1"
FT                   /inference="protein motif:PRIAM:4.2.1.24"
FT                   /protein_id="ADI73153.1"
FT                   /translation="MFPQVRMRRLRQGKLQNLVRETTITADDLICPVFVDENIETPQEV
FT                   PSMPGTYKLPVDYAADEAKEISDLGIPSIMIFGVPARKDESGSSAWGNNEVVQRAVRNI
FT                   RNDISSRDMAIITDVCLCEYTTHGHCGVVDYDKEEILNDPTLPLLGKTAVSHAEAGADM
FT                   VAPSGMMDGMVESIRSELDNNNFENIPIMSYAAKYFSAFYGPFRDAAESGYSFGDRSSY
FT                   QMNPSNSNEAIREVELDIDEGADIVMVKPALPYLDILYRIKDELEMPTAAYNVSGEYAM
FT                   IKAAAQNGWMDENKIIYESITSIKRAGADMILTYFAKDMAKLLK"
FT   gene            complement(224434..225684)
FT                   /locus_tag="Metev_0224"
FT   CDS_pept        complement(224434..225684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0224"
FT                   /product="glutamyl-tRNA reductase"
FT                   /note="KEGG: mac:MA0577 glutamyl-tRNA reductase; TIGRFAM:
FT                   glutamyl-tRNA reductase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Tetrapyrrole biosynthesis, glutamyl-tRNA
FT                   reductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73154"
FT                   /db_xref="GOA:D7E6D2"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6D2"
FT                   /inference="protein motif:TFAM:TIGR01035"
FT                   /protein_id="ADI73154.1"
FT                   /translation="MTQQISSMVITHTKASIEEMEKAWHGDIEYVLKSLYSHEYVYECA
FT                   VLKTCNRVEVYVVSPKASSVLFHFAKDMGASSHIVEFYDHEDSLKHLLRLASGLESMIV
FT                   GEDQILGQIKDLYTTAKNVGTIGPALDTAFSKAIQVGKKARTETRINKGSVSIGSAAVD
FT                   LADEILGGLTGKNILVIGTGEMGTLVARALAHKDMDVVYLANRTFETAKQLAEEIGGDA
FT                   VLFDNIDECIRNADVVICATAAPHFVLRKSTIEKAMDDRNKELLLIDIATPRDIEPEIS
FT                   EIEHVKLHNIDSLRRINEKNMEMRRGEAKKVDALIEEEFELLNTQYKRQKADGLISQLY
FT                   GQVHNVREREKQRAINRLSSYHTIGDIESEVLDDLTHSIVNKILAEPTKMLRKAAENDE
FT                   DELMDTASRLFNLDNKK"
FT   gene            complement(225737..226420)
FT                   /locus_tag="Metev_0225"
FT   CDS_pept        complement(225737..226420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0225"
FT                   /product="siroheme synthase"
FT                   /note="TIGRFAM: siroheme synthase; KEGG: mba:Mbar_A1461
FT                   precorrin-2 oxidase / ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73155"
FT                   /db_xref="GOA:D7E6D3"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6D3"
FT                   /inference="protein motif:TFAM:TIGR01470"
FT                   /protein_id="ADI73155.1"
FT                   /translation="MNSDKNFTPLMIDLSGKKIIIFGAGSVGERKALFFSAYADTTIIS
FT                   TSFTSSIKELENSRKIKLITSNINSLNDSQIKDLIYDAFMVIPATNNRQLNQRITEVAN
FT                   KTDKNILVNQVDDIGDVIVPSVIKRGDLTIGISTLGSSPAISKFTRENIEQTITPEYSE
FT                   MAEIQNDIRTYLKEVISDQRKRKQILWNIIEDDSVWSALSDSYEKAYNIALNIVDEQLR
FT                   SEKID"
FT   gene            complement(226435..226938)
FT                   /locus_tag="Metev_0226"
FT   CDS_pept        complement(226435..226938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0226"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="KEGG: mbu:Mbur_1231 AsnC family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73156"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6D4"
FT                   /inference="similar to AA sequence:KEGG:Mbur_1231"
FT                   /protein_id="ADI73156.1"
FT                   /translation="MSDETSNNSSCYIDNKDNIYTKIIKLTQDGIPFTHSPFAQIASYL
FT                   GISEDEVINIIKEMENKGIIRRFGASIGHRAIGITANAMCIWNVPDEKVEEVGAIMAGF
FT                   SEVTHCYERPRYPDWPYNLFTMVHSYSKRDCEYVAEEISKATGITDYKLLFSEHEFKKT
FT                   GVRL"
FT   gene            complement(226928..227383)
FT                   /locus_tag="Metev_0227"
FT   CDS_pept        complement(226928..227383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0227"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="SMART: Transcription regulator, AsnC-type; KEGG:
FT                   mbu:Mbur_1232 AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73157"
FT                   /db_xref="GOA:D7E6D5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6D5"
FT                   /inference="protein motif:SMART:SM00344"
FT                   /protein_id="ADI73157.1"
FT                   /translation="MIQLDETDKKILNEIQLDFPLDTHPYEKLAERLGISEEEVIKRLE
FT                   DLYYKGAVRRIGPIINTRKTGGISTLVAVKAPDSQVSDIADYINQYPEVSHNYLRPDKY
FT                   NLWFTVSASSKQRLDEILEEIRNETGCPLINLPTKRLFKIGVKFDVR"
FT   gene            complement(227380..228441)
FT                   /locus_tag="Metev_0228"
FT   CDS_pept        complement(227380..228441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0228"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: mbu:Mbur_1233 radical SAM family Fe-S protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73158"
FT                   /db_xref="GOA:D7E6D6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR030896"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6D6"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI73158.1"
FT                   /translation="MAQPPKLIAWEFTKSCNLSCAHCRGSSTSKMDKDELSTGESKRFI
FT                   DEIANFGKPILILSGGEPLVRSDIFEIASYGTHKGLRVVMATNGTMVTSNIADKLKRSG
FT                   IQRVSISIDGATARTHDEFRGMPGAFEGALNGIEILKNTGIGIQINTTITKRNIKEIPD
FT                   IFEFAKNIGSDALHIFMLVPTGRGKEIEKDEIPPEEYEDILNWFYEKQKSSPIQLKATC
FT                   APHYFRIALQRSQEENKNPPFKKEGYNAMTRGCLGGTGFCFVSSKGEVYPCGYLPALAG
FT                   NIRDEKFEEIWNYSKVFNDLRDVTKLKGKCGICEYKNICGGCRARAYAGTGDYMDEEPY
FT                   CIYNPKQKSRVSK"
FT   gene            228824..229216
FT                   /locus_tag="Metev_0229"
FT   CDS_pept        228824..229216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73159"
FT                   /db_xref="GOA:D7E6D7"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6D7"
FT                   /inference="similar to AA sequence:KEGG:Mbur_1234"
FT                   /protein_id="ADI73159.1"
FT                   /translation="MNKGKKILTAMVFIAIVAIVGLWNVDFSDGYLMVSELKSNPKDYV
FT                   GGKVNTMGSIKNGTLNKTPESTSFILKDAESKTYQIYIEYTGDLPANLAEGKRISLSGT
FT                   MINDKKIKANKIVMGCPSKYNEKTSS"
FT   sig_peptide     228824..228898
FT                   /locus_tag="Metev_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.713) with cleavage site probability 0.588 at
FT                   residue 25"
FT   gene            229254..230120
FT                   /locus_tag="Metev_0230"
FT   CDS_pept        229254..230120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0230"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: mbu:Mbur_1235
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73160"
FT                   /db_xref="GOA:D7E6D8"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6D8"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ADI73160.1"
FT                   /translation="MNIEKWDEYIRITDAMDELIENMDDSSQIKNVVSHVCNYGGKRIR
FT                   PIILMLSTDICGGDSKTSINAALAVELMHSASLIHDDLIDDGIIRRGVPSAHKKFGHSA
FT                   AMLCGDFLISKSIELMSSYGHNAITEFGQAGMSMAHGETIDLGGDDAGFVEVNYFDCIY
FT                   KKTASLFAACASIGAYISGADDEMVHRCRLYGEYMGTAYQIVDDLLEYLHEIDDKSSVR
FT                   KSVTLPQIYTKQMTHEEAVNKTVDKVDEYVTQAKNIIVGFESENGKDKLLQITNHITID
FT                   MLPENYF"
FT   gene            230146..231330
FT                   /locus_tag="Metev_0231"
FT   CDS_pept        230146..231330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0231"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: mbu:Mbur_1236 radical SAM family Fe-S protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73161"
FT                   /db_xref="GOA:D7E6D9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6D9"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI73161.1"
FT                   /translation="MRVYDRSTIKVNATTKNNRVVLDAEGTFSPVVKPILTHINNVFGE
FT                   EKPVSADEDRIIFSTWLPPIPSSIFGRVVSSQIGSVFKRRIPDQFSIGITMKCPNNCIH
FT                   CGAADVVANPELSLDEINNAVTQSIDLGSYLISFDGGETMLRKDLEDMVENVDKERAIA
FT                   TVFTSGYGLTEQRAQSLKNAGLYAVRVSFDSPFEDEHDKVRGRDGAYQDAISAVKNAKS
FT                   ANLLTDMFVVVSPDNIDNLKEFYDLAVDLGVDEISLYEIVAVGRWLHQEDQILNDSDVS
FT                   RLETFQKNMNAKSEGPRVTAFPYIMGPKQFGCFAGRRWIHVTSAGDVLPCAYTPLSFGN
FT                   IREDNLKDIWKRMGKHSAYKNHADYCMMRNPEFRKKYIHTLPDDVQMPYRMDKN"
FT   gene            231567..231896
FT                   /locus_tag="Metev_0232"
FT   CDS_pept        231567..231896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0232"
FT                   /product="ATP synthase H subunit"
FT                   /note="TIGRFAM: ATP synthase H subunit; KEGG: mbu:Mbur_1237
FT                   H(+)-transporting ATP synthase, subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73162"
FT                   /db_xref="InterPro:IPR014275"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6E0"
FT                   /inference="protein motif:TFAM:TIGR02926"
FT                   /protein_id="ADI73162.1"
FT                   /translation="MAKDDVLLKIKEAEQSAEKTVEESVKEKNERISNAKAEADEIIKQ
FT                   AKKDAEESANNSYKSEEEKIRNENAKIIEDGKNEAESIKQKARENEDKAVDYLIKEFER
FT                   AITNA"
FT   gene            231889..233919
FT                   /locus_tag="Metev_0233"
FT   CDS_pept        231889..233919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0233"
FT                   /product="V-type ATPase 116 kDa subunit"
FT                   /note="PFAM: V-type ATPase 116 kDa subunit; KEGG:
FT                   mbu:Mbur_1238 V-type ATP synthase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73163"
FT                   /db_xref="GOA:D7E6E1"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6E1"
FT                   /inference="protein motif:PFAM:PF01496"
FT                   /protein_id="ADI73163.1"
FT                   /translation="MLEPKPMSRVLIVGHKNIMKDTVETLHNLNVYHIEDYNEEEPGLE
FT                   IGKPFESAEDISKKLVKIRSLSNYLGVKGDESVSEDADKVWSNLDDRLNELDSKITEKT
FT                   EERSELESKLKDIENLKKDLQPLSNIPLDLDLYRGYENISVFAGTVKENIDSLETDISG
FT                   ITNLYEIWKDPEWNAIALFVYKDYVGQVSKILSDYSFKELRIPEKSGVPKDILSKFEGD
FT                   KQSIEEKIESIDEEIESIKEQYSNFILASDELLSMEAEKAEAPLKMATSENTFVINGWV
FT                   PDDEYDTVVQSLDKATNGHAYVSIVESEESDEHEEYSEEEIPPTEYNNSKLTKPLETVM
FT                   DLYSRPRYKELDPTSLIFIALPLFYGMMLGDVGYALVILAAAFGIKKYVNMESLKPVMN
FT                   VLIYCQIFSFIFGILYGEVFGISLGTTHAGVPPWSPEPLYELFGVTFESHGHGFLSGLI
FT                   PGFETIYLFEFPFTNEMVSFPFHRPDAVLTLIVLTAVLGIIQINIGYVLGMVNVYRNHG
FT                   LMDAILEKGSWIIIELGVVLAALGFLEYLPTTIIGLAVFIIGFAMLFKGEGVKGAVELP
FT                   SLLSNVLSYARIAAVGLSSIYIAYIVNEIAFVMLSPDTSILLAILSILVFIFGHALNTV
FT                   LGVIAPGLQALRLQYVEFFTKFYEGGGKKYNPFGRIRKYTE"
FT   gene            233945..234181
FT                   /locus_tag="Metev_0234"
FT   CDS_pept        233945..234181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0234"
FT                   /product="H+transporting two-sector ATPase C subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase C subunit;
FT                   KEGG: mbu:Mbur_1239 H+-transporting two-sector ATPase, C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73164"
FT                   /db_xref="GOA:D7E6E2"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6E2"
FT                   /inference="protein motif:PFAM:PF00137"
FT                   /protein_id="ADI73164.1"
FT                   /translation="MAAEQFAMIDPAGYKAIGAGIAVGLAGIATGIAEKDIGSAAVGAM
FT                   AENESLFGKGLILTVIPETIVIFGLVVALIVGA"
FT   gene            234287..234838
FT                   /locus_tag="Metev_0235"
FT   CDS_pept        234287..234838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0235"
FT                   /product="H+transporting two-sector ATPase E subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase E subunit;
FT                   KEGG: mbu:Mbur_1240 V-type ATP synthase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73165"
FT                   /db_xref="GOA:D7E6E3"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6E3"
FT                   /inference="protein motif:PFAM:PF01991"
FT                   /protein_id="ADI73165.1"
FT                   /translation="MGLETVVNDIMDVAHAEAAQKKEEADTEAAQIIEDAKEKAKKIKG
FT                   DRLAETEAKIERLRRQEISSANLEVKRVKLNARKEILDEVYNKAVDSVSNLSPSKNEEL
FT                   LKSLIDKYEQHGTRVYSNKESEEIVKKLSSLEYAGNIDCIGGIVIENSDGSVRLNYTYD
FT                   TILKSVYDQSLKQISDILFG"
FT   gene            234844..235914
FT                   /locus_tag="Metev_0236"
FT   CDS_pept        234844..235914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0236"
FT                   /product="ATP synthase A1, C subunit"
FT                   /note="KEGG: mbu:Mbur_1241 V-type ATP synthase subunit C;
FT                   TIGRFAM: ATP synthase A1, C subunit; PFAM: H+transporting
FT                   two-sector ATPase C (AC39) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73166"
FT                   /db_xref="GOA:D7E6E4"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR014272"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6E4"
FT                   /inference="protein motif:TFAM:TIGR02923"
FT                   /protein_id="ADI73166.1"
FT                   /translation="MHLFSKLRRKSGGENLRTSNYSYVTARVRAMKSKLLPADTYSKFL
FT                   NMGIDEITRTIEELEYKQDIDVLARQYSGADLIEHALNRNLAVTFTKVLNMAEGEPNYL
FT                   LSKYLKRYDVWSLKTILRGKHYNASPNKIEENIISAGKYSFDFLSDLANKDSYTDVIST
FT                   LENTEYYPILKQYDGTNLSDIENELEKEYYKDLFISVSKLKSKNSRIFSEFVGTEIDIK
FT                   NLRTLFRLKMSGIEPEETRKLMIEGGHRVKMKDIESLLPLSFDEFLSAVDKYSYWYNFS
FT                   DVVSSEMESLIDLETQLLKQNVKFASSISHVYPLSIVPIMDYILNKKIEVDNLRIIIRG
FT                   KSAGLDKEVIRKQLVI"
FT   gene            235914..236213
FT                   /locus_tag="Metev_0237"
FT   CDS_pept        235914..236213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0237"
FT                   /product="Vacuolar H+transporting two-sector ATPase F
FT                   subunit"
FT                   /note="PFAM: Vacuolar H+transporting two-sector ATPase F
FT                   subunit; KEGG: mbu:Mbur_1242 V-type ATP synthase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73167"
FT                   /db_xref="GOA:D7E6E5"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR022944"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6E5"
FT                   /inference="protein motif:PFAM:PF01990"
FT                   /protein_id="ADI73167.1"
FT                   /translation="MELSVVGNGEFVTGFRLAGIRKIHEVSDENLESAVKEVIKDPEVG
FT                   ILVMHDDDFNKLPQNLRDKLNESVEPTVVTLGGTGQSSNLREKIKQSVGVDLWK"
FT   gene            236204..237940
FT                   /locus_tag="Metev_0238"
FT   CDS_pept        236204..237940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0238"
FT                   /product="ATP synthase, A subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="TIGRFAM: ATP synthase, A subunit; KEGG:
FT                   mbu:Mbur_1243 V-type ATP synthase subunit A; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73168"
FT                   /db_xref="GOA:D7E6E6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005726"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6E6"
FT                   /inference="protein motif:TFAM:TIGR01043"
FT                   /protein_id="ADI73168.1"
FT                   /translation="MEVKGEIYRVSGPVVIATGIRPKMYDVVKVGHEGLMGEVIKIEGD
FT                   KSTIQVYEDTSGIKPGEPVENTGLPLSVELGPGLLESIYDGIQRPLQVLQDKMGDFIAR
FT                   GATANGIDREKQWEFKPIVDKGDKVEPGDIIGVVQETPNLEHQIMVPPNMQGGTVSDIY
FT                   SGKFTVDETVCVLSNGKELSMLQKWPVRTPRPTKRKLKPDKPLLTGQRILDGMFPVAKG
FT                   GTAAIPGPFGSGKTVTQQQLAKWSDTDIVVYVGCGERGNEMADVLDEFPELEDPKAGRP
FT                   LMERTVLIANTSNMPVAAREASVYTGITISEYYRDMGYDVALMADSTSRWAEAMREISS
FT                   RLEEMPGEEGYPAYLAARLSEFYERAGYVKSNSGYDGSITVIGAVSPPGGDFSEPVTQN
FT                   TLRIVKVFWALDAKLSQRRHFPAINWLTSYSLYTESLSDWLSENVASDWIDLRNYAMDI
FT                   LEEESELQEIVQLVGSDALPESQQLKLEVARMFREYFLQQNAFHEIDRYCPFYKQYKLV
FT                   QAIHKFSETANSKLEAGYSINDIMAMESKDELAKVRYEEDFDGALNKVLSKMDDEFSQI
FT                   GG"
FT   gene            237947..239374
FT                   /locus_tag="Metev_0239"
FT   CDS_pept        237947..239374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0239"
FT                   /product="ATP synthase, B subunit"
FT                   /note="KEGG: mbu:Mbur_1244 V-type ATP synthase subunit B;
FT                   TIGRFAM: ATP synthase, B subunit; PFAM: H+transporting
FT                   two-sector ATPase alpha/beta subunit central region;
FT                   H+transporting two-sector ATPase alpha/beta subunit domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73169"
FT                   /db_xref="GOA:D7E6E7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005724"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6E7"
FT                   /inference="protein motif:TFAM:TIGR01041"
FT                   /protein_id="ADI73169.1"
FT                   /translation="MTKEYKTITQISGPLIFLEKTEPVGYGELVQINTEDGSTKRGQVL
FT                   DTSGDTVVVQVFEGTGGLNDSAGVVFTGETIKLPVSKDMLGRILSGSGEPLDEGPHIVP
FT                   DKRLDINGAAMNPYSRRPPEEFIQTGISTIDGTNTLVRGQKLPIFSGSGLPHNEIALQI
FT                   ARQSTVLGSEEEFAVVFAAMGITHEESQTFMDDFEKTGALERAVVFLNHADDPAVERMI
FT                   TPRMALTAAEYLAYEHDMHVLVILTDMTNYAEALRQMGAAREEVPGRQGYPGYMYTDLA
FT                   SLYERAGVIKGRKGSVTQIPILTMPGDDITHPIPDLSGYITEGQIVVSRELHRKGIYPP
FT                   INVLPSLSRLMGSGIGEGKTRDDHKKVSDQLYAGYAEGRDLRGLVAIVGKEALSERDRK
FT                   FLEFADHFEDRFVRQGRDENRSVEDTLNISWDILSELPIKQLTRIDDKIIEKYHPAKQT
FT                   TSKSEYQPQEQEVSGEQ"
FT   gene            239395..240015
FT                   /locus_tag="Metev_0240"
FT   CDS_pept        239395..240015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0240"
FT                   /product="V-type ATPase, D subunit"
FT                   /note="KEGG: mbu:Mbur_1245 V-type ATP synthase subunit D;
FT                   TIGRFAM: V-type ATPase, D subunit; PFAM: H+transporting
FT                   two-sector ATPase D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73170"
FT                   /db_xref="GOA:D7E6E8"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6E8"
FT                   /inference="protein motif:TFAM:TIGR00309"
FT                   /protein_id="ADI73170.1"
FT                   /translation="MAVEDVKPTRSELLEIKKKIKLSEDGHKLLKKKRDGLILEFFDIL
FT                   NQAKDVRSELDDAYKDANSKIGIAKSVEGTITVNSTAFSLKDYPKIHLQSNNIMGVVVP
FT                   KIESSSVRKPINQRGYGILGTSSYIDEATDAYETLVEKIIQAAEMETTMKRLLAEIEKT
FT                   KRRVNALEFKVIPELKEARDFIKLRLDEMEREGTFRLKKIKKS"
FT   gene            240401..240607
FT                   /locus_tag="Metev_0241"
FT   CDS_pept        240401..240607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0241"
FT                   /product="deoxyribonuclease/rho motif-related TRAM"
FT                   /note="PFAM: deoxyribonuclease/rho motif-related TRAM;
FT                   KEGG: mbu:Mbur_0304 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73171"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6E9"
FT                   /inference="protein motif:PFAM:PF01938"
FT                   /protein_id="ADI73171.1"
FT                   /translation="MFDRNESIAPVQSGEMYDVEIENIASKGDGIARVNGFVIFVPDTS
FT                   VGDEVTIKVTKVMQKFAFAELAA"
FT   gene            240739..242034
FT                   /locus_tag="Metev_0242"
FT   CDS_pept        240739..242034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0242"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: cno:NT01CX_0997 ATP-dependent RNA helicase;
FT                   PFAM: DEAD/DEAH box helicase domain protein; helicase
FT                   domain protein; SMART: DEAD-like helicase; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73172"
FT                   /db_xref="GOA:D7E6F0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6F0"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADI73172.1"
FT                   /translation="MEISTFNELNLSRDIEKAIEDLGYEEPTPIQARSIPYIMQGRDVI
FT                   GQAQTGTGKTAAFGIPALEKVDRNSKKVQTIVLCPTRELANQVADELNKLARYKKIKVL
FT                   PIYGGQPIERQIKALNKGAQIVIGTPGRILDHMERHTLSLDNVKMTVLDEADEMLDMGF
FT                   REDIELILSKLPDKRQTTLFSATMPGPIMKMTKKYQDNPELIKTVHKKLTVPQVEQTYF
FT                   EVKERSKPEALCRLTDFYNIKSSLVFCNTKKGVDNLVETLKTRGYLADGLHGDMKQKQR
FT                   DKVMSNFKNGEIETLVATDVAARGIDVENIEVVFNYDVPQDEESYVHRIGRTGRAGKQG
FT                   KAFTFAFGKEIYKIKDIQKYTQTKIHSGRIPSQSDVEDFRANMLSQKVKETIDSGHLGK
FT                   YVHWVENLLEEDYTSIDVAAGLVKVMLSDEFK"
FT   gene            complement(242155..242334)
FT                   /locus_tag="Metev_0243"
FT   CDS_pept        complement(242155..242334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0243"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: mbu:Mbur_0292 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73173"
FT                   /db_xref="GOA:D7E6F1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6F1"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADI73173.1"
FT                   /translation="MKNNLKVWIAKKDITQEYRAKEMGVTRQTINAIERDKYDPSIQLA
FT                   FKLARFEDFFFYEE"
FT   gene            242761..243813
FT                   /locus_tag="Metev_0244"
FT   CDS_pept        242761..243813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0244"
FT                   /product="Outer membrane lipoprotein-sorting protein-like
FT                   protein"
FT                   /note="KEGG: mac:MA4325 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73174"
FT                   /db_xref="InterPro:IPR025377"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6F2"
FT                   /inference="protein motif:COG:COG2834"
FT                   /protein_id="ADI73174.1"
FT                   /translation="MGSVLLITGCTEQPEPSEKEVVNNTIEKFESANDYSYLIILNSSE
FT                   YEEVNNVTIEMFYESSGKGKMIIEKSYEDLMYVVVNNGNNILTYDSEHDVVTRNPDPIS
FT                   NVFQENPLTYYSLMERIIENNKPVLQGTETINGNKTYILEFVFESSISDFPVDSTKLWI
FT                   NSDNWSPVKYELYKNEKIVISAAFKNFRFNTGISDKKFEYQPPKNAKVIEQQKSAPQTV
FT                   TLEEVKNSVDYELKKPSYVPDEFEFDHVQYTPSTSSVVIYYENDVMRSVLAVVQMPYES
FT                   SQKPEVAGQENTTIGTTKGNYFESTNSKHLKWSENNIEYTIMLNPPLERDNEIDKREMI
FT                   KIAESLEPVE"
FT   gene            243848..244075
FT                   /locus_tag="Metev_0245"
FT   CDS_pept        243848..244075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A0817 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73175"
FT                   /db_xref="GOA:D7E6F3"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6F3"
FT                   /inference="similar to AA sequence:KEGG:Mbar_A0817"
FT                   /protein_id="ADI73175.1"
FT                   /translation="MFGAMGFPFYMLIFILIGILATVFWIWMLIDCATKEPSQGNDKVV
FT                   WIIIIVFTQVIGALIYYFVRRPKRKAEFDE"
FT   gene            244095..244592
FT                   /locus_tag="Metev_0246"
FT   CDS_pept        244095..244592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73176"
FT                   /db_xref="GOA:D7E6F4"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6F4"
FT                   /inference="similar to AA sequence:KEGG:Mbur_1003"
FT                   /protein_id="ADI73176.1"
FT                   /translation="MAHNLLFQETQSFRNTWMFFIILGIAVFAWYNAIQQFVYVVEIGS
FT                   NPVSDLGLVILLIVFGVILPVLFYINKLETRVYEDGIYVRYFPFHLLYRKYSFGDIKNF
FT                   KLITYSALKDYGGWGIRYKFKDRTKAYNVSGNSGVLLEFKNGNKLLIGSQRPDELCNSI
FT                   KT"
FT   gene            244875..245267
FT                   /locus_tag="Metev_0247"
FT   CDS_pept        244875..245267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0247"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afu:AF0096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73177"
FT                   /db_xref="GOA:D7E6F5"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6F5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73177.1"
FT                   /translation="MGASIDNFDTEGVNSMGEDNKGIYILLLALVGTLAVLAPFMYDAY
FT                   VKTTDDYYVSAHLSDITPDDYTGISDEDLDKHPKLKEAFDKKDIVELTESEYSKMDEFL
FT                   AEGDDGITYIKYKDEYYGIWLQHIAR"
FT   gene            245365..245523
FT                   /locus_tag="Metev_0248"
FT   CDS_pept        245365..245523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_2244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73178"
FT                   /db_xref="GOA:D7E6F6"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6F6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73178.1"
FT                   /translation="MNEKKKNSINWLLTSVAILLVLSAVILSLWEKQSDGELDFTLKLD
FT                   KEQVKRV"
FT   sig_peptide     245365..245460
FT                   /locus_tag="Metev_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.566 at
FT                   residue 32"
FT   gene            245979..247238
FT                   /pseudo
FT                   /locus_tag="Metev_0249"
FT   gene            247649..248017
FT                   /pseudo
FT                   /locus_tag="Metev_0250"
FT   gene            complement(248092..248163)
FT                   /locus_tag="Metev_R0007"
FT                   /note="tRNA-Ala4"
FT   tRNA            complement(248092..248163)
FT                   /locus_tag="Metev_R0007"
FT                   /product="tRNA-Ala"
FT   gene            complement(248219..248488)
FT                   /locus_tag="Metev_0251"
FT   CDS_pept        complement(248219..248488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0251"
FT                   /product="translation elongation factor aEF-1 beta"
FT                   /note="KEGG: mba:Mbar_A3440 elongation factor 1-beta;
FT                   TIGRFAM: translation elongation factor aEF-1 beta; PFAM:
FT                   Translation elongation factor EF1B, beta and delta chains,
FT                   guanine nucleotide exchange"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73179"
FT                   /db_xref="GOA:D7E6F7"
FT                   /db_xref="InterPro:IPR004542"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR036219"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6F7"
FT                   /inference="protein motif:TFAM:TIGR00489"
FT                   /protein_id="ADI73179.1"
FT                   /translation="MGQVAAKIKVMPESVDTDLEELKKKIEEALPEETELHGTSEEPIA
FT                   FGLKALMLDISVSDKEGGTEEVEEAFMNVPGVDNVQVVGLGRGL"
FT   gene            complement(248517..248687)
FT                   /locus_tag="Metev_0252"
FT   CDS_pept        complement(248517..248687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0252"
FT                   /product="Protein of unknown function DUF1610"
FT                   /note="PFAM: Protein of unknown function DUF1610; KEGG:
FT                   mbu:Mbur_1318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73180"
FT                   /db_xref="InterPro:IPR011668"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6F8"
FT                   /inference="protein motif:PFAM:PF07754"
FT                   /protein_id="ADI73180.1"
FT                   /translation="MAKPEVKYCTTCGVHLAERGFVRFPCPSCSTELGRCINCRQQSNP
FT                   YTCPNCGFEGP"
FT   gene            complement(248802..249404)
FT                   /locus_tag="Metev_0253"
FT   CDS_pept        complement(248802..249404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0253"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   mbu:Mbur_1317 aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73181"
FT                   /db_xref="GOA:D7E6F9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011375"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6F9"
FT                   /inference="protein motif:PFAM:PF00696"
FT                   /protein_id="ADI73181.1"
FT                   /translation="MDNITEIVNHVIEYINTTSEEMKSVVIVPGGGIFADCVRDISKKY
FT                   HISNDASHWIAIASMEQYAYYIIDKTGLESIDTLSELYSGIMVLKPYQYLKNNDELPHG
FT                   WNVTSDTIGAWIAKKLDASFVKITDVDGIFKEQSLVSEINASDIDKSGLSCTDKYMPEF
FT                   LKDNRMNCYIVNGYHPERITAALRNKPVTGTYIKGNI"
FT   gene            complement(249455..250426)
FT                   /locus_tag="Metev_0254"
FT   CDS_pept        complement(249455..250426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0254"
FT                   /product="H4MPT-linked C1 transfer pathway protein"
FT                   /note="KEGG: mma:MM_2511 hypothetical protein; TIGRFAM:
FT                   H4MPT-linked C1 transfer pathway protein; PFAM:
FT                   Hydantoinase/oxoprolinase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73182"
FT                   /db_xref="GOA:D7E6G0"
FT                   /db_xref="InterPro:IPR002756"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6G0"
FT                   /inference="protein motif:TFAM:TIGR03123"
FT                   /protein_id="ADI73182.1"
FT                   /translation="MRNSTIGIDIGGANTKVSSNDGNFTELHYVPLWKNTVLPNILQEI
FT                   ARKIEPYRVAVVMTGELADCFDNKHNGIKFIMDSVDNAFNCEVNFVNVDGQFINDSNNI
FT                   NHLAAANWAASARIIGNEIGNCIFVDMGSTTTDIIPIIDGKHKAQYTDFKRLLHDELLY
FT                   TGLLRTNIATVVDKMDLNEGSCRPSSELFATTADAYLMLGDISSDMYTCEPADNAGVEK
FT                   NDALRRLARVVCSDLNEISNDDIEKIAQSVKEKQISLIREAISSVSKQYNLDKIVTAGI
FT                   GEYIIKNAVEQLGFECLSVTDIWGPNVSKVFPAYAAANIYDL"
FT   gene            complement(250423..251340)
FT                   /locus_tag="Metev_0255"
FT   CDS_pept        complement(250423..251340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0255"
FT                   /product="protein of unknown function DUF201"
FT                   /note="KEGG: mbu:Mbur_1315 hypothetical protein; manually
FT                   curated; PFAM: protein of unknown function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73183"
FT                   /db_xref="GOA:D7E6G1"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR024710"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6G1"
FT                   /inference="protein motif:PFAM:PF02655"
FT                   /protein_id="ADI73183.1"
FT                   /translation="MKILLAEYSVGAGLGGTYLLEGKCMLETIANSFTRVGHEVIYPSS
FT                   DTVISSGFPVESDSSNFEYIIEMLAKKCDAGLVIAPDELLPVLTRIIENNTINLGCPPE
FT                   AVDKCVDKIKCSEFLSKSNIPIPKTTREIKNGWWVIKPRYGSASENTFVTSIKGYKPEN
FT                   NYIATEYIDGEHVSVSLISGDNQLPLTVNKQLIDIPQINDSEIKYNGNLTPYSTSKKQK
FT                   LYNIAVSASRLLDCRGYVGIDFILNNDTPYIVDVNPRPTTSLVSICNVMKEEIAELLIK
FT                   NRFEKLPNSVEIHGQHSFLKEDLK"
FT   gene            251447..251872
FT                   /locus_tag="Metev_0256"
FT   CDS_pept        251447..251872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0256"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73184"
FT                   /db_xref="GOA:D7E6G2"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6G2"
FT                   /inference="similar to AA sequence:KEGG:Mbur_1314"
FT                   /protein_id="ADI73184.1"
FT                   /translation="MRDMNTEFISENPFLKALTISTTMAVFIIGIALGLKYMFSEGTIP
FT                   MPLWTLLLIFAIIFIIGSVFFEQRGADQMGSLIGGSIVAVSTTFASVSFFGGMVYAFSG
FT                   GIEALGVEPIISALAICMIASMLLIKLLSHKLQVQGF"
FT   gene            252063..252677
FT                   /locus_tag="Metev_0257"
FT   CDS_pept        252063..252677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0257"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: mbu:Mbur_1313 GrpE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73185"
FT                   /db_xref="GOA:D7E6G3"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6G3"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ADI73185.1"
FT                   /translation="MAEESDKYEAENSEVAENNAEGAESQNLNEESEMSSKDEEIERLN
FT                   QQIEDLNQKYRRLAAEYDNFRKRASREKEELRKYGIENVVIDLLEVLDNFERALESARN
FT                   TNDTNSIIEGIEMVYNQFYSTLNKYGLEKLICEGEEFDPYKHEALSHVEKSENPEDTVV
FT                   DVCKPGYALNSKVIRPAMVTVSKKSESETEDENEDNNKDQE"
FT   gene            252750..254600
FT                   /locus_tag="Metev_0258"
FT   CDS_pept        252750..254600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0258"
FT                   /product="chaperone protein DnaK"
FT                   /note="KEGG: mba:Mbar_A3433 molecular chaperone DnaK;
FT                   TIGRFAM: chaperone protein DnaK; PFAM: Heat shock protein
FT                   70"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73186"
FT                   /db_xref="GOA:D7E6G4"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6G4"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ADI73186.1"
FT                   /translation="MGKIIGIDLGTTNSCMAIMEGGEPNVIPNAEGSRITPSVVGFSKK
FT                   GELLVGQVAKRQLIANPDNTVYSIKRHMGEQDYKVTLQDKEYTPQEISAKILRKMKDDT
FT                   EDYLGEELQDAVITVPAYFNDAQRQATKDAGRIAGFNVKRIINEPTAAALAYGIDKEEE
FT                   QKILVYDLGGGTFDVSILDIGDGVYEVVSTTGDSHLGGDDFDQRLVNHLVKKFKEEEGL
FT                   DLSQDRSALQRLTDAAEKAKIELSSVTTTNVNLPFITADANGQPKHLDIDVSRSQFQQL
FT                   TEDLVEETVDLMQQALKDANLTANDINKVLLVGGSTRMPAVTDAINKVVGKEPYKNINP
FT                   DEAVAVGAAIQGGVLSGETEELLLLDVTPLTLGIETEGGVMTPLIERNTTIPTKKTQVF
FT                   STAEDNQTAVDVHVLQGERPMAKDNQSLGRFRLEGIPAAPRGVPQIEVTFDIDANGILN
FT                   VSAKDLGTNKEQSITIEKPGALSEDEINQMVKEAEEHAEEDKKRKEEVETRNRADTLVN
FT                   SADKTLEEAKDVITEDEKSKIENAKSELQEALKGDDIEDIKSKTETLQNAIYEVSQKMY
FT                   QQAQEQAQQQAETEGAESAGGSSEEDVVDADYEDSDEKKQ"
FT   gene            254679..255812
FT                   /locus_tag="Metev_0259"
FT   CDS_pept        254679..255812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0259"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: chaperone
FT                   DnaJ domain protein; heat shock protein DnaJ domain
FT                   protein; DnaJ central domain protein; KEGG: mbu:Mbur_1311
FT                   chaperone DnaJ; SMART: heat shock protein DnaJ domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73187"
FT                   /db_xref="GOA:D7E6G5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6G5"
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /protein_id="ADI73187.1"
FT                   /translation="MTTTRDYYEILGVSKDASQDEIKKAYRKLAMKYHPDKSDDPDAEE
FT                   KFKEISEAYGVLSDPDKRAQYDKFGHSGIDSRYTEEDIFGSADFGDFGFGDIFDMFFGG
FT                   GGRRRSGPSRGSDLRYDLSITLEDAAFGLNTEIDVPRAEKCGECEGTGAKDGKVKNCPT
FT                   CHGRGQITQTRSTPLGRFMTTSICSTCYGQGQVAETPCPSCSGTGKVKRTAKVPVKVPP
FT                   GSYDGLRLKVSGEGEQGSPGAPPGDLYIVLHVKPHDTFERVGDDIACEIPITITQAALG
FT                   TTITVPTLYGNVNMKVPSETQTNTIFRLKDKGMPHLNGRGHGDQHVKVIVKTPTNLTSE
FT                   QKRILQELDETLAGENESKARKGDKSIFDKVKGAFEV"
FT   gene            255974..257308
FT                   /locus_tag="Metev_0260"
FT   CDS_pept        255974..257308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0260"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: mbu:Mbur_1310 potassium transporter peripheral
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73188"
FT                   /db_xref="GOA:D7E6G6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6G6"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADI73188.1"
FT                   /translation="MKIVIIGAGEVGYHIANSLYENNDVIIIDRDDEACERADELDLQV
FT                   IQGNGANVRLLTQVLTNADLLVAVTGSDEVNIVSCMAAKLVSKSKKPLKTMARVSNPDY
FT                   IDKPVARRTQIGIDTMICPELAMASEVAEVLSIPSAIDAEFFADGKVEMIEFVAKDNTE
FT                   IVGKQVKNLQLSESCIISALFRGGEVIIPHGDDAINSGDHVVIIGKTDEMKSIRGIFGE
FT                   IGQNVNKVMIIGGGKVGFHLAQIAQKSGIKIKIIEHDKKRCEYIADVLPEVLVINGDGT
FT                   DVNLLKEEEVSNMDTVFSVMDSDEKNLLSALLAKQFGVGKVIARVERSGYSPLFEMVGV
FT                   DLAASPKQATINEVMKLSMGTGIEALTTIEGERAEIIEYIAYKNSKITGKPLKDIKFPS
FT                   GAIVSMVIHGNEPFIPRGDHVIEDGDRVLIFSLPSAVTDVEKLFK"
FT   gene            257328..258767
FT                   /locus_tag="Metev_0261"
FT   CDS_pept        257328..258767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0261"
FT                   /product="cation transporter"
FT                   /note="PFAM: cation transporter; KEGG: mbu:Mbur_1309 K+
FT                   transporter trk"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73189"
FT                   /db_xref="GOA:D7E6G7"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6G7"
FT                   /inference="protein motif:PFAM:PF02386"
FT                   /protein_id="ADI73189.1"
FT                   /translation="MNVHIIFNIIGRLLLLLGFIMIIPLFVALYYGEPIEPFTVAITMT
FT                   ILVGTVFLFLFRSTEDEWHHREGFAIVALGWLFAAIFGSIPYMLDGVTPLNAFFESMSG
FT                   FTTTGSTVFVNIEAHPKGILFWRNMTEWLGGMGIIVLFIAILPKLGVAGRQMFRAEVPG
FT                   PQEDKLKPRIRETSKILWMVYLVVSIAEAIALKLAGLSVYDAVTHTFTTVSCGGFSPYA
FT                   RSIEAFGSPLVETIIMVFIFISGANFALHYKTLYASRKSLIKDDEFKFYSFVIFSAIAL
FT                   LTLILWRDINIPIIESLRYAAFQVLTIITTTGYATTDFIAWPHSAQMILLILMFAGGCA
FT                   GSTAGGPKMVRWLLMLKYSRREIFKVIHRRAVTRIKFNKKSVPEDIMQSVISFIAIYFL
FT                   IFAASSVLLGLLGMDLVSSITASIATLGNIGPGLGAVGPMDNFDVVPALGKVALIGNMW
FT                   MGRLEIFTVFVMLTPEYWKKW"
FT   gene            complement(258776..260008)
FT                   /locus_tag="Metev_0262"
FT   CDS_pept        complement(258776..260008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0262"
FT                   /product="geranylgeranyl reductase"
FT                   /note="KEGG: mbu:Mbur_1308 geranylgeranyl reductase;
FT                   TIGRFAM: geranylgeranyl reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73190"
FT                   /db_xref="GOA:D7E6G8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR023590"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6G8"
FT                   /inference="protein motif:TFAM:TIGR02032"
FT                   /protein_id="ADI73190.1"
FT                   /translation="MKNQYDVIVVGAGPGGSIAAKTAAKNGLDVLLIEKRQEIGDPVRC
FT                   AEGIGKEGLKHHIEPDPKWICADVKGSRIYSPNETVVEMSEELSGGEVGYVLERKIFDR
FT                   ELVNQAASYGVDVMVKTRATGLISENGYVRGIKAIYLGEEYNFYSNIVIGADGVESKIG
FT                   RWGGIDTSLKPSDIEVCAQYLIGNIDTDLNFCHFYLGNEIAPSGYIWVFPKGEKLANVG
FT                   IGILGSRSGKYRAIDLLSDFVKQKFPEGKILELDVGGVPVSGTIDQTIADGLMLVGDAA
FT                   RQSDPITGGGLVNAMDAGEIAGNVAYEAISANDVSTKMLQRYESRWRKTIGQDIDNDLI
FT                   VKNKFVEFTDEQLNTFAHSLQNVNFNTMNLKELLYVLFKANKRLLWDLRVLFKEYTKYN
FT                   KKSQWESEIKS"
FT   gene            complement(260005..260178)
FT                   /locus_tag="Metev_0263"
FT   CDS_pept        complement(260005..260178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0263"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mbu:Mbur_1307 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73191"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6G9"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADI73191.1"
FT                   /translation="MSINVNRYKCGYCGACVGVCPEGALELVETFIEADNKCTGCGLCA
FT                   KICPVGAIEVVR"
FT   gene            complement(260386..261009)
FT                   /locus_tag="Metev_0264"
FT   CDS_pept        complement(260386..261009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0264"
FT                   /product="2-phospho-L-lactate guanylyltransferase CofC"
FT                   /note="KEGG: mbu:Mbur_1305 hypothetical protein; TIGRFAM:
FT                   2-phospho-L-lactate guanylyltransferase CofC; PFAM: protein
FT                   of unknown function DUF121"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73192"
FT                   /db_xref="GOA:D7E6H0"
FT                   /db_xref="InterPro:IPR002835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6H0"
FT                   /inference="protein motif:TFAM:TIGR03552"
FT                   /protein_id="ADI73192.1"
FT                   /translation="MRAVIPYKKTKAKSRLSSVLTLKEREEFVESMLKDVVNTLSDAQI
FT                   KNIDVLTTTSNSIPDNLDVKVITSEHGLNEAINSYLKNIQEPVLIIMADLPLVKSNHIT
FT                   DIINTKKDVVIVPGKGGGTNILYLKKPEKFTVKYYGSSFLTHCNIAKKNLNAVEIYDSF
FT                   LASTDIDEPHDLVEILLHGQGLSRKYIEKKFEIDDSRGRLKLKC"
FT   gene            complement(261038..262129)
FT                   /locus_tag="Metev_0265"
FT   CDS_pept        complement(261038..262129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0265"
FT                   /product="7,8-didemethyl-8-hydroxy-5-deazariboflavin
FT                   synthase, CofH subunit"
FT                   /note="TIGRFAM: 7,8-didemethyl-8-hydroxy-5-deazariboflavin
FT                   synthase, CofH subunit; PFAM: Radical SAM domain protein;
FT                   KEGG: mac:MA1490 FO synthase subunit 2; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73193"
FT                   /db_xref="GOA:D7E6H1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019940"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6H1"
FT                   /inference="protein motif:TFAM:TIGR03551"
FT                   /protein_id="ADI73193.1"
FT                   /translation="MVIEYSCIPNDIVHRARKGECTREDGIYLFNVEPFELFSLADRLR
FT                   YESVGNDVTYIINRNINFTNQCEGTCGFCAFRNSSESGYIYSINEITEKVKDETGLYLT
FT                   EICIQGGLLQDVDIDFYKNILESVKKEAPDIHIHAFSPMEIYHLSKINNLSVKKTLQEL
FT                   KNSGLDSMPGTAAEILSDRVREIICPDKLTTDEWINVVKLAHKTGIPTTSTMMYGHIET
FT                   LEERIDHILTIRKIQEETNGITEFVPLPFMLSNNPIGEQIKTEGRFGTTGIEDLKIHAI
FT                   ARILLHGYVNNIQASWVKLGKKLAQVALYHGANDLGGTLIEESISKSAGSKEGEFVSPD
FT                   EFRWLIESAGKNPKQRDTLYQIV"
FT   gene            complement(262181..263173)
FT                   /locus_tag="Metev_0266"
FT   CDS_pept        complement(262181..263173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0266"
FT                   /product="7,8-didemethyl-8-hydroxy-5-deazariboflavin
FT                   synthase, CofG subunit"
FT                   /note="TIGRFAM: 7,8-didemethyl-8-hydroxy-5-deazariboflavin
FT                   synthase, CofG subunit; PFAM: Radical SAM domain protein;
FT                   KEGG: mbu:Mbur_1302 FO synthase subunit 1; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73194"
FT                   /db_xref="GOA:D7E6H2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019939"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6H2"
FT                   /inference="protein motif:TFAM:TIGR03550"
FT                   /protein_id="ADI73194.1"
FT                   /translation="MPIPEFVTYCRNVFIPVTNICRNRCGYCGFRRDPDDPQAQLMSVD
FT                   EIIPILKKGYESGCTEALFTFGESAEEVPEYRYWLYEMGYSSTVEYVMELCETAIDNGL
FT                   LPHTNAGVLDKKQLTMLKPLNASMGLMLETISKLDAHENSPGKIPEKRIETIKLAGQLK
FT                   IPFTTGILVGIGETANNRIESLNEIKKLHEKYGHIQEVIIQNFTPKPETPMSNYPSPSL
FT                   STISETVSYAREILPDDVTIQVPPNLTDPYLLIKNGASDLGGISPTTIDWINPESEWPD
FT                   IVELENIIPDIPLKERLPIHPKYIQKGWYSDRLNKIIDNLADENGYRKT"
FT   gene            complement(263222..264502)
FT                   /locus_tag="Metev_0267"
FT   CDS_pept        complement(263222..264502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0267"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG: mac:MA1492
FT                   phytoene dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73195"
FT                   /db_xref="GOA:D7E6H3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6H3"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADI73195.1"
FT                   /translation="MKTIVVGSGLGGLLSAAYLAKSGHDVEVFEALPFTGGRFTNIDYK
FT                   GFKLSTGALHMVPHGDSGPLSQMLKKLNADVNIVTSNPSSVIRMPANDNDTDYKNGFRD
FT                   MAFHDFKVPFSLINRIKIAFLAFTTKYFPPKKGTFDDWIKHHINEKWATRIANSFCGWS
FT                   ISLKSSDVSAKEVFEIISNLYRYSGPGVPTGGCKGITNALVEIIQENGGKIYTGKEVTE
FT                   IITSNNHAKGVVADGDKYYSDLIISDIGHIETNRLCKNVTETEEYVQYKNQLQNIKSSA
FT                   GIKISLACDEPLIGHGGVVLTPYSKRIDGMNEVTNVDKTLAPEGKHLVMTHQCLRWDRL
FT                   DDIEEEIELGLQDIRDIFLNKDYEVLMVQSYHDGWPVNRSASSQDLSNKTPISNLYVVG
FT                   DGAKGEGGIEIEGITLGVLNTMDMVLS"
FT   gene            complement(264502..264660)
FT                   /locus_tag="Metev_0268"
FT   CDS_pept        complement(264502..264660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0268"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: mba:Mbar_A3413 putative ferredoxin; manually
FT                   curated; PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73196"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6H4"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADI73196.1"
FT                   /translation="MKINDKCVGCGQCAAICKNDAIQVWGKAKITQNCTNCKICSYYCP
FT                   LNAIEVT"
FT   gene            264858..265277
FT                   /locus_tag="Metev_0269"
FT   CDS_pept        264858..265277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0269"
FT                   /product="Protein of unknown function DUF22"
FT                   /note="PFAM: Protein of unknown function DUF22; KEGG:
FT                   mbu:Mbur_1299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73197"
FT                   /db_xref="InterPro:IPR002572"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6H5"
FT                   /inference="protein motif:PFAM:PF01629"
FT                   /protein_id="ADI73197.1"
FT                   /translation="MSTQVIQVVSRKNGELNSTKVKASSYEFTMATRAKWEMIIANEDM
FT                   SIRSGEFKKIDVKDINVEPDMVAMPCIFSQHAVASVLKIGAKEGNVPVDKERVIDSAYV
FT                   IGQETGHIREGDLLGVLNLFPIMFTREATKPEKVD"
FT   gene            265292..265795
FT                   /locus_tag="Metev_0270"
FT   CDS_pept        265292..265795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73198"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6H6"
FT                   /inference="similar to AA sequence:KEGG:Mbur_1298"
FT                   /protein_id="ADI73198.1"
FT                   /translation="MENCIICGQEQDSKQYEGYNICTACVDILEDVMTEYFLKTIYNNT
FT                   PKAYDNFLNYLYRTTRYISDYKRLTNNSVDYTKKIDARAKDALEYTTHPSKQRYFEHMH
FT                   VVLEWLKNNPEFYHYYFKEYYVCPNCCASLFEKYTTNSIGEWFVITCSNCEALIKKFYS
FT                   PKLV"
FT   gene            266062..266457
FT                   /locus_tag="Metev_0271"
FT   CDS_pept        266062..266457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0271"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3; KEGG: mba:Mbar_A3412 F420H2 dehydrogenase subunit
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73199"
FT                   /db_xref="GOA:D7E6H7"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6H7"
FT                   /inference="protein motif:PFAM:PF00507"
FT                   /protein_id="ADI73199.1"
FT                   /translation="MPEIIDTSSIINSYVPVAIFLIVGVVMPPITMLIVKLLSPRSKSK
FT                   QKFTTYESGSDPTGDARIQFNVEYYIYAIAFVLFDVEILFLYPWATVYRGHGITSIATT
FT                   AILAFIVIMVIGFIYEWKKGALQWSTK"
FT   gene            266442..267011
FT                   /locus_tag="Metev_0272"
FT   CDS_pept        266442..267011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0272"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   KEGG: mac:MA1496 F(420)H(2) dehydrogenase, subunit FpoB;
FT                   PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73200"
FT                   /db_xref="GOA:D7E6H8"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6H8"
FT                   /inference="protein motif:TFAM:TIGR01957"
FT                   /protein_id="ADI73200.1"
FT                   /translation="MVNEMNTNTNNDAGKPSGELEIPGVITTNSNAISEFLKKTKVQDI
FT                   INWGRKNSLWFMTQPMGCCGVEMIATGCAHYDTDRFGIIPRNSPRQADVMIISGYVTKK
FT                   YFPALKKVYEQMPSPKWVIAMGDCAISGGPFYESYSTVQNIDEIFPIDVYIPGCPPRPE
FT                   ALIQGFVELQKKITAKKDNAAMYGEA"
FT   gene            267015..267491
FT                   /locus_tag="Metev_0273"
FT   CDS_pept        267015..267491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0273"
FT                   /product="NADH (or F420H2) dehydrogenase, subunit C"
FT                   /note="KEGG: mma:MM_2489 NADH dehydrogenase subunit C;
FT                   TIGRFAM: NADH (or F420H2) dehydrogenase, subunit C; PFAM:
FT                   NADH dehydrogenase (ubiquinone) 30 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73201"
FT                   /db_xref="GOA:D7E6H9"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6H9"
FT                   /inference="protein motif:TFAM:TIGR01961"
FT                   /protein_id="ADI73201.1"
FT                   /translation="MDAKTIVDSLSRTFPEAISDATVKSDIRVTAYVDKDHVKEVCEYL
FT                   KNDLDFNHLCCESGVDYILRNEFEVVYHIASYEHPVILALKARLNRDDPVIESIVDVYW
FT                   NANWYERETYELFGIMFKYHPNLKPLVLPEDLLGDWPLRKDYEGFPQKTAKNLV"
FT   gene            267500..268633
FT                   /locus_tag="Metev_0274"
FT   CDS_pept        267500..268633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0274"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: mac:MA1498 F(420)H(2) dehydrogenase, subunit
FT                   FpoD; PFAM: NADH-ubiquinone oxidoreductase chain 49kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73202"
FT                   /db_xref="GOA:D7E6I0"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6I0"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ADI73202.1"
FT                   /translation="MDELEELESTEMLIHIGPQHPAQPGPFRLNLKVKGETVTDAQVEL
FT                   GFIHKGIEKILESKTYLQGIPIVDRMCYLGALSNEEAFCGCVEQLAGIEVPERAQYIRV
FT                   ITEELSRIQSHLLGFGEFSEFIGYQSMFMYTIKERENVLSLLDSITGARITHTFLKFGG
FT                   VREDLPPGFKDKFTRTMEQLKSTVLDEYERLLKSDTIYKDRTVGVGVLSPEVAKEVGVA
FT                   GPVLRATGVPFDIRKDEPYLVYDDLDFKVCTQKEGDSYARIMVRLNEIRESIYIIEQAL
FT                   DQIPDGPIFPENTPYGKRTPTMRVPEGEVFNRVENPRGEMGIYMVSDGSDKPYRVKVRG
FT                   PAYPTLQALPPVLRGVYVADVNTIAGSMDGCTSEVDR"
FT   gene            268639..269700
FT                   /locus_tag="Metev_0275"
FT   CDS_pept        268639..269700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0275"
FT                   /product="respiratory-chain NADH dehydrogenase subunit 1"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase subunit
FT                   1; KEGG: mac:MA1499 F(420)H(2) dehydrogenase, subunit FpoH"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73203"
FT                   /db_xref="GOA:D7E6I1"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6I1"
FT                   /inference="protein motif:PFAM:PF00146"
FT                   /protein_id="ADI73203.1"
FT                   /translation="MVMDIIAGSYDLLLEYLTNPWIRGYLGLSLIGFIFVSAMAAVWLE
FT                   RKISADVQFRIGPCRVGPIGIFQLIADAIKLFTKEDIVPRKADSIMFRSAPIFLMVSVF
FT                   LMLVAIPIGAIVINGVAYPLVVTDMDISILYVEAVSSISIIGVFMVAYSSNNKYALLGA
FT                   FRNFARMVGYEIPFGISIIAVAITTGSLNIIEIVENQTIWNVILQPIGFFVFFVALMGD
FT                   LGRLPFDQTEAEQEVVAGWITEYSGMRFGLGFFAEYIHMVLGSFLVVLLFLGGWNLPGL
FT                   GLLTSIPVIGFIMPTLVFLGKSAIVLAFIILLRWAVPRFRIDQVVDLGWKRIIPLSIVN
FT                   LIWAIALGLFLGA"
FT   gene            269707..270138
FT                   /locus_tag="Metev_0276"
FT   CDS_pept        269707..270138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0276"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mbu:Mbur_1292 F420H2 dehydrogenase subunit
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73204"
FT                   /db_xref="GOA:D7E6I2"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6I2"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADI73204.1"
FT                   /translation="MVLENIVKAIKSIYQPPVTIMCPEEKSRGIPERFKGLQVLDKSKC
FT                   IGCGICANTCPNNAIKIVRSRVSKTSDKQRWFPEIDIGHCMFCGLCIDQCPQDALSSSK
FT                   IYTSGVVKWNHEDLLFTPDELAREVDIGEDEYNEEELEK"
FT   gene            270158..270475
FT                   /locus_tag="Metev_0277"
FT   CDS_pept        270158..270475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0277"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6; KEGG: mma:MM_2485 NADH dehydrogenase subunit J"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73205"
FT                   /db_xref="GOA:D7E6I3"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6I3"
FT                   /inference="protein motif:PFAM:PF00499"
FT                   /protein_id="ADI73205.1"
FT                   /translation="MVAILDYLTSFTFDDLTTIARFGAFALLSLIIILFSLLTIVSRDV
FT                   VRAAISLIVSLFSVAGLYILLNAQFLGVVQVLVYVGAVGVLILFGVMLTKTESGRGPYV
FT                   R"
FT   gene            270465..270725
FT                   /locus_tag="Metev_0278"
FT   CDS_pept        270465..270725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0278"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6; KEGG: mba:Mbar_A3405 F420H2 dehydrogenase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73206"
FT                   /db_xref="GOA:D7E6I4"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6I4"
FT                   /inference="protein motif:PFAM:PF00499"
FT                   /protein_id="ADI73206.1"
FT                   /translation="MLGKIINVIVALLVVLLFLGMIGVSVIGTGWDTVEELPQTPEDQS
FT                   NIERIGVSVFTKYVVPFEIMAIVLLSALIGAFYMGRGADSK"
FT   sig_peptide     270465..270551
FT                   /locus_tag="Metev_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.481 at
FT                   residue 29"
FT   gene            270722..271036
FT                   /locus_tag="Metev_0279"
FT   CDS_pept        270722..271036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0279"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   mbu:Mbur_1290 F420H2 dehydrogenase subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73207"
FT                   /db_xref="GOA:D7E6I5"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6I5"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ADI73207.1"
FT                   /translation="MILPAIPLPFYLILSAVVFSIGLLGVMTKQNGVRLLMCVELMLNS
FT                   ANINLVAFSSYNNDITGQVFVLFTIALAAAEAAIGFGIFMAVYRMKNRIDLNDFNILRW
FT                   "
FT   gene            271041..273041
FT                   /locus_tag="Metev_0280"
FT   CDS_pept        271041..273041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0280"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /note="KEGG: mbu:Mbur_1289 F420H2 dehydrogenase subunit L;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain L; PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   NADH-Ubiquinone oxidoreductase (complex I) chain 5/L domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73208"
FT                   /db_xref="GOA:D7E6I6"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6I6"
FT                   /inference="protein motif:TFAM:TIGR01974"
FT                   /protein_id="ADI73208.1"
FT                   /translation="MPIGDFAFLIPLLPALAFVITFFLGKKMYAGGALVPIGAIALSFV
FT                   ISLLITLNLLQNPDQIVAQSVDWFGAFNLGILIDPLAAVMLTMVSFVSLLIHIYSVGYM
FT                   EHDKSKPRYFAETALFTCSMLGLILSDNILQLFVFWELVGLSSYLLIGFWYGKPSAASA
FT                   AKKAFLTTRIGDVMFLAGIIILFSDLFAIFNGFPDNAYMLQFTEMFNHIPEIAGMSAQI
FT                   FGFEVSHLTLITLLFFGGAVGKSGQFPLHVWLPDAMEGPTTVSALIHAATMVTAGVYLV
FT                   ARTFPMFISAPDTLIVIAYLGGFTALFAATMAIVMNDLKRVLAYSTISQLGYMMLGLGM
FT                   GAVIGMEAVGLSIFHLINHAFFKALLFLSAGSVIHAVGTHDMRELGGVGKVMPITAITM
FT                   LIAGLSLAGFGIPGTIIGTSGFLSKDAIIEAAFLFGEHSHNWLPYIFAIVGAFLTSAYI
FT                   FRLLFMTFTGKPRTDYDGHESPSSMTVPMVILAAFSLFFGMFTTGTFSRFLGDTFNFIN
FT                   MNLNELAASLGNYELLHEAGHEPLIILWLPLILAVAGLLITYLIYYLRVLDFSVSRNNP
FT                   IYKLVYNRYYQNEILTEGFAIKVVYEGVSLALYHIDRGINWIVNAIGSALTEAGHMFRH
FT                   VQTGVVQNYATAIIAGVSLLAILVKIIMEVI"
FT   gene            273041..274528
FT                   /locus_tag="Metev_0281"
FT   CDS_pept        273041..274528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0281"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /note="KEGG: mbu:Mbur_1288 F420H2 dehydrogenase subunit M;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain M; PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73209"
FT                   /db_xref="GOA:D7E6I7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6I7"
FT                   /inference="protein motif:TFAM:TIGR01972"
FT                   /protein_id="ADI73209.1"
FT                   /translation="MLPVLSMLILIPLIFAVITFFTKTKEQARTTALTGSVISLVLALY
FT                   MYMNFDSSIASLQFVEISKWVPSLGITYSVGVDGVSMPLILLNAIVIPFLIIYSWNEEK
FT                   SYPNRFFGLILAMQGAVIGVFAALDFFLFYVFWELTLIPLYFMVSQWGGPNKEFAAIKF
FT                   FIYTHVASLVMLLGIFALYFTAWSQTGSPTFNIQELLTQFQSFEAPLVKDAIFIALLFG
FT                   FIVKIPTFPFHSWLPDAYTESPIAGNVLFILLKIGGYGLFRIMLPILPFTGTPNLMISI
FT                   MALLGTASIIYGAFVALAQRDFKRMIAFASVSHMGFVVLGSAGLVSLSVSGAMFQQFSH
FT                   GLILSVMFMSVGVIQTNAGTRIINQLGGLSKKMPKLALIMVVVFMASLGLPGLTGFVAE
FT                   FLVLTSSYVNLPGYVLAVMIGIVITAAYHLWAMQRSMFGLYNEKLGDVKDLTNYQSLSM
FT                   AVISLLVIYFGLNPNPVLDMMITNSEHIVSLLSVAGV"
FT   gene            274531..275979
FT                   /locus_tag="Metev_0282"
FT   CDS_pept        274531..275979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0282"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /note="KEGG: mbu:Mbur_1287 F420H2 dehydrogenase subunit N;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain N; PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73210"
FT                   /db_xref="GOA:D7E6I8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6I8"
FT                   /inference="protein motif:TFAM:TIGR01770"
FT                   /protein_id="ADI73210.1"
FT                   /translation="MNGITLFAPELTVVATALVVLMIGVFLNTESKKVLGYLASAGLAA
FT                   SLILTLMNLDANAVMYSGTLTVDALSQFFKIVFLIVALLVSVASIKYTENNEHVEEFFT
FT                   LVLLAVVGMMMVASSNDLLVLFVSFELASISTYALAGFERRNLKSLESAMKYFIIGALS
FT                   SALMLFGISFVYGLAGTTNIPEIAQNSAMLVSSPLGIVSIVLLVAGFGFKIALVPFHMW
FT                   APDTYEGSPSVVSSLLAAGSKKMGFVAAFKVFMIALVALKTEWTMAFAILSVITMTLGN
FT                   VIALSQNSVKRMLAYSSVAQAGYISMAFVVMSPMAVTGGLFYILSHGFMKAGAFLVTAV
FT                   VGYMILSENREAENVDHLENFKGLAKRMPISAFSMMIFVFALAGIPLTAGYMSKFVLFS
FT                   STIEAGLVWLAVIAILNSAISLYYYARVVKYMYFYPAEGERVSEPLPYALTLVAAVVGV
FT                   LILGFWPEPFIQWAMEAAKVLIAT"
FT   gene            275993..276346
FT                   /locus_tag="Metev_0283"
FT   CDS_pept        275993..276346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0283"
FT                   /product="F420H2 dehydrogenase, subunit FpoO"
FT                   /note="PFAM: F420H2 dehydrogenase, subunit FpoO; KEGG:
FT                   mac:MA1507 F(420)H(2) dehydrogenase, subunit FpoO"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73211"
FT                   /db_xref="InterPro:IPR018288"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6I9"
FT                   /inference="protein motif:PFAM:PF10621"
FT                   /protein_id="ADI73211.1"
FT                   /translation="MADCELCGESLPTLCPVRVYAPRLIITYPEGVCKGLCPTCVKAAE
FT                   DTYSKLDQSILSVSSGKCNLCGKPTRLYPVEVQIPSFKQGVEKVDMNLCRTCLEACHET
FT                   HEKYHEKFEEAYH"
FT   gene            complement(276402..277349)
FT                   /locus_tag="Metev_0284"
FT   CDS_pept        complement(276402..277349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0284"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   mac:MA3285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73212"
FT                   /db_xref="GOA:D7E6J0"
FT                   /db_xref="InterPro:IPR038880"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6J0"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADI73212.1"
FT                   /translation="MNYYLDLFVRVLDFAVPVLVIIFIGIFGSGVLIEKGLMQKLSRFA
FT                   RPIFKYTYLPETCASSFLVALGSSVAANTMIVKRQDDGCLNRREVLLCSLMNSTPAYIR
FT                   SIFTYQIPIMLPALGAVVGSFYAFVFIITAIIKIIVVVVASRLFLVENPCKVSDTPETE
FT                   KVSLKTALLRSLKREKKLFLKIAVIYLVMTTLVFALRDQGAFEVFSVLPLAEIFGLPSE
FT                   SIVPLTSYIASPILGASILGPMIHSGSITYLQAMIVLMVGSMFMLPLLGIKNMAPRYVS
FT                   IFGFRLGLGIVTLSMSISVMIRFILLLILLAIAG"
FT   gene            complement(277430..278542)
FT                   /locus_tag="Metev_0285"
FT   CDS_pept        complement(277430..278542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0285"
FT                   /product="protein of unknown function DUF100"
FT                   /note="PFAM: protein of unknown function DUF100; KEGG:
FT                   afu:AF1442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73213"
FT                   /db_xref="GOA:D7E6J1"
FT                   /db_xref="InterPro:IPR002803"
FT                   /db_xref="InterPro:IPR036076"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6J1"
FT                   /inference="protein motif:PFAM:PF01950"
FT                   /protein_id="ADI73213.1"
FT                   /translation="METTFSAIKADVGSVAGHHVVPEELEESAISVLEEAKGKDIFDYF
FT                   VTHCGDDLELIITHDKGEDSEEVYEIAWNAFLKATEKAKELGLYGAGQDLLSDAFSGNI
FT                   KGMGPGIAEMEFKERKSNPVFTFMMDKTEPGAFNLPMYKIFADPFNTAGLVLDPNMHSG
FT                   FVFEVWDIKESKKINFYCPNDLYDMLALIGAKSRYVIKRVYPKEDNPKATSQEPAAVIS
FT                   TEKLSHIAGEYVGKDDPVAVVRGQSGLPAAGEILEPFTHPELVSGWMKGSHNGPLMPVP
FT                   VEDATPTRFDGPPRAICLGFQVKDGMLIGPVDSFADPAFDKTREKAHQVSDYMRAHGPF
FT                   EPHRLPEEEMEYTTLPDVMEKINHRFEDMD"
FT   gene            278717..278899
FT                   /locus_tag="Metev_0286"
FT   CDS_pept        278717..278899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0286"
FT                   /product="protein of unknown function DUF343"
FT                   /note="KEGG: mbu:Mbur_1284 hypothetical protein; manually
FT                   curated; PFAM: protein of unknown function DUF343"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73214"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6J2"
FT                   /inference="protein motif:PFAM:PF03966"
FT                   /protein_id="ADI73214.1"
FT                   /translation="MKKELMDILACPICKGDLVLNIIEEDEVEIKSGTLYCSQCREYYP
FT                   VEDGIPNLLPPDIRE"
FT   gene            278927..279580
FT                   /locus_tag="Metev_0287"
FT   CDS_pept        278927..279580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73215"
FT                   /db_xref="GOA:D7E6J3"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6J3"
FT                   /inference="similar to AA sequence:KEGG:Mbur_1283"
FT                   /protein_id="ADI73215.1"
FT                   /translation="MLLQQVHINRLEINSIEFEDDIVEIPLSPGGEHSFEIAVINYGSP
FT                   TNVYFSTSDNLKDHITFLEDNPYVRHEEYVPVISHLPIGGEEFVKGEIYVTVGYGSRTS
FT                   GFSIKIGSEKSANISVEVDVDDHITVDNKFEMNRNSNKGDSGSTAYSIKSSLDVSPRIA
FT                   LLIAGVLIASFMIYFLSTQATGIEYEMGFYPAVILAILFTALIMYLFLKLPINK"
FT   gene            279601..281190
FT                   /locus_tag="Metev_0288"
FT   CDS_pept        279601..281190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0288"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="TIGRFAM: CTP synthase; KEGG: mbu:Mbur_1282 CTP
FT                   synthetase; PFAM: CTP synthase-like; glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73216"
FT                   /db_xref="GOA:D7E6J4"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6J4"
FT                   /inference="protein motif:TFAM:TIGR00337"
FT                   /protein_id="ADI73216.1"
FT                   /translation="MKYIVVTGGVMSGLGKGITTASIGRNLKNKGYRVTAIKIDPYINI
FT                   DAGTMSPYQHGEVYVLKDGGEVDLDLGNYERFLDTELTHDHNITTGKFYNSVISKERRG
FT                   EYLGKTVQIIPHVTNEIKDWIRDVASDSGADICLIEVGGTIGDIESMPFLEALRQMHRE
FT                   EPEENTIFVHVTLVPLDAQGEQKTKPTQHSTRDMRELGLTPNVVVARCEEPLLESTISK
FT                   ISLFSDVPEEAVISANDVEDIYEVPLMLEKEGLTNYLMKMLDLKKITEDTSWNEMVSKM
FT                   KSITGEVKFAIIGKYTHLGDSYISIREALKHAAIESGCNFKSTWIDAELINRDSDALEN
FT                   LSEYDGILVPGGFGERGIEGKIKAIQYAREHDIPYLGLCLGMQLSVIEFARNVAGLENA
FT                   NSTEFDPSTPHPVIDILPEQKDLVNMGATMRLGTYKACLKQGTLAQQIYSADEIVERHR
FT                   HRYEVNPEYIEKIEKHGMIFSAMNNGKRMEIAEIPEKKFFFTSQFHPEFTSRPGHPSPP
FT                   FKAFIEAMMDNK"
FT   gene            complement(281196..282512)
FT                   /locus_tag="Metev_0289"
FT   CDS_pept        complement(281196..282512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0289"
FT                   /product="tRNA pseudouridine synthase D TruD"
FT                   /note="PFAM: tRNA pseudouridine synthase D TruD; KEGG:
FT                   mbu:Mbur_1281 tRNA pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73217"
FT                   /db_xref="GOA:D7E6J5"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6J5"
FT                   /inference="protein motif:PFAM:PF01142"
FT                   /protein_id="ADI73217.1"
FT                   /translation="MKVHDIEKEIGIDLYTTSTNGIGGTLRQEIDDFIVKEITNREEGD
FT                   TGKYLVLELKKSNWETHHLIRDLTRKLGISQKRIGFAGTKDKRAVTTQKISIYDLSLED
FT                   INNVTLKDSEMNYIGRSDKSIELGDLIGNEFYITVRNTDHSIDELYNQLEIITKDIKQM
FT                   EGIPNFFGVQRFGSTRPVTHIVGESLVRGDPEDAALKYIAFAFPEEPEDTKSARKYVYE
FT                   TRDYIEGLKLYPLRLRYERSMMDYLIKNPDDYSGAFNVLPRNIQRIFVHAYQSYLFNKI
FT                   LCQRIKEGLPLNRAVEGDIVCFRNKAGLPDTSRIQEVTSTNIDGMNNLIKRKRAFVTAP
FT                   LIGYQTEFSSGKPGEIEKKIFDETGLTLEDFKVPSTPELASKGVRREILLHTEPSFKAD
FT                   EDELNPGKSKAVLEFTLPKGSYATTLLREYMKVNPLKMS"
FT   gene            complement(282677..283024)
FT                   /locus_tag="Metev_0290"
FT   CDS_pept        complement(282677..283024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0290"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="KEGG: mbu:Mbur_1277 peptidyl-tRNA hydrolase; PFAM:
FT                   protein of unknown function UPF0099"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73218"
FT                   /db_xref="GOA:D7E6J6"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6J6"
FT                   /inference="protein motif:PRIAM:3.1.1.29"
FT                   /protein_id="ADI73218.1"
FT                   /translation="MIDYKQCIIIREDLKLSKGKLATQAAHAAVSSVEKASKSTIENWK
FT                   NGGQKKVVLKVPSLQDLYELKEIAEKKEIPTALISDAGHTQIPAGTVTALGIGPAKVEE
FT                   LDSFTGNLKLV"
FT   gene            complement(283026..283940)
FT                   /locus_tag="Metev_0291"
FT   CDS_pept        complement(283026..283940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0291"
FT                   /product="alpha-L-glutamate ligase, RimK family"
FT                   /note="KEGG: mma:MM_0111 ribosomal protein S6 modification
FT                   protein; TIGRFAM: alpha-L-glutamate ligase, RimK family;
FT                   PFAM: RimK domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73219"
FT                   /db_xref="GOA:D7E6J7"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6J7"
FT                   /inference="protein motif:TFAM:TIGR00768"
FT                   /protein_id="ADI73219.1"
FT                   /translation="MAKIGIIVTDNNDWTARALYNAAKERNFNPVFINLENIEVSIGST
FT                   IRYSLRENSLSELDAVVVRDVGAGSIESVSFRFDVLRQLYELGILIVNTPESIQNAANK
FT                   YYSTYLMAKANLPVPCTRVVQSVESALKTLDDFRDAIIKPVFGFKGIGIIRIKNYSIIE
FT                   PDNTTNPKQIEEMVKNEIDNKGMLYIQEYIPNMGRDIRAYVVDGKVIGAIYRTAPDGKW
FT                   LNNLSQGGSCQRCSLTPSQKEISIKAAKTIGTVFAGVDLIEGNNKTMLLEVNGTPSGAG
FT                   IYKSLGINPADYIMDYIQKQVRD"
FT   gene            complement(284006..284317)
FT                   /locus_tag="Metev_0292"
FT   CDS_pept        complement(284006..284317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA3649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73220"
FT                   /db_xref="GOA:D7E6J8"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6J8"
FT                   /inference="similar to AA sequence:KEGG:MA3649"
FT                   /protein_id="ADI73220.1"
FT                   /translation="MANTIIKRIGELSLGKILGIIYAVIGLIIGVIVSFVTLIAGNIGM
FT                   GNAIGGPAYLFGAAAIITMPVFYGIMGFVLGLIIAVIYNLIAGFIGGLEIDLETDSKT"
FT   gene            complement(284403..284657)
FT                   /locus_tag="Metev_0293"
FT   CDS_pept        complement(284403..284657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfd:PFDG_01373 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73221"
FT                   /db_xref="GOA:D7E6J9"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6J9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73221.1"
FT                   /translation="MVLFVLILTLSIHITPHSFEYKKFKSDSNPIEKNHLINNIKKVTN
FT                   WNHDAGIEDDASTLKLVDPVLMLIILVMAFLLLKAIEHV"
FT   gene            284891..286125
FT                   /pseudo
FT                   /locus_tag="Metev_0294"
FT   gene            complement(286166..286846)
FT                   /locus_tag="Metev_0295"
FT   CDS_pept        complement(286166..286846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0295"
FT                   /product="protein of unknown function DUF434"
FT                   /note="PFAM: protein of unknown function DUF434; KEGG:
FT                   mma:MM_0098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73222"
FT                   /db_xref="InterPro:IPR007368"
FT                   /db_xref="InterPro:IPR041652"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6K0"
FT                   /inference="protein motif:PFAM:PF04256"
FT                   /protein_id="ADI73222.1"
FT                   /translation="MQNNPHSIEYLRQKLSEPAVDVRYLFNRGYPRTSTIQFVGNHYRL
FT                   NEEERHILTRVVVSSNRSKLRKQIKIECNQINNMNLIIDGYNVFITVESLLKNYILWKS
FT                   DDGFFRDTRGIFNKFKITDVTYKAIDEIITFLLKYQINSVIILFDKQISKSGELARFVS
FT                   EKLKNYSIKGYARTSRHVDFDLKNNSSDYIIATSDGAVIDNSKQVIDIPECIAKNKGYR
FT                   AFTL"
FT   gene            286919..287896
FT                   /locus_tag="Metev_0296"
FT   CDS_pept        286919..287896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0296"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="4.3.1.12"
FT                   /note="TIGRFAM: alanine dehydrogenase; KEGG: mbu:Mbur_1274
FT                   alanine dehydrogenase; PFAM: ornithine
FT                   cyclodeaminase/mu-crystallin"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73223"
FT                   /db_xref="GOA:D7E6K1"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR012742"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR028609"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6K1"
FT                   /inference="protein motif:TFAM:TIGR02371"
FT                   /protein_id="ADI73223.1"
FT                   /translation="MDVLWLNQSDVKNVLDMKSTIDVVEKAFEQHGLKRVQMPSKLYLY
FT                   FNKYNGDLRTMPTYLEDMDISGVKIVNVHPDNPSRDLPTVMATVILNSTETGAPISIMD
FT                   GTYLTDMRTGAGGGVAAKYLARPDSKIIGIIGTGNQARSQLLALSHIFNIEQVKITSKS
FT                   SKHCDEFEKRMKPVVGGDFTKTDIKDVCDCDILVTTTPVRDPIVKFEWINEGTHINAIG
FT                   ADARGKQELESEILKSSKVIVDDTEQASHSGEINVPLSNNIISTTDIYGELGEIITGHL
FT                   TGRESRKEITIFDSTGLAIQDISTADFVYRKAVENGLGNKLKMF"
FT   gene            complement(287922..288125)
FT                   /locus_tag="Metev_0297"
FT   CDS_pept        complement(287922..288125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0297"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nvi:100119087 similar to leukocyte receptor
FT                   tyrosine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73224"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6K2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73224.1"
FT                   /translation="MLYGMLGMDPHSTKSITKKTMQRCPKCGTYQKVGDEPQKCVNEKC
FT                   RAEIIREDFSSTARSTMMMASK"
FT   gene            288478..289032
FT                   /locus_tag="Metev_0298"
FT   CDS_pept        288478..289032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0298"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: mba:Mbar_A2814 PBP
FT                   family phospholipid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73225"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6K3"
FT                   /inference="protein motif:PFAM:PF01161"
FT                   /protein_id="ADI73225.1"
FT                   /translation="MNKINMYITLLLFCTIFLGIGCTGQDGNKLDNGAENSQIAQFDVS
FT                   SSVFENNESIPVAYTCDGENINPPLQFSGIPDDAKSLVLIVEDSDAPDGVFTHWIVWNI
FT                   NPESNIMENSVPGIEGENSFGEVSYGGPCPPSDTTHRYIFGVYALDTELNLDGGANRQN
FT                   LENAMDGHILAKGELIGLYGR"
FT   sig_peptide     288478..288552
FT                   /locus_tag="Metev_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.728) with cleavage site probability 0.644 at
FT                   residue 25"
FT   gene            complement(289035..289880)
FT                   /locus_tag="Metev_0299"
FT   CDS_pept        complement(289035..289880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0299"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   mbu:Mbur_0476 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73226"
FT                   /db_xref="GOA:D7E6K4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6K4"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADI73226.1"
FT                   /translation="MNLEELYNYIFQSGEILIKIFSVVIFILIALFISKIITVYLRRYF
FT                   KDKIAPSRLNVFLKLIYYSIITVTIGIFILPIVGIQPSSLLVAGGIVGIVIGFASQSIV
FT                   GNLISGIFLIVERPIKIGNQVNIDNNIGIVEDINLISTIIRTFDGLYIRIPNEKVFTNN
FT                   ITNYVANVARRFEYIVGIRYSDDAEQAIDIIKDLIEKEPLALKHPESLVFVDNLGNNAV
FT                   NLSVRIWAPATEWFSLRTSFLWKIKTTLEDNGIEIAFPQRTVWFANQTQGEEYYKKNEM
FT                   "
FT   gene            complement(289877..290605)
FT                   /locus_tag="Metev_0300"
FT   CDS_pept        complement(289877..290605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0300"
FT                   /product="Protein of unknown function DUF432"
FT                   /note="PFAM: Protein of unknown function DUF432; KEGG:
FT                   mbu:Mbur_0475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73227"
FT                   /db_xref="InterPro:IPR007366"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6K5"
FT                   /inference="protein motif:PFAM:PF04254"
FT                   /protein_id="ADI73227.1"
FT                   /translation="MYGYHNAPLKFEYNEFILSCTNLDGVFLYKRDNTNDNDNNDNIEK
FT                   IIHKEDCNLLINPIEPVNLPKKITSLLLIEFTKSIFISPSSIKKIYLTFPIEIGVFISD
FT                   NKDNYEVLDFFTLAKKKYSIYGTPSNGTICKYWSSDTHLSIPETNPLYEGILELQITNS
FT                   TVRWMEVSKTVLNAYGMKLYYDSEIVSMKVNMKITGQYMAETDFISQPILENMTNSTEL
FT                   YNVGKVKFVNITKYIMENGI"
FT   gene            complement(290650..291090)
FT                   /locus_tag="Metev_0301"
FT   CDS_pept        complement(290650..291090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0301"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mac:MA1462
FT                   universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73228"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6K6"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADI73228.1"
FT                   /translation="MVDKYNNILIATDGSENSKNAIQSGINLASKTGAKVYAVYVIHPV
FT                   SVTTGRKGPDWVEAAREMMRDEGEKATNYIKKMGDEENLEVESVILEGDPGDEIVKFAD
FT                   KNDVDLIVMGTRGLSGIQRFMVGSVADKVVKHSNTEVLIVPS"
FT   gene            complement(291115..291555)
FT                   /locus_tag="Metev_0302"
FT   CDS_pept        complement(291115..291555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0302"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mma:MM_1455
FT                   universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73229"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6K7"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADI73229.1"
FT                   /translation="MTEDQFKKILIATDGSDNSKNAVNSGIEIAKINNADVYAVYVIPP
FT                   VSAPAAQRGRSWAESIRQDLTEDGKKATKDVEDAAKETGVNVETILLEGNPSEEIINFA
FT                   EKNDMDLIVLGSLGKSGIEKFLIGSVAEKVVMNANKQVLIVP"
FT   gene            291773..292525
FT                   /locus_tag="Metev_0303"
FT   CDS_pept        291773..292525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0303"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="KEGG: mma:MM_0307 uroporphyrin-III
FT                   C-methyltransferase; TIGRFAM: uroporphyrin-III
FT                   C-methyltransferase; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73230"
FT                   /db_xref="GOA:D7E6K8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6K8"
FT                   /inference="protein motif:TFAM:TIGR01469"
FT                   /protein_id="ADI73230.1"
FT                   /translation="MNQKNGKVFLVGSGPGDPELLTLKADRLIKSADVMVCDQLPGKKI
FT                   LESIPESVEKIDAGKSAGDHKLSQNEINQVLVNKAREGKTVVRLKGGDPYIFGRGGEEA
FT                   EELIKEGINFEVVPGITSAIAVPAYAGIPLTHRDHASMVTFITGHEDPTKDESSLDWES
FT                   LANFEGTIVILMGVKRLKQNAQQLIKHGKNPKTPVAIIENGTHSDQRVTVGSIESIADI
FT                   AEDRGVKPPAITVIGDVVKLRNKLGFND"
FT   gene            292561..293388
FT                   /locus_tag="Metev_0304"
FT   CDS_pept        292561..293388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0304"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   mac:MA3034 uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73231"
FT                   /db_xref="GOA:D7E6K9"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6K9"
FT                   /inference="protein motif:PFAM:PF02602"
FT                   /protein_id="ADI73231.1"
FT                   /translation="MTSNINQDTGQTPVIAIMRPEMYLNKSVILAQEYGFETFSAPMIE
FT                   IVDKKDACFDDFVYRVLNGKSDYVIFTSANGIDFTLNKISDEIKQEFLVALNNTNVLAI
FT                   GPNTQKALEDTGIECIDLPDSYSSEGVVDYLSLYVEGKTIDIARSSHGSKYLISGLINN
FT                   GATVFETQVYTLNTPDNITQKNLIRCALAGNISVFAFTSSMIVHNFFTKANDVEAEDRI
FT                   IEILNSNDTTVAAIGTPTASTLKNYGVKVDIVPEKYLFENMLADIHDFIYGTQ"
FT   gene            293413..294612
FT                   /locus_tag="Metev_0305"
FT   CDS_pept        293413..294612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0305"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: mac:MA3035 coenzyme PQQ synthesis protein E;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73232"
FT                   /db_xref="GOA:D7E6L0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR030894"
FT                   /db_xref="InterPro:IPR034479"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6L0"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI73232.1"
FT                   /translation="MIGISKLYCGTVESSDALRYGCLSSKLPSHLLQFSKDKKPVVVWN
FT                   VTRRCNLKCAHCYAQSQDIDYSDELTTNEGKELIDDLAEFGSPVILFSGGEPLMRHDLF
FT                   ELVRYARSKGIRAVISTNGTLIDSDMATTLKGIGLSYVGISLDGVKDTNDRFRGVRGAF
FT                   NAALEGLQNCQKEGIKVGLRFTMNKENVADIPALFDLIDEMDIPRICFYHLVYSGRGSG
FT                   LMDKDLSPEETRKTLDLIMDRTKQLHDKGKQVEVLTVDNHCDGPYVYLRLLEEDPERAE
FT                   DVYQLLSMNKGNSSGIGIGCVSWDGSVHPDQFWRHYTLGNVKERKFSDIWTDTSDDLMA
FT                   GLKNRKPLIISNADRCASCKWFDICNGNFRVRAEAVHNNVWADDPACYLTEEEIGYYEG
FT                   "
FT   gene            complement(294657..295016)
FT                   /locus_tag="Metev_0306"
FT   CDS_pept        complement(294657..295016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0306"
FT                   /product="Desulfoferrodoxin ferrous iron-binding region"
FT                   /note="PFAM: Desulfoferrodoxin ferrous iron-binding region;
FT                   KEGG: mbu:Mbur_1006 desulfoferrodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73233"
FT                   /db_xref="GOA:D7E6L1"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR036073"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6L1"
FT                   /inference="protein motif:PFAM:PF01880"
FT                   /protein_id="ADI73233.1"
FT                   /translation="MIENIVKGKEEEAESKLKEKHIPSIEIMKGQGKQGGDFIEVAVGK
FT                   ETPHPNKVEHHIAWVELHGVRNNGQVVNLGKMDFAPVYVEPNAKFEVNSIDDFKSFYAV
FT                   EYCNIHGLWENSVEM"
FT   gene            complement(295042..295602)
FT                   /locus_tag="Metev_0307"
FT   CDS_pept        complement(295042..295602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0307"
FT                   /product="Ferroxidase"
FT                   /EC_number="1.16.3.1"
FT                   /note="KEGG: mbu:Mbur_1120 ferritin and Dps; PFAM: Ferritin
FT                   Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73234"
FT                   /db_xref="GOA:D7E6L2"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6L2"
FT                   /inference="protein motif:PRIAM:1.16.3.1"
FT                   /protein_id="ADI73234.1"
FT                   /translation="MLSEKMTEALNVQLNKEMYSAYLYMSMSAYSTYIGLNGFANWFMV
FT                   QYQEEMTHAMKFYDYINDHGAQVKLMEIPQPPTAFDSALDMFEKTLKHEKFVTKSINEL
FT                   VDLAVEEKDHATYTFLQWYVSEQIEEEANDNEIISKLKLMGEDGSGMYMLDKELSQRVF
FT                   VPEYTSKALSGAQTQTQAEDKGQ"
FT   gene            296143..298758
FT                   /locus_tag="Metev_0308"
FT   CDS_pept        296143..298758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0308"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="KEGG: mbu:Mbur_2184 valyl-tRNA synthetase; TIGRFAM:
FT                   valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73235"
FT                   /db_xref="GOA:D7E6L3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6L3"
FT                   /inference="protein motif:TFAM:TIGR00422"
FT                   /protein_id="ADI73235.1"
FT                   /translation="MTVPKEYIPHEVEPKWQSSWDMSKYHFDWEDQSRPQYIIDTPPPY
FT                   PTGNFHIGNALNWCYIDFIARYKRMRGYNVMFPQGWDCHGLPTEVKVEELHGITKNEVS
FT                   RAEFRKMCKDLTSQNIEKMRETMMRLGFSIDWNNEFVTMEPEYFVKTQKSFVQMYDINR
FT                   IYQSDYPVNWCPRCETAIALAEVEYDSRDTSLNYLYFDDLEIATTRPELLPACVAVAVN
FT                   PEDERYREHINDEVEVPIFGQKVPVLADEAVDTSFGTGVVMICTFGDKQDVRWCVKYDL
FT                   PVRKAINKNGRMTDVAGKYSGMTISECKDAITQELSDKGHLYQQETLEQNVGLCWRCKT
FT                   PIEILSEPQWFVSVNDDEIHNTADEVNWHPEYMKTRLKNWTDVMEWDWCISRQRVFATP
FT                   IPVWYCNKCGETMVAKEEWLPLDPIQTEPPEPCNCGSTDFEPENDVLDTWMDSSLTALH
FT                   VSGWLSEHELRLPTQIRPQGHDILRTWAFYTILRTKAIKGIKPWEFILVNGMVLGEDGH
FT                   KMSKSQGNIISPDEVVGQYGADAFRQWGAVGGTPGSDVMFRWKDVVSASRFMQKVWSIY
FT                   RFSMTHLEEFVPDSSDMAQISQENLSLVDKWLLSKLNKLIESVTTSMDKLLFDEAYKSM
FT                   RTFAWEVLADNYLELVKSRLYGKDPESRKAAQTTLYYAIDTLIHVLAPITPFFAEEMYS
FT                   RFKEGSVHEQSWPEVNELLIDNDVESKGEVIKDIASNIRRYKSDNGMALNAPLEKVEIY
FT                   SDVIGNNDIEEIKGATNSEVEVLSGHPQIDYKPVEIKPNMGMIGPKFRDKAGSIVKTLK
FT                   SEDPEKISKQADEGKIVVSVDGETIELDPDSVEIEKEAMSSGRAVDVMDVDGTVVVVIR
FT                   "
FT   gene            complement(298789..300033)
FT                   /locus_tag="Metev_0309"
FT   CDS_pept        complement(298789..300033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0309"
FT                   /product="pyrrolysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.26"
FT                   /note="TIGRFAM: pyrrolysyl-tRNA synthetase; KEGG:
FT                   mbu:Mbur_2086 pyrolysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S)"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73236"
FT                   /db_xref="GOA:D7E6L4"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012739"
FT                   /db_xref="InterPro:IPR023877"
FT                   /db_xref="InterPro:IPR023878"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6L4"
FT                   /inference="protein motif:TFAM:TIGR02367"
FT                   /protein_id="ADI73236.1"
FT                   /translation="MSKKSLASLISDLQVWVSRSGLLHEIKNYEVSQRYIHMEMDCGEK
FT                   ITVRNSRNSRTARILRLKKYKKPCKNCKVSDEVINRFLQKHTDRTDTKVTAFSYSESKK
FT                   KKSKQLGHKKKKQSKVQVNPTTESIQSNTSVSEDKTDNKIEPETFTSAQKERINELLLP
FT                   GEKIPFSNEPSKFKEIESELVNKRRNDFKQMYENDREEQIAKLERTISQFFVDKGFIEI
FT                   KAPIIIDIDSVKKMGIDTDHKLSKQIFYLDNKHCLRPMLAPGLYQWLKNFDKILPDPIK
FT                   IFEIGPCYRKESEGSQHLEEFTMFNFCQMGSGANRENLLNHIDDLLKHLNIDYKIIDDN
FT                   CHVYGETIDIVHGDLELSSAVVGPVPIDMNWGIDKTWIGAGLGLERLLKVKHGYKNIKR
FT                   ASKSHSYYNGISTNL"
FT   gene            complement(300257..300328)
FT                   /locus_tag="Metev_R0059"
FT                   /note="tRNA-Pyl"
FT   tRNA            complement(300257..300328)
FT                   /locus_tag="Metev_R0059"
FT                   /product="tRNA-Pyl"
FT   gene            300540..301562
FT                   /locus_tag="Metev_0310"
FT   CDS_pept        300540..301562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0310"
FT                   /product="methyltransferase MtaA/CmuA family"
FT                   /note="KEGG: mac:MA0146 methylcobalamin:coenzyme M
FT                   methyltransferase; TIGRFAM: methyltransferase MtaA/CmuA
FT                   family; PFAM: Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73237"
FT                   /db_xref="GOA:D7E6L5"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006360"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6L5"
FT                   /inference="protein motif:TFAM:TIGR01463"
FT                   /protein_id="ADI73237.1"
FT                   /translation="MAEEYTPKERFAKALKGESVDRMPAICATQTGTVEQMEASGAYWP
FT                   DAHYDADKMTTLAEAAHTAVGFEMVRVPFDITAEAEFFGCELKEGTQKQQPSVVGHVVK
FT                   TEDDIKSLEGYDLSQKRIGTICESIKQLADKYGDELPIFGSMIGPFSLAQHLNGDDWFT
FT                   NVMINEEFGKKLLDFTTEFCVAYAKKQVENGADTVVIIDPTASYELLGPDFFRKFVLPY
FT                   HKQVVDACKDMGVGTIVHICGDTTKGLPIMDESGTDAISVDQKVDVATAKENVQNAKIV
FT                   GNLDPVETLWNGNPDVIKEKSQESLDKGVDFLAPGCGIVSATSNENLQTMVECAKSWKY
FT                   "
FT   gene            301755..303332
FT                   /locus_tag="Metev_0311"
FT   CDS_pept        301755..303332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0311"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="TIGRFAM: D-3-phosphoglycerate dehydrogenase; KEGG:
FT                   mbu:Mbur_2385 D-3-phosphoglycerate dehydrogenase; PFAM:
FT                   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase catalytic
FT                   region; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73238"
FT                   /db_xref="GOA:D7E6L6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6L6"
FT                   /inference="protein motif:TFAM:TIGR01327"
FT                   /protein_id="ADI73238.1"
FT                   /translation="MKVLVSDSLAEEGINKLKEQFTVDVITGLSEDELVEKIKDYDALV
FT                   VRSGTNVTEKVINAADNLKIIGRAGVGVDNIDVDAATNKGIIVVNTPEGNMISAAEHTI
FT                   SMMMAMCRNIPQAHASLKSRKWERKKFMGVEVNGKYLGVIGLGRIGSYVAQRGQALHMK
FT                   VLGYDPYVSQEQADEMGVELTSVEDICKRADFITVHTPLTKGTENLINADKFALMKDGV
FT                   RVLNCARGGIINEDALAEALRSGKVAGAAIDVFVEEPPFESPLLDFDNVITTPHLGAST
FT                   EEAQVNVAEAAADEVISALTGGPVNNAINIPTVKPEMMPALTPYLKLAETMGKFAGQLM
FT                   TGNYKRVELEYSGDILDKDIKPVTVAALKGILENALGPGVNFVNANSLAKSRKIKVIES
FT                   KSETTNKFPSTITLELTRGSDTKSITGTVSGNGKIGRIIQIDGYHFDIVPTENMLVVDH
FT                   MNRPNVIGPCAIMLGKNDINISGMQVGQVGLGEKTIMVLNVDSEVPESILNEMKSIEGI
FT                   LDAKPVTL"
FT   gene            303376..303861
FT                   /locus_tag="Metev_0312"
FT   CDS_pept        303376..303861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_2386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73239"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6L7"
FT                   /inference="similar to AA sequence:KEGG:Mbur_2386"
FT                   /protein_id="ADI73239.1"
FT                   /translation="MMRKRIYHRPPGLETHFEQQYRYYSDLQYLLKILAGMTGKFGMFE
FT                   SQGTHEQKNFQLKREIGVEIVTNGVDFEPINNKNINRTLSTIEPEGAIDIRINLSYSYL
FT                   DDNYSRVPFRNDSYIVRVDLRDGLLTLKISHHEGPGYTEARRIADTIFDEIRRGSCG"
FT   gene            303833..304318
FT                   /locus_tag="Metev_0313"
FT   CDS_pept        303833..304318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0313"
FT                   /product="Protein of unknown function DUF2240"
FT                   /note="PFAM: Protein of unknown function DUF2240; KEGG:
FT                   mbu:Mbur_2387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73240"
FT                   /db_xref="InterPro:IPR018716"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6L8"
FT                   /inference="protein motif:PFAM:PF09999"
FT                   /protein_id="ADI73240.1"
FT                   /translation="MKYGVVHVDELTKVVASVYKKKSSSELSLKEFEFALSFDFKWMSP
FT                   DEASRVSDMAIESNIVYEQDGYINLNINLDNVSIPHDFKPSDELFKEKSIIEQIMEYIT
FT                   VTMNMDKQKVASLINEKQEEYSQLLYPEISAILVAKELGCDITPFYQKIYKKILQYD"
FT   gene            304488..304868
FT                   /locus_tag="Metev_0314"
FT   CDS_pept        304488..304868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0314"
FT                   /product="ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15; KEGG: mbu:Mbur_2388 50S
FT                   ribosomal protein L18e"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73241"
FT                   /db_xref="GOA:D7E6L9"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR022947"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6L9"
FT                   /inference="protein motif:PFAM:PF00256"
FT                   /protein_id="ADI73241.1"
FT                   /translation="MSKKSQKRVAKKTNPRIVELIGLLKETSHTENAPIWKDLAKRLEK
FT                   PNRTHAEINLSKIDRNTDENEIVLVPGKVLGAGDLGHGVTVAALKISNTAKDKIESVGG
FT                   KILTIEDILEENPSGSGIKILQ"
FT   gene            304893..305312
FT                   /locus_tag="Metev_0315"
FT   CDS_pept        304893..305312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0315"
FT                   /product="ribosomal protein L13"
FT                   /note="KEGG: mbu:Mbur_2389 50S ribosomal protein L13P;
FT                   TIGRFAM: ribosomal protein L13; PFAM: ribosomal protein
FT                   L13"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73242"
FT                   /db_xref="GOA:D7E6M0"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6M0"
FT                   /inference="protein motif:TFAM:TIGR01077"
FT                   /protein_id="ADI73242.1"
FT                   /translation="MKIIDANDLIIGRLASTVAKELLAGEEIAIVNAENAVISGSKVRT
FT                   LTDYNEKREIGSIEHGPHFPKRPDRIITRTVRGMLPYKREKGKKAMSRLKVHVGVPSQF
FT                   ENSKFTTIEGAELSRLSRNKFVKLGEVSSRLGAKF"
FT   gene            305342..305746
FT                   /locus_tag="Metev_0316"
FT   CDS_pept        305342..305746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0316"
FT                   /product="ribosomal protein S9P"
FT                   /note="KEGG: mbu:Mbur_2390 30S ribosomal protein S9P;
FT                   TIGRFAM: ribosomal protein S9P; PFAM: ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73243"
FT                   /db_xref="GOA:D7E6M1"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019958"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6M1"
FT                   /inference="protein motif:TFAM:TIGR03627"
FT                   /protein_id="ADI73243.1"
FT                   /translation="MVDKVVTSSGKNKAAIARATISKGTGKVRVNKVPIEIYEPKFGRL
FT                   KMQEALKLAGDVVSEMDIDVNVRGGGLMGQANAVRTAIARGIVDWTNDTNIRDTYMAYD
FT                   RNLIVNNSRQKESKKFGGPGARAKYQKSYR"
FT   gene            305769..305957
FT                   /locus_tag="Metev_0317"
FT   CDS_pept        305769..305957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0317"
FT                   /product="RNA polymerase, N/8 Kd subunit"
FT                   /note="PFAM: RNA polymerase, N/8 Kd subunit; KEGG:
FT                   mac:MA0598 DNA-directed RNA polymerase subunit N"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73244"
FT                   /db_xref="GOA:D7E6M2"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR020789"
FT                   /db_xref="InterPro:IPR023580"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6M2"
FT                   /inference="protein motif:PFAM:PF01194"
FT                   /protein_id="ADI73244.1"
FT                   /translation="MIPIRCFTCGKVIANQWHEYKNRVEEGENSGAVLDDLGIKRYCCR
FT                   RMFLTHVELVDTLAPYQ"
FT   gene            305958..306056
FT                   /locus_tag="Metev_R0008"
FT                   /note="tRNA-Pro1"
FT   tRNA            join(305958..305997,306022..306056)
FT                   /locus_tag="Metev_R0008"
FT                   /product="tRNA-Pro"
FT   gene            306211..306408
FT                   /locus_tag="Metev_0318"
FT   CDS_pept        306211..306408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0318"
FT                   /product="RNA polymerase Rpb6"
FT                   /note="PFAM: RNA polymerase Rpb6; KEGG: mma:MM_1759
FT                   DNA-directed RNA polymerase subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73245"
FT                   /db_xref="GOA:D7E6M3"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6M3"
FT                   /inference="protein motif:PFAM:PF01192"
FT                   /protein_id="ADI73245.1"
FT                   /translation="MNIQTKKQTFTRYERARIIGARALQISMDAPILIENVENLDPLQV
FT                   AIEELKHGVIPVTVKRELRK"
FT   gene            306418..307128
FT                   /locus_tag="Metev_0319"
FT   CDS_pept        306418..307128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0319"
FT                   /product="ribosomal protein S2"
FT                   /note="KEGG: mbu:Mbur_2393 30S ribosomal protein S2;
FT                   TIGRFAM: ribosomal protein S2; PFAM: ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73246"
FT                   /db_xref="GOA:D7E6M4"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023454"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6M4"
FT                   /inference="protein motif:TFAM:TIGR01012"
FT                   /protein_id="ADI73246.1"
FT                   /translation="MEDQQDIEDNSEKNLETEETEETATVSQSATPQPSEESTESEEES
FT                   TSLIPIDEYLASGVHIGTQQKTKDMINFIYRVRTDGLYVLDIQSTEERIKLAASFLSKY
FT                   NPSTILVTSARQYGQHPATMFAKAIGAKSMVGRFIPGTLTNPQMEGFFEPEVTLVTDPT
FT                   GDAQVIKESVNVGVPVVAFCDTNNQTSSVDLVIPTNNKGRKALSLVYWLLAKEVAKNMG
FT                   IPFNYEFSDFETEI"
FT   gene            307217..308014
FT                   /locus_tag="Metev_0320"
FT   CDS_pept        307217..308014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0320"
FT                   /product="protein of unknown function DUF52"
FT                   /note="PFAM: protein of unknown function DUF52; KEGG:
FT                   mbu:Mbur_2394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73247"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6M5"
FT                   /inference="protein motif:PFAM:PF01875"
FT                   /protein_id="ADI73247.1"
FT                   /translation="MRNPTVAGQFYALDPSGLEKEISRCFGDIDISQQNIHGAVIPHAG
FT                   YMFSGPVAAYAFAQLPEADTYIILGPNHTGLGSAVAISQDTWSTPLGNVETDKELGKSL
FT                   AGSILDVDEMAHMYEHSIEVQIPFLQYRFSHGFKVLPICMGLQDEETALEVGNQISSAI
FT                   TESNKKIFVIASSDLTHFEPENVANDTDKYLIESIENMDVHEFYRRISERSATACGYGP
FT                   ISAMLTVAKSLGGRTGKLLKYGTSADVTGDSSSVVGYAAVVIE"
FT   gene            308064..308978
FT                   /locus_tag="Metev_0321"
FT   CDS_pept        308064..308978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0321"
FT                   /product="mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /note="TIGRFAM: mevalonate kinase; KEGG: mma:MM_1762
FT                   mevalonate kinase; PFAM: GHMP kinase; GHMP kinase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73248"
FT                   /db_xref="GOA:D7E6M6"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022937"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6M6"
FT                   /inference="protein motif:TFAM:TIGR00549"
FT                   /protein_id="ADI73248.1"
FT                   /translation="MITSSAPGKIYLFGEHAVVYGENAICCAIELRTHVQAEFNDHIEI
FT                   NSVLGRSGLNFEKHPYVSAAIERMKEFAPVDGVKININSELPVGSGLGSSAALTVSTIQ
FT                   ALNHLFHCGLSLEQIADLGYNVEWDVQGNASPTDTYVSTMGGVFMLPSRRKLELNDCGI
FT                   VIGDTKKNSSTKKLVTNVAELKNRFPEIVTSILSTIGKITYCGEYSVCNGDYESIGKLM
FT                   NINQGLLDSIGVGSLELSQLIYSARSKGAYGAKLTGAGGGGCMIALADASKTVDVSDAI
FT                   KSAGGVPITTNITDKGVVVETKR"
FT   gene            308984..309775
FT                   /locus_tag="Metev_0322"
FT   CDS_pept        308984..309775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0322"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   mbu:Mbur_2396 aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73249"
FT                   /db_xref="GOA:D7E6M7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR024192"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6M7"
FT                   /inference="protein motif:PFAM:PF00696"
FT                   /protein_id="ADI73249.1"
FT                   /translation="MSTNSSGGQNITILKIGGSVITDKNADENFAKHDEIDRISKEISE
FT                   FDGKLVIVHGAGSFGHPQAKKYQITDKFDAKGSIITHKSVNLLNQLFIDSLIDNNVNAV
FT                   SVHPMNNTISKNGRIQDMFLDNLYYMLDNKIVPVLHGDVVMDKNTGTSIISGDQIVPYL
FT                   ATQMGAIRIGIGSIKEGVLDENGKTLKLITHDNFANVKNNIGSSEGTDVTGGMLGKVTE
FT                   LLKLNELTGSTSYIFNAGKPGNVSMFLQGNDIGTSITGSGQ"
FT   gene            309800..310876
FT                   /locus_tag="Metev_0323"
FT   CDS_pept        309800..310876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0323"
FT                   /product="isopentenyl-diphosphate delta-isomerase, type 2"
FT                   /EC_number="5.3.3.2"
FT                   /note="TIGRFAM: isopentenyl-diphosphate delta-isomerase,
FT                   type 2; KEGG: mma:MM_1764 isopentenyl pyrophosphate
FT                   isomerase; PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73250"
FT                   /db_xref="GOA:D7E6M8"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6M8"
FT                   /inference="protein motif:TFAM:TIGR02151"
FT                   /protein_id="ADI73250.1"
FT                   /translation="MSTSRRKIEHLNFCAHSPVESRKKGSGFDDITLIHRALPEVNMDE
FT                   IDLSTRFLGKDFSAPFMIASITGGHEDTIPVNRALAKAVEEMGVGIGVGSQRAAIEDPA
FT                   QEESFRVVRDEAPNAFIYGNVGAAQIKEYGVEVVEKLVDMIDADAMAVHLNFLQEAVQP
FT                   EGDRDASGTLEAISEITSLNIPVIAKETGAGISHEDAVLLKNAGVSAIDVGGVGGTSWS
FT                   GVEFYRAKDRNDLRSQLLGEIFWDHGIPTASDLIECDVSLPLIATGGIRSGLDIAKSVT
FT                   MGADVASAALPFVEPALKNEQEVINTLSNFIYQLKVSMFLCGCKTVSDLRDVPAVVTGW
FT                   TREYLLQRGFEIDKLSMR"
FT   gene            310986..312329
FT                   /locus_tag="Metev_0324"
FT   CDS_pept        310986..312329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0324"
FT                   /product="RNA-metabolising metallo-beta-lactamase"
FT                   /note="PFAM: RNA-metabolising metallo-beta-lactamase; KEGG:
FT                   mbu:Mbur_2398 beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73251"
FT                   /db_xref="GOA:D7E6M9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030879"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6M9"
FT                   /inference="protein motif:PFAM:PF07521"
FT                   /protein_id="ADI73251.1"
FT                   /translation="MTDIGIIAVGGYNEMGRNMTAIRVGEDIIILDMGLRLDRVQIHED
FT                   VEINKMHSLELIEMGAIPDDTIMKEINGTVRAIVCTHGHLDHIGAIPKLAHRYAAPIIS
FT                   TPYTTSLIKQQIESEVKFGVKNKIVTLNAGGIYQVTEDISIEFIRAQHSIIDCVFAVIH
FT                   TPDGAILYACDYKLDRMPTMGEQPDFDRLKSLGEEGVLAMITESTNSGVPGKTPSERIA
FT                   HDLVRDVLLGTEESDVGMIVTTFASHIARINSIIKFAAEMGRTPVLIGRAMDNYVLTAK
FT                   KLGYIELPDNIEVYGARKDVDKALKKIVNKGKDKYLPIVTGHQGEPGAILPRIANGETP
FT                   YTIESGDKVIFSANVIPSPMTEGNRYSLETKLKMRGARLFTDVHVSGHACKEDHWELLR
FT                   IINPEHVIPAHGTINMHSSYIEMAEDAGYVLGNTLHLLRNGEELYIEE"
FT   gene            312354..313331
FT                   /pseudo
FT                   /locus_tag="Metev_0325"
FT   gene            complement(313372..316032)
FT                   /locus_tag="Metev_0326"
FT   CDS_pept        complement(313372..316032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0326"
FT                   /product="pyruvate, phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="TIGRFAM: pyruvate, phosphate dikinase; KEGG:
FT                   mbu:Mbur_0966 pyruvate phosphate dikinase; PFAM: pyruvate
FT                   phosphate dikinase PEP/pyruvate-binding; PEP-utilising
FT                   protein mobile region; PEP-utilizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73252"
FT                   /db_xref="GOA:D7E6N0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6N0"
FT                   /inference="protein motif:TFAM:TIGR01828"
FT                   /protein_id="ADI73252.1"
FT                   /translation="MTDKKFVYFFGDNQTEGSNKMKHLLGGKGANLAEMANLGVPVPPG
FT                   FTISTEACVLYMKNNDYPEGMWDEIDKNIDKLEKSTGKKFGDPENPLLSSVRSGAPISM
FT                   PGMMDTVLNLGLNDETVRGLAKRTDNEWFAYDSYRRFIMMFSDVVLGIDTNEFENLIQQ
FT                   KKDELGVTEDTELDTNTMKDLVEEFKSVYKEKTGSDFPQEIKQQLKMAINAVFNSWNNE
FT                   RAKKYRQLNDISDELGTAVNVQAMVFGNMGETSGTGVAFTRNPATGEKEFYGEYLTNAQ
FT                   GEDVVAGIRTPKSIQALKENMPDVYKQLDDITQKLEQHYKDMQDIEFTIEKGKLYMLQT
FT                   RNAKRTAAAALKVAVDMVYENLINKKEAVMRLKPSQIDQVLHPMIDPDSELELLSSGLA
FT                   ASPGAAVGKVVFSAEHAEEMAQNNEDVILVRTETSPEDIGGMHAAKGVLTVRGGMTSHA
FT                   AVVARGMGKPCVCGCDGISIDMNKGVFTAKGYSINEGECISIDGSEGKIYMGEAELKMP
FT                   NVSGELETMLQWADEIRSLNVRTNADTPEDAKLARDFGAEGIGLCRTEHMFFGEERIPV
FT                   VREMIMADNKEDREKALQKLQPMQKDDFLDIFRAMDGYPITIRLLDPPLHEFLPNYEDL
FT                   IEKIKKLESEGGKQEEIKRVNDLLRNVDTLKETNPMLGHRGCRLGITYPEIYEMQIKAI
FT                   IEAACELSSEGTNVIPEIMIPLVSNEKELDFVKKTVTDTAESVMNEKGTNIDYLCGTMI
FT                   ELPRAALTADKIAKGAEFFSFGTNDLTQTTFGYSRDDAGKFLPLYIDKGILESDPFAVL
FT                   DQEGVGELMKIGIDKGRSSRPDIKMGICGEHGGDPESISFSYEAGLNYVSCSPYRVPIA
FT                   RLASAQAVLKEENQN"
FT   gene            316422..316682
FT                   /locus_tag="Metev_0327"
FT   CDS_pept        316422..316682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0327"
FT                   /product="H/ACA RNA-protein complex component Gar1"
FT                   /note="KEGG: mma:MM_1771 H/ACA RNA-protein complex
FT                   component Gar1"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73253"
FT                   /db_xref="GOA:D7E6N1"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR038664"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6N1"
FT                   /inference="similar to AA sequence:KEGG:MM_1771"
FT                   /protein_id="ADI73253.1"
FT                   /translation="MKKLGTVSHLSKSRNLIVRMDKLKPSDAFKKAPKINSVVLNKSVK
FT                   PIGEINDIIGPVSHPYVIINVSRKVTDSELLNYVNERVYIK"
FT   gene            316756..317781
FT                   /locus_tag="Metev_0328"
FT   CDS_pept        316756..317781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0328"
FT                   /product="Transcription factor TFIIB cyclin-related
FT                   protein"
FT                   /note="KEGG: mbu:Mbur_0963 transcription initiation factor
FT                   IIB; PFAM: Transcription factor TFIIB cyclin-related; Zinc
FT                   finger TFIIB-type domain protein; SMART: Cyclin domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73254"
FT                   /db_xref="GOA:D7E6N2"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023484"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6N2"
FT                   /inference="protein motif:PFAM:PF00382"
FT                   /protein_id="ADI73254.1"
FT                   /translation="MVEVERERYSDTSEREKIREMIKARKEKEKEKEKSSETESSVTKC
FT                   PECGSINLEQDYERAELVCSDCGLVVDAELVDEGPEWRAFDHDQRMKRSRVGAPMTYTI
FT                   HDKGLSTMIDWRNRDSYGKSISSKNRAQLYRLRKWQRRIRVSNATERNLAFALSELDRM
FT                   ASALGLPRTVRETAAVVYRKAVDKNLIRGRSIEGVAAAALYAACRQCSVPRTLDEIGEV
FT                   SRVSRKEIGRTYRFISRELSLKLMPTSPIDYVPRFCSGLKLKGEVQSKGVEILRQASEK
FT                   ELTSGRGPTGVAAAAIYIASILCGERRTQREVADVAGVTEVTIRNRYKELSEELDIEII
FT                   L"
FT   gene            317917..318534
FT                   /locus_tag="Metev_0329"
FT   CDS_pept        317917..318534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0329"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   mbu:Mbur_0962 lysine exporter protein LysE/YggA"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73255"
FT                   /db_xref="GOA:D7E6N3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6N3"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADI73255.1"
FT                   /translation="MLETFEMLLIGLGVGFTGAVVPGPMLFATIETSFKKGWSAGPEVV
FT                   LGHALIESVITLLIIFGISSFINDDIFSIISVVGGIALVVFGIFTVKSPVNDQYSCSNS
FT                   YEMLTSPIVSGVVTSASNPYFWMWWFTAGSALVLRGYEIGLIAAVFFIAGHWIADLGWY
FT                   SAVSLSFSRGKKLISSGMHNWMMKICGVFLILFGLWFVIGWS"
FT   gene            318536..319561
FT                   /locus_tag="Metev_0330"
FT   CDS_pept        318536..319561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0330"
FT                   /product="protein of unknown function Met10"
FT                   /note="PFAM: protein of unknown function Met10; KEGG:
FT                   mba:Mbar_A1392 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73256"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR040601"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6N4"
FT                   /inference="protein motif:PFAM:PF02475"
FT                   /protein_id="ADI73256.1"
FT                   /translation="MSEVVKRKGIKVSKKKGEPTRRVLIEKGLLDASAKIFSSNGFLFL
FT                   PILKQPVNSEFFEIKQVSNDFIVGDYEFELMEKSPTFEDLLGYIPHYEIVGDIAIVDED
FT                   DESEARKIADAIIRLHPNIKTVVGTTAPIGGEYRVRNVKVIAGEDRTETIHKEHGCRYV
FT                   VDIAEAYFTPRLSTERERVLSLISSRDLVVDMFAGVGPYSILIAKKVDVKKVIAIDKNP
FT                   TAVRFLRRNIELNSVNNVVAIEGDAGDKEQELEGIADHVIMNLPHSAEEFLNAAVNITK
FT                   PGGIIHYYDITPEDDLFDSSLELIRNAANYKGRQIEVVNKRVVRSYAPHEFNICIEVKV
FT                   N"
FT   gene            319618..319689
FT                   /locus_tag="Metev_R0009"
FT                   /note="tRNA-Thr1"
FT   tRNA            319618..319689
FT                   /locus_tag="Metev_R0009"
FT                   /product="tRNA-Thr"
FT   gene            320266..321705
FT                   /locus_tag="Metev_0331"
FT   CDS_pept        320266..321705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0331"
FT                   /product="phage/plasmid primase, P4 family"
FT                   /note="KEGG: mma:MM_0151 hypothetical protein; TIGRFAM:
FT                   phage/plasmid primase, P4 family; PFAM: primase P4"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73257"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6N5"
FT                   /inference="protein motif:TFAM:TIGR01613"
FT                   /protein_id="ADI73257.1"
FT                   /translation="MKISNYNDKRSEIHKLAQIIIERYDILNLTRRDMNLLLIYDKDEG
FT                   IYKNNPNLLDRIIYDEGARLSELRGKGNNSPFTDFDNNNSPFKDFDNSNLIKEEVERVK
FT                   HVIQSKLRCIDKSQINTDKFYLPVNNGLLELKTGKLKNFSPEIYFTKKIPIDYKKDTNV
FT                   PCEFFNFLKDIFEGDEWQIYVLQEYLGYTLYCGYPFDKFLFLRGLPENGINVILELMKS
FT                   LVGDVNYHTLTFSDLLKEKSAVQLEYYDKLFNICGEMGKNVSPNPEQLGKLVGDNAIKV
FT                   DEKYEYGFTFKNRTKLLFTGDKLPDVNRLSADLIKKLIILDVFPKEKRIQNDEIPNVHQ
FT                   IQIMCENPTFLKGILSWALEGLQRLLYNNGFSYSEKIDNKINEMLTLKENHIDLYVGQR
FT                   IAHNTGSFCPSDMVYSDYISFASELGITPYGKSKFYSEFIDACIKFGYKLYKTQKTYNN
FT                   GKRHQSFVNISLKNIISSYPL"
FT   gene            322265..323290
FT                   /locus_tag="Metev_0332"
FT   CDS_pept        322265..323290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afu:AF2357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73258"
FT                   /db_xref="GOA:D7E6N6"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6N6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73258.1"
FT                   /translation="MIKSKRGLMKINQYKKFLSSALVIILLLYYPFMDYYLLEKDNYDR
FT                   YLKDTCEEILSHSDNNTEKVKNIIKWEQHRIIDNPNVEYFTISNILSLFFINPYRLPDN
FT                   PGWYLYIGKASCQELAFVFENMAKRTNLTYRRIYADKLIKPNGESNNHRWSEVKLGGKW
FT                   TIADAGWNGLYHPDYNKSYFINNGYKFGHVVIVDENFKPIKDCTSSYVNKTGHLKIEAT
FT                   KNGKPVENANISIYMMHENSYYQVVGHSIDYSTNSNGIFELDLATYGNTNYIIKLSSTE
FT                   LNGIYQYEGKKSLSLNNNENKILNVKLDEIRPGGSCFYLILGLILIINFYLYIFKGNIM
FT                   K"
FT   gene            323528..324103
FT                   /locus_tag="Metev_0333"
FT   CDS_pept        323528..324103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0333"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mvn:Mevan_1628
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73259"
FT                   /db_xref="GOA:D7E6N7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6N7"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADI73259.1"
FT                   /translation="MKYSKEWLRENELKKILNNTTISEKYEIWILLMYTPALRVSEALN
FT                   VRVRDLDFENECIEIYGGKGKDDTEMQKAPCNISVLKRLKRYAEHSDLRPKEYIMFSQK
FT                   KKKASRFHVYNVLNKLCSQAGIDKKIGTHTLRRSRAEHLLDRGLSLTYVSRFLRHKNLA
FT                   TTMAYLDVSTTDIQREMSKIDDSVEEIL"
FT   gene            324295..324750
FT                   /locus_tag="Metev_0334"
FT   CDS_pept        324295..324750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0334"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   pho:PH1033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73260"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6N8"
FT                   /inference="protein motif:PFAM:PF01878"
FT                   /protein_id="ADI73260.1"
FT                   /translation="MRYWCLSTSIDNWKVCKENNLWGMDYRYYPTLAKFVNPGDKAVIY
FT                   TSKNKRFVATVKFTGSYFYDDSDIGWNYLFPYRINFEILHENEKSPQINYTVSNDGNEA
FT                   NWFGDNLIDEISFIADKSRTWNQYFQVSIIRITEEDFNTIQNVIINQ"
FT   gene            complement(324856..326283)
FT                   /locus_tag="Metev_0335"
FT   CDS_pept        complement(324856..326283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0335"
FT                   /product="HNH endonuclease"
FT                   /note="KEGG: ecj:JW1145 5-methylcytosine-specific
FT                   restriction endonuclease B; PFAM: HNH endonuclease; SMART:
FT                   HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73261"
FT                   /db_xref="GOA:D7E6N9"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6N9"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ADI73261.1"
FT                   /translation="MSDKKKESKNNQKPDIWVIKANINSKLYQVDMFLNEGITGLGYSL
FT                   GDLSYLIGYNLKEIKNDFEKYDINVDRVAPPVNRFLNQVKKGDIVLMPIGNKYVNIGKI
FT                   KTGEYEYHPDGFRKYLYDINEKELNRLKTREDLNVYHVKRVDWIHYNVLFEGFPEINSS
FT                   IDSPSNVFQINGEDNKNHIYNYILSPSNTESRDEDNKLSEHPVNDFTPKQPNNRTLGNR
FT                   KRPADIDNIQAFKEWMVENGHQFGVDLSTKFINEFLGLETTMLKKNKETGEMEEVERDK
FT                   LLPSVLNQLYDDEFVLEKLKNRAGYNVMLLPIGEETETVGTITITIDDDESNENENDEV
FT                   DEDKSNHVSGKTRGIKDLSIEELKQRVRQSKKNSTKPDRREVNTETPKRDPYISELAKR
FT                   MAKGVCQLCGNNAPFYDRGGNPYLETHHIIRVSKDGDDTIDNVVALCANCHRKMHILNL
FT                   DYDKDKLKKIAKKQSVL"
FT   gene            326590..327507
FT                   /locus_tag="Metev_0336"
FT   CDS_pept        326590..327507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0336"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00440670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73262"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6P0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73262.1"
FT                   /translation="MMKENDCILKSKVLNAILSGNHTCKSIYLMIDYMGSYSSFRVALN
FT                   YYVKKGYVNKIGCSKPYQYNLTKKGVKHAYNPFLHRNNFYSFVEKKANEKAIKLLEDDN
FT                   RIKEIVQKLVDDTHEVNNNFEYMGNSLFNENRKLKNEIYRLKFDRNLKIEKVKVQTQNE
FT                   ILNMLGYNNLNELYSNIKGHKNKSKLSETEFKRRMNLIKRFNKRYITKQFFDELKYYKP
FT                   YFSPSTFEIKILPISYGKQVVKDGFFRELNANEILKFKMYVIVSSDEGKFSIISQKIGK
FT                   LADINLKNNTGKQQKRKINPKDRS"
FT   gene            complement(327605..329314)
FT                   /locus_tag="Metev_0337"
FT   CDS_pept        complement(327605..329314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0337"
FT                   /product="Restriction endonuclease, type II, AlwI"
FT                   /note="PFAM: Restriction endonuclease, type II, AlwI; KEGG:
FT                   bha:BH4001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73263"
FT                   /db_xref="GOA:D7E6P1"
FT                   /db_xref="InterPro:IPR018573"
FT                   /db_xref="InterPro:IPR037264"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6P1"
FT                   /inference="protein motif:PFAM:PF09491"
FT                   /protein_id="ADI73263.1"
FT                   /translation="MTSIGNTKTLFFFTSPRTPIKMIDEIELLVNNFEGQNWNPKTQES
FT                   YALTLKNSNFFEGKIKNNLSFAARDRINRAPKALGFVNLKPIELTNAGARLLSNKRINE
FT                   IFIRQMMKFQLPSPYHTDNSGRFYVRPYLEILRLIYELDGLTKHELAIFGLQIIHIDYY
FT                   ELIKTEIQNFRLEKSKKFYTRKKEYIQESYIRAIEKIYADEINQKNFKTRETDNNDYRQ
FT                   FINTKRRNIIDYADAAIRYLKATELVSFDVNSLKLTITHDKKDDVKFLLDNVPREPVYI
FT                   NNENEFKNHLFDANNIILYTDNKEETTKKIFELYKYLYKKLPKGFIKKVRNLHIEELKD
FT                   LKDKLEQDKIDDVLNKQINSLKVTDDFNDIINVYDSIIQGEVADPPLIFEWNTWRALVI
FT                   LDDGNINGNFKIDTDGSPLFSAPPKYPDISCYYNEFNLIVEVTLSYGEKQYDMESEPVP
FT                   RHLGDFSKSSDKESFCLFIAKNVSEGTLAYFYGLNNIEISYYGGKSKIIPMDLNSFKAF
FT                   LHHANEKDNIESNQLHSYLKYLIEQTNSTENEIEWYKTIKNTVTNWTEVISN"
FT   gene            complement(329319..330101)
FT                   /locus_tag="Metev_0338"
FT   CDS_pept        complement(329319..330101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0338"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   vpa:VP0394 haemagglutinin associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73264"
FT                   /db_xref="GOA:D7E6P2"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6P2"
FT                   /inference="protein motif:PFAM:PF01555"
FT                   /protein_id="ADI73264.1"
FT                   /translation="MNHYKKLYYTSQEGKVKLYQDDALDFIKGLPENSVDIIVTDPAYS
FT                   GMNQKMKFGNGRIVGEYKNENNNKWFQEFHDTEDNYRYFLSQCYKVLKDNSHIYIMFDS
FT                   YSLLSLGNLLREYFNVKNIIVWDKVNMGMGHYFRRRHEFVIFATKGNKKLISRSIPDVW
FT                   RFKRIYNKCYPTQKPVELFEAMLAGSVDNENLTVCDPFVGSGSSAIAALKKNCNFIGND
FT                   TDEKALKTSSERIDSFLKTENDIYQKKPSNMPGDKIFW"
FT   gene            complement(330477..332807)
FT                   /locus_tag="Metev_0339"
FT   CDS_pept        complement(330477..332807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A1490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73265"
FT                   /db_xref="GOA:D7E6P3"
FT                   /db_xref="InterPro:IPR018723"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6P3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73265.1"
FT                   /translation="MKNKAMQKWFCSYIKDTFQDKYIISILLAMLPIYLISIISINHLF
FT                   NILNINLSIDITIFALSSYTFYFIAVIGLLIDRILKKIDKNLYLWLRQITILTLLILFI
FT                   IYLPTLLTPFDEFLPIKANSAKYMISSLVQSEAAIIALVITLSLVGIQYSASSYSTKII
FT                   DIFSKKPDMWILIVIYLGSIVYGLYILKGIPETNINSSIEENVIRLFFINLIAFIYLLF
FT                   YINSTLKLFKSSNLILWFGDKITPKSINDNLISTNLNFNEDNPYQKVIDITKSSIRNQN
FT                   INTVKLGVLSIIDYKQYIINNDYFTDEEIIQIKSKLETHLEDLLLYSIKNNQISTYTKI
FT                   LDYYFLFIISTIENNNKEIIDNQLNQFYSTILNIGYEAIDKPSCITFITYLLNRISFIS
FT                   GNLGNPENNKKYVLNVIKTLEYLIIEASKKDMFYLMLIIVKSIKDFDLENLNIENKNTK
FT                   SENNEPLSTDTFKYIIDRLIKQNQYDIATYIVNLMLSINDEYNISTNDKIDLIKPISKP
FT                   FIEAHYELGVTYISTKIKDLYISEIEDNQDNVKYICYNLNSIIIDCLNYNFNVAAFSII
FT                   EKYKESSEKITNERFINANYDVKYLNNELLYGLNYLILNTEAQKGEVLNFISEVVKNMA
FT                   YEYIDKCLYDNSKQAIRLLENISILASQKKCDYTMDIVNNLKNVEVKAINEYSFNCIND
FT                   LDQIFERIGYEVIYHDMYDITEFIIISLKNITIKLYNHNISHIAKKSEKSFEKLYSKAM
FT                   DKDYPNLSKIDNAYQEMKNNIYI"
FT   gene            complement(333029..333975)
FT                   /pseudo
FT                   /locus_tag="Metev_0340"
FT   gene            334094..334165
FT                   /locus_tag="Metev_R0010"
FT                   /note="tRNA-Thr2"
FT   tRNA            334094..334165
FT                   /locus_tag="Metev_R0010"
FT                   /product="tRNA-Thr"
FT   gene            334266..335441
FT                   /locus_tag="Metev_0341"
FT   CDS_pept        334266..335441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0341"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mac:MA3794
FT                   integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73266"
FT                   /db_xref="GOA:D7E6P4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6P4"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADI73266.1"
FT                   /translation="MDIYGHDRKLENVEKRIRDADYSEDNKSLIFEFENRLFAEGLETS
FT                   RVLKYMSQMNMISRWFGKNLADVDEKDVEQLVGSLERSSKKYSTKRDYKITIKKFFKWL
FT                   YRSEKLEMVDWIPTKKSRENDKLPEDMLTPDDIKKMVDAAGNARDRAIIYTLYESAARI
FT                   SELANMKMRDVKFDEDGALIHLDGKTGPRTVRVAYSVPALGTWIEMHPNKNDKDAYVWI
FT                   NIGSRSKGQPMKYSSFQRLIKRTAKKANIDKNVHHHLFRHSRATELSQIIEQPLLEKFM
FT                   GWVHGSGMTSVYLHLSDEDLDNAICNMYGRDNRKSKEPALKPQFCPFCDKPISPTSQLC
FT                   TNCGKPLNAETAIDLDEKRKQVADVMQLLISDPELNQLVQEKISEVKENDI"
FT   gene            335489..335764
FT                   /locus_tag="Metev_0342"
FT   CDS_pept        335489..335764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0342"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sul:SYO3AOP1_0436 ribonucleoside-diphosphate
FT                   reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73267"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6P5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73267.1"
FT                   /translation="MDLEKLIESCGYGIHSKRSKYEYNKNFDSNVEVFESTYMNKDRNY
FT                   KDIIEPEFSVHMEQPGFGKTESMIDYIKSNPNEKHLILGPSHAFLE"
FT   gene            335984..337063
FT                   /locus_tag="Metev_0343"
FT   CDS_pept        335984..337063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0343"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pbe:PB000501.01.0 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73268"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6P6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73268.1"
FT                   /translation="MPIHFLFYVDIDFNSFDNIFIEETINNNNLRKQSQVDYLKEIFKL
FT                   NNGNKNIKHLLNNIRDCILDYDYEKFSELQNDFSSVIYEHNRSILNDDRKRKMDFCNIN
FT                   TNELFFHLLFNRTSNPNPQTACEWLIFYKQMESGKNIVYNSASFRKHQFFHHLRMFREI
FT                   FPQYSPVIRLYHTEHSNPNTHIIRMTKDRAIYKSWMLSYFDDYSDRLWKLVKNKRYNQN
FT                   KDVCFLTYKYLIENKLDKHGLTKENTIFGSQAFWFGAGHGINTYEGFDVLIVFGDHLAG
FT                   SQHYREYFLAYYPRDDLPNFDDVDKGIPQDRRLLEQFYAFQLDIYDAVHRLRPLKNNIT
FT                   IYWFGLYIPPELLNEFSVV"
FT   gene            337305..337445
FT                   /locus_tag="Metev_0344"
FT   CDS_pept        337305..337445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73269"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6P7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73269.1"
FT                   /translation="MEEMLNKKKETIRELAELDSEKLTKFSDIEKAVILACRELVNKGA
FT                   V"
FT   gene            337669..337932
FT                   /locus_tag="Metev_0345"
FT   CDS_pept        337669..337932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0345"
FT                   /product="putative transposase IS891/IS1136/IS1341 family"
FT                   /note="PFAM: putative transposase IS891/IS1136/IS1341
FT                   family; KEGG: fma:FMG_P0027 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73270"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6P8"
FT                   /inference="protein motif:PFAM:PF01385"
FT                   /protein_id="ADI73270.1"
FT                   /translation="MVRKEGQNCRNLRLKIYPTPEQERKLDDTLECCRSIWNHLLSLQV
FT                   DLYDRFGLSVKRSDLEKKPEKSGLSYTFFRKTGCIPAIMFCL"
FT   gene            337949..339010
FT                   /locus_tag="Metev_0346"
FT   CDS_pept        337949..339010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0346"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: mma:MM_3038 transposase; TIGRFAM: transposase,
FT                   IS605 OrfB family; PFAM: putative transposase
FT                   IS891/IS1136/IS1341 family; transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73271"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6P9"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADI73271.1"
FT                   /translation="MKKGRLKNTKPKKGMFVKRKDVPCGNNSSGFIKYDGILPKGHPKF
FT                   KSRDDFTSFRYKQHGNGWNLDGNWLYLSKITGKSNPIKIDIDNLPDGELKTCTLKKEGK
FT                   QWFVYLTVELPENPTPSTPTNAVGIDLGLKSFITTSDDDFVEPPRFLRKAEKRLAKEQR
FT                   KLSKMEFRSKNYQKQKQKVNRIHRKVASARNHFSHCLSKLLVEKYDLVVFEDLKIKNLI
FT                   KNNRLAKSISDVGWNKLVQHVTYKAAERGKIVDKVNPNYTSQVCSHCGRKKKEKLKLED
FT                   RTFYCSNCGLEIDRDLNAAINILTKSSYYNPKWHTVGLAGINGCGYGTSTSGLGISSQV
FT                   PSMNQQMLNLVIG"
FT   gene            339455..339847
FT                   /locus_tag="Metev_0347"
FT   CDS_pept        339455..339847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0347"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: gme:Gmet_2649
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73272"
FT                   /db_xref="GOA:D7E6Q0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6Q0"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADI73272.1"
FT                   /translation="MFKRIDHVEIIPTDFEKALNFYQDVLNFKLWQRQEVDMPPLQQIA
FT                   YLTLGDTMLELLQVEGNKESIVNYWGIGYRMMALEVDDMDEAVEYLENQNVKVTWGPID
FT                   LGGTKRAEIQDPDGISIELREWSNKS"
FT   gene            339956..340384
FT                   /locus_tag="Metev_0348"
FT   CDS_pept        339956..340384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0348"
FT                   /product="putative cytoplasmic protein"
FT                   /note="manually curated; KEGG: sat:SYN_02962 putative
FT                   cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73273"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6Q1"
FT                   /inference="similar to AA sequence:KEGG:SYN_02962"
FT                   /protein_id="ADI73273.1"
FT                   /translation="MQTFLPYPSFIDSAKSLDSKRLGKQRVEAYQILKNLVRERDRWYN
FT                   HPAVQMWLNYEEALKLYYDTILIEWIKRGYENNMPFMLVSRYKLVFPEWLGSKDFHDSH
FT                   KSNLLRKNYGYYSRFNWNVSDDYQYVWPNRKGNYQDDG"
FT   gene            complement(340369..340668)
FT                   /locus_tag="Metev_0349"
FT   CDS_pept        complement(340369..340668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0349"
FT                   /product="Subunit of heterotrimeric Replication Protein A
FT                   (RPA)"
FT                   /note="KEGG: ppa:PAS_chr4_0034 Subunit of heterotrimeric
FT                   Replication Protein A (RPA)"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73274"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6Q2"
FT                   /inference="similar to AA sequence:KEGG:PAS_chr4_0034"
FT                   /protein_id="ADI73274.1"
FT                   /translation="MVKNIKVVSDGFSFTIWIDGEIIENVLKISVVQGTALPKDSNDET
FT                   ITTISYGGYDPEDFMNIIEGPYSYSYLKSSGKKKDIDKETIDIYGEVMYYYPSS"
FT   gene            complement(340704..341291)
FT                   /locus_tag="Metev_0350"
FT   CDS_pept        complement(340704..341291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA2361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73275"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6Q3"
FT                   /inference="similar to AA sequence:KEGG:MA2361"
FT                   /protein_id="ADI73275.1"
FT                   /translation="MDNQSLKQQIEDACNNLNQFFNNIAVLLKDCDRLMAEEGYTPFNG
FT                   NTASYEISRSILNPEGWYPSYFSRAYVPEESSGYEPVDKVLFISIFLRYGVAGCHDVFM
FT                   DDGTPLIVGGYIRPDDFDGFTYAGWLTKSWFWKDESNNISNANGEVYGTYKSFKNVKEI
FT                   KSFAYPLGNIKNTTDIKGKIIERLVQIDSDDF"
FT   gene            complement(341293..342201)
FT                   /locus_tag="Metev_0351"
FT   CDS_pept        complement(341293..342201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA2360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73276"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6Q4"
FT                   /inference="similar to AA sequence:KEGG:MA2360"
FT                   /protein_id="ADI73276.1"
FT                   /translation="MTFSEINEKPTYMHSEDLLTSDVFGCCSFLEYRDLLDYLLKMSTH
FT                   FASGNGFTQSREVISDNYFFWPRFKTDLSFIEPDVLIILWHSNNSCSLVIVESKYLSGK
FT                   SSEADYDIDNITDQLAKELMILETKSFYSQLSSLKRVHVLSEMLLYVSADNEFPEKSFI
FT                   KSANEYLTKTNTKANRETSSLPLYWLPWWRIENFIYSYLDEKSDDINLRKYRVLKHIRD
FT                   VLAHKNLSRFVGFRDLFLGSIQLPYSSASKIIEVGKGQSNFYNLSISLDFPVFYGKEEK
FT                   NNQYDFFVDNLIIDYQYNSEV"
FT   gene            complement(342296..344188)
FT                   /locus_tag="Metev_0352"
FT   CDS_pept        complement(342296..344188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcr:BCAH187_A1094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73277"
FT                   /db_xref="GOA:D7E6Q5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6Q5"
FT                   /inference="similar to AA sequence:KEGG:BCAH187_A1094"
FT                   /protein_id="ADI73277.1"
FT                   /translation="MNSGLTVIPSDLSSLRYGERKVANKIKQIYSDVDWKAYLYVQPSI
FT                   SNLEPDFILIDEYKGISIIEVKDWSLDKIDISKLNPAEVFVSGHRRENPFSKANTYFNT
FT                   VKNRLQKEPELIDEDYSLKYQVYSNLVFTNMQSEDLELIEPYIFKPPARCLTSDNLNDL
FT                   TFEELFGDDTRYIDDHDFNRIRSVFFPEIQVNSRQKEIWEFHRNNTKDNSIIKTLDTDQ
FT                   EKFSKRIPYGHYMVSGVPGSGKTVILVARAVHLARENPEWNILILTYNRSLKSKLKNIL
FT                   KSMHKDLDNMGVNYENIEISSFHKTAMKVANETTIPKPTPDNYWDELLPYKAINNVESM
FT                   YDAVLIDEYQDFHNIWLKLCLKLCRKHEYKGEYTENLFLAGDRLQSIYNPSTHNWKSLG
FT                   IHIRGRSKLLKTSYRSGSTHINLALEYLMKNSNTRSEVEKFYEGKDGICCNYDTENNVD
FT                   FLNGDFREINDYLKSLIYESQYNPEDILVLLPFKNLRDKLYRYLDEDLQKMAEVSKNIS
FT                   DNLMTITTYHSSKGVECKVCVLAEVDKLENSKMDNTKYTKLLYVGMTRASEKVMIQSSH
FT                   PENGTIFNELLNCYNDLMDDEVEVENQDVDTEKSTDGVTSEKRGIWSRIRKLSR"
FT   gene            complement(345153..346013)
FT                   /locus_tag="Metev_0353"
FT   CDS_pept        complement(345153..346013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0353"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73278"
FT                   /db_xref="GOA:D7E6Q6"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6Q6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73278.1"
FT                   /translation="MKWKSHRECTKVIAEDLGLDGDHVNSILEGCVYPDKVGFKDEGLM
FT                   GVPISFPHHKETNQRIYQILVNMRKMVLKGDGVSAFEIGCLAHLIQDRVTFPHAHPNFD
FT                   DFQNGVAKCRIKSKWREEDVPVLDARVLDELDNILTLNNPDDPEKALKEGYQETLLVLK
FT                   SVLQDSNLPDEYRPAYNDCKSKFKSLKKSRIFYWVSTYLNPLAPLYAMLDSKAIANSDM
FT                   VKRYAYVKKNVVWKGVVAVFAFLIAQDMFWSLLYGLPIFGQILTLRFKIPEEIERNLEW
FT                   YNFDD"
FT   gene            complement(346101..349358)
FT                   /locus_tag="Metev_0354"
FT   CDS_pept        complement(346101..349358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0354"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: mac:MA2358
FT                   ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73279"
FT                   /db_xref="GOA:D7E6Q7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6Q7"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ADI73279.1"
FT                   /translation="MLDSNLATLKPKQRQAVEHSEGPLLVLAGAGTGKTTTITTKIAYM
FT                   IEYLGVPPEEILALTFSRDAAKNMQQKVQELVGRRRDVNVSTFHSFCAELLREHPDECG
FT                   VSENFTIYEDMDMAIYLHRELGIDSKKAAHYSSSISKAKDLNLSMKDFEDYIDGKKEIL
FT                   YKFSSEGEWEQLYHDYKVNLNTFHLKDKSEQKALKEEKKSWQEFINVYDEYRKYQDFID
FT                   AWKSYEDKKSSINALDYGDLNYIALQYLDTYGTEELNDTYRYIVVDEFQDTNYLQFELI
FT                   KRLTAREQNVTIVADPNQSIYAFRGAYTDNIEEFKKQYDIHEDDIVAIDVSYRSTNKIL
FT                   RVSHELIQNNYSDDRKSECILLKNHEDNEGDNVVIQETLDDKEEARKIAEMVDWCAEEG
FT                   TPLEDIAVLYRTHSQGRVVKDTLQRRGFPVSVKENTDFLKLPEIKTALAYLYVLNNFTH
FT                   PTPRGTESWWRLFHYNNSLDRSDSIKIAEYIKNNRTTFQDVIYHHLDELGISDRGLEII
FT                   NSVKQSIAKLFEKTIYDISDLLLEIYDYTGLVRQFSGSDTIRNREALLNLRKLYENAET
FT                   FEQMHDRDLSGFIAYLEILDEMDGNPSAANITDDNAVNLMTIHSAKGLEFDTVFVINMA
FT                   DNRFPLKRGGKEPLIPYELMEQYRDIFESDFSSEKELNKAIDARKKQLKIEEERRLCYV
FT                   AFTRAKNHLVLTFSDEYNGSDSGPSDFLYDIGFDESFEDCDTLDDVTFYRDTENKAKEL
FT                   VMDDDIEREKQRRRELLMDSMGSGNITEPLKHLLVYQELVNKEDRDYLEEIKSNWSKIN
FT                   PLPEASEILDSCKSSKCSPKFKPDNLSFSYSSIKTYEECPKKYELQELLRMPDRSSEKL
FT                   GEAANIGSFVHKVLEIGVKRKVETKDQLYNIVYELAEKPDWKMIDLKKTYTLFDTFWER
FT                   HKDKIHYNFAVEKRFSVPIGGFYFKGFIDRVDFLSGCDTDVEVIDYKAGKTDPPTEDRA
FT                   RQLLLYAYGFNYLYPEYTVRRVTLEMLGKEKPRSFELNGAGVYESIIDRMTKPLDNNAI
FT                   QNMVETAKWIAHDYENGFEKTGDHRICENCGFRLYCQ"
FT   gene            complement(349418..349996)
FT                   /pseudo
FT                   /locus_tag="Metev_0355"
FT   gene            complement(350140..350436)
FT                   /locus_tag="Metev_0356"
FT   CDS_pept        complement(350140..350436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0356"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   hne:HNE_3468 putative nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73280"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6Q8"
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /protein_id="ADI73280.1"
FT                   /translation="MSRKNKHKKKVHWTDGDSGTFSDGTRFRLQNVRAPESGQKGGQKA
FT                   KRVAAGITGRSKNQVTVEEVGRDKYGRKLVKMKNKDGSINKRLRKKGYTDMGN"
FT   gene            350618..351217
FT                   /locus_tag="Metev_0357"
FT   CDS_pept        350618..351217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0357"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: mma:MM_0565 transcriptional regulator;
FT                   TIGRFAM: CRISPR locus-related DNA-binding protein; PFAM:
FT                   regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73281"
FT                   /db_xref="GOA:D7E6Q9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR010163"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6Q9"
FT                   /inference="protein motif:TFAM:TIGR01884"
FT                   /protein_id="ADI73281.1"
FT                   /translation="MTNRTLITTIFDVEPVILCITKFSPSKVILLTEEDAADKKVESIE
FT                   TIEKTFGSMIEIKRKYTSLYDHVQVASDVADLIDEEHDKGNQIITNVSGSRKTQAFGAL
FT                   YGAYARKDMVKRVVYVTEEDHEIIDFPILSFNISTTKKSILEQIQSGTSSVGDIAQKLD
FT                   ISKGMTYNHLRELKSLGYITDEDGYKITDSGKLAGI"
FT   gene            complement(351435..351551)
FT                   /locus_tag="Metev_0358"
FT   CDS_pept        complement(351435..351551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73282"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6R0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73282.1"
FT                   /translation="MSNKDNNIMLLAEAPTKVKVINQLVNYLNKKPLFFIKK"
FT   gene            complement(351551..352252)
FT                   /locus_tag="Metev_0359"
FT   CDS_pept        complement(351551..352252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0359"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   mbu:Mbur_0308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73283"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6R1"
FT                   /inference="protein motif:PFAM:PF01987"
FT                   /protein_id="ADI73283.1"
FT                   /translation="MTNYTVNEFLEQTKQSDHSEEKFGLERGRILIANLEDDKIWAKTG
FT                   SMIAYHGDIKFEREGITEHGIGKLLKSKLTGEEMELMKAQGTGQAYFAEDGKKISIIDL
FT                   KGESITVNSNDLLAFEDGLDWDVHSMKSIAGAVSGGLFNVKIEGEGMVAITTHYDPLTF
FT                   KVSKDKPIYTDPDTTVAWSGNLNPDINTDVSFKTFIGRESGESIQMKFEGEGFVVVQPY
FT                   EEIYYNTVSNQ"
FT   gene            complement(352367..353809)
FT                   /locus_tag="Metev_0360"
FT   CDS_pept        complement(352367..353809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0360"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tsi:TSIB_1098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73284"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6R2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73284.1"
FT                   /translation="MKGNIKKSIISVALIALLAISIPLQVYGASDEKVEDYMIYDSHQG
FT                   AVVEKQMSVDLEDGTQWITINTTSSLDFDKLRLSESNIELEPINSENVEVTEIKLNTAN
FT                   GFEENIGEEITVVFSSDQNITGKLVRTEGMNIVMDTDEGISYINRENINRMITENGNSP
FT                   DVKAKIKAQTEGDYEFKLKYRMEGVTWNPSYELMLNDGPQSESEFEGDIVIQNPSGKTF
FT                   DGQVNLISGDVRSGRVILPEYGDSMGSGAEAFKSTAVGDLQTIGRVNLYNLGMYTIDSY
FT                   SQKSINYMNDNVDTDVNHVYKSSAHSDHSRTVSKQLTFDNNMKDLPEGRISIYRNHNGS
FT                   EVMVGSDFIERTAEGNDVEIDLGKSYDIEGSTKVLDAQMNQNNITREINITITNHADET
FT                   REVTVEHQWINGEIIDTNIEPAETLVDKAIWKIEVDANSEKNINFKSIEQKFDSRVEGT
FT                   ETSSTAVVKGSESASGSVSVER"
FT   sig_peptide     complement(353723..353809)
FT                   /locus_tag="Metev_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.977 at
FT                   residue 29"
FT   gene            353996..354181
FT                   /locus_tag="Metev_0361"
FT   CDS_pept        353996..354181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppp:PHYPADRAFT_3971 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73285"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6R3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73285.1"
FT                   /translation="MGIRCSINTSHIKKDLFSISITGSICTSHTIIISENIKLLDHIPY
FT                   INGKYALTEQYLSDSL"
FT   gene            354332..355156
FT                   /locus_tag="Metev_0362"
FT   CDS_pept        354332..355156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0362"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hmu:Hmuk_1610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73286"
FT                   /db_xref="GOA:D7E6R4"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6R4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73286.1"
FT                   /translation="MDINIRTILAGIGGVTGIGAVISFLQTELFSSPVTTSIALIAVGI
FT                   LILAITHRTEDKAIRNIGVIICSFSIIASVLYGVISLTSGTLTVTLSLAILTTGFLTAA
FT                   YISQTERKILTQKKLSVLSVIFLCLFAFTAVVDAVVSEPEYNLELEETITEVESTDYRS
FT                   NYIVGTLTVSNPSFLPLDTERQSYRACLTGVDFGNDTEDAEEIERVLVDMRLQTERIPD
FT                   PLFFSTKVDVLFGAGFADRLEEVGVSVTDIPVVGDTRCPDSTEQPQLTIITA"
FT   gene            355255..355740
FT                   /locus_tag="Metev_0363"
FT   CDS_pept        355255..355740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hla:Hlac_2076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73287"
FT                   /db_xref="GOA:D7E6R5"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6R5"
FT                   /inference="similar to AA sequence:KEGG:Hlac_2076"
FT                   /protein_id="ADI73287.1"
FT                   /translation="MSSLLLFINQVAGWFLFAIILIIPGIIAATFWTPFLVSERLRALF
FT                   RKLPPTNSVFSSYIIAGISASLPYIIGFLVILAVGDVDNTQVSNSLITMSLLLFMVYTI
FT                   GLPFIGVILLPRIGVDWDPHNYSVSTWILLAAGGAWYAILFTIPLAAFAFLLALPTG"
FT   gene            complement(355763..356047)
FT                   /locus_tag="Metev_0364"
FT   CDS_pept        complement(355763..356047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0364"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A0817 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73288"
FT                   /db_xref="GOA:D7E6R6"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6R6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73288.1"
FT                   /translation="MEKLTYKFLIPIILGILISVYGIILGYPINVLIAIIFALLFAFWL
FT                   WVLVDCATREPSQDNDKLVWVIIIVFTHFIGALLYYFIRRPKRKAEFGE"
FT   gene            356332..357564
FT                   /locus_tag="Metev_0365"
FT   CDS_pept        356332..357564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0365"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: csc:Csac_2480 IS605 family transposase OrfB;
FT                   TIGRFAM: transposase, IS605 OrfB family; PFAM: transposase
FT                   IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73289"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6R7"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADI73289.1"
FT                   /translation="MYLTQKNHLRTDKQTYETLKRLTKLSKNLYNFTLYTIRQYFFNYG
FT                   KYLNKNTAYHTVKENENYRLMPSQVAQNTVETVDGSMKSFFKLLDKKRKGEYEKPVSLP
FT                   KYLDKDGNFICTFKKDQLKVIDDKIRLSLGPEYGRTYGTRFLYFKIPDNIIGQYINQVR
FT                   IVPKYKGRWFEIEYVYHEDGEIAELDYNSHLSIDLGVDNFATCVTTSGTAFILDGRGIK
FT                   SYNRWWNKEKSRLQSVYDKQNVDDGIKMDRFSNKRFWKINDFMNQCVNHIVKHCLENRI
FT                   GNIVIGEMKEIKQEQNIGKKNNQNFQTIPFARFKQKLVSKCEYHGINYHEVNEAYTSKV
FT                   DALALEPIRKHNKYLGKRHKRGIFQSSTGRLINADINGALNILRKVIGDSLAGIVDSGD
FT                   VNSPGRIRLSR"
FT   gene            358156..358590
FT                   /locus_tag="Metev_0366"
FT   CDS_pept        358156..358590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tws:TW809 integral membrane virulence protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73290"
FT                   /db_xref="GOA:D7E6R8"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6R8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73290.1"
FT                   /translation="MNKNENRVLAGLFLIIMGTFLKWHEFMEYYRAYGPSGIGEVSQRV
FT                   SGTVAGYDLTAGKFIFALSLILVVLVFLPKPALYHKRLLSAEFFLTSVIAGLFFIGGLI
FT                   PVFTPTQNIGPGIGLAVLLAGCVITLVYIKKDLNSFNSDI"
FT   gene            complement(358680..359929)
FT                   /pseudo
FT                   /locus_tag="Metev_0367"
FT   gene            359987..360384
FT                   /pseudo
FT                   /locus_tag="Metev_0368"
FT   gene            complement(360552..360836)
FT                   /locus_tag="Metev_0369"
FT   CDS_pept        complement(360552..360836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0369"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nph:NP0988A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73291"
FT                   /db_xref="GOA:D7E6R9"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6R9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73291.1"
FT                   /translation="MIEKLNYTLDKNLNSSKFYGDYMNDTENVLQKTLGNILSAASMLV
FT                   FSIIALFLATYMVEYVANSANYQVVGNYILLSASIITGSAVIAGNLSQK"
FT   gene            complement(360921..361088)
FT                   /locus_tag="Metev_0370"
FT   CDS_pept        complement(360921..361088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hoh:Hoch_3383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73292"
FT                   /db_xref="GOA:D7E6S0"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6S0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73292.1"
FT                   /translation="MGFNIYSKVLEDFSKKNTIISITIILALLIVILDIIVDFTDPEAS
FT                   LTVFFYSPYI"
FT   gene            complement(361189..362688)
FT                   /locus_tag="Metev_0371"
FT   CDS_pept        complement(361189..362688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0371"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: mbu:Mbur_0262 PAS/PAC sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73293"
FT                   /db_xref="GOA:D7E6S1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6S1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADI73293.1"
FT                   /translation="MNPLAYKFKKYVIVFILTVLIVSSIAFYVPIEQTVVQNKKDDIEH
FT                   DIRLNFNDMEYTIGSYEGKVIALTNRLMLRKKLLSYHQGNLSLKELRDCTQPKYSLYGS
FT                   LAYDDILASKRTTFNNTRVAHYGNLTFFNRYYETDKKFDVINEDDQTILYIKKPIMSND
FT                   SLLGYEVCLFNTTDFFEKYECNHKTNCIDYNIVKTEKLEEYNNSKDKKIYASKLEGREY
FT                   YLVASYDEDLLDEGLGTINIYMFSFILILIVTLLPLSYFTLFRESKEIIDQYEKSNEFK
FT                   DTFTDIIRHDLLNPASIISGYAKLLINKESDTSKIQMLKKIQSSNDKIIELLENASEFA
FT                   KLENTENIEFENRDIVEIIRKIVDDFQFQLINKNLKTEVLAENEHLCRINPMIEQAIAN
FT                   LLSNAIKYSPENSTIKIYLTDKGNFWRINVADFGEGVPDEDKPHLFDRFSRKDKKGIKG
FT                   TGFGLAIVKMVVDLHGGYVGVDDNPEGKGSVFWFTLVKSTE"
FT   gene            complement(362739..363254)
FT                   /locus_tag="Metev_0372"
FT   CDS_pept        complement(362739..363254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0372"
FT                   /product="CheW protein"
FT                   /note="KEGG: mba:Mbar_A0990 CheW protein; PFAM: CheW domain
FT                   protein; SMART: CheW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73294"
FT                   /db_xref="GOA:D7E6S2"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6S2"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ADI73294.1"
FT                   /translation="MAQETVETDAYIDGQENESMQLVVFQLGGEEFGVDIMQVQEIIRM
FT                   HQGTRIPQAPDYVKGVINIRGNIIVVINLEKILELPIKEEDDDNRIIVVEIGGNILGMT
FT                   VDSVSEVLSIAKSNVEPAPDMITSKINSDFIKGVGKLDDRLLILLDLENVLTIKQLADV
FT                   SEVSAARG"
FT   gene            complement(363286..365409)
FT                   /locus_tag="Metev_0373"
FT   CDS_pept        complement(363286..365409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0373"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: chemotaxis
FT                   sensory transducer; PAS fold-4 domain protein; histidine
FT                   kinase HAMP region domain protein; KEGG: dps:DP2360
FT                   methyl-accepting chemotaxis protein; SMART: chemotaxis
FT                   sensory transducer; PAS domain containing protein;
FT                   histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73295"
FT                   /db_xref="GOA:D7E6S3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6S3"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADI73295.1"
FT                   /translation="MFNLFGNDNETKQDVVKVANNIQDGKLDARLDTQNGVDRETAHSV
FT                   NSMLDNLTKKVSDTESKAEIIELLPTPIMTIDKEFTVTFLNSSGAEVLDMGQEECIGKK
FT                   CYELFKTPHCNTGECRCDQAMRTGSVGTGETICDPKGKHIPIQYTGAPLKDSDGNINGA
FT                   VEYVVDITDTKKALDEAKQKAEYLNNVPTPVMVIDKNMNVQFMNNAGAEAVGKTTEECE
FT                   GKKCYNLFNTGHCNTENCQVAKAMQKDGTFTDDTVAKLPSGELPIRYTGAPIKDNKGEI
FT                   VGGLEYVIDITEENQAVSEVEGLVDDALNGKLSTRGNPDNYDIVGFRNVIKGINNTLDA
FT                   IVEPLNETKRVAEAIADGDLTQSINVDTKGDLKEFADTIEEMQDNLKNLVENIKESASQ
FT                   VSSTSEELSASSEQLTSSANQISDTITEITNGAQNQSTKIQEVSSTMNDMSTSIQDVSS
FT                   NAQKTSETVTEVNKLVNEVGEQSKELKSKMENIQTTSEQTSEVVRELDNKSKKIGEIVS
FT                   MITNIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAEESSNSAQQIGDLIQEIQ
FT                   NSTGEAVSSMENSSQEIENGSQALDETVNSMSNVVGKTSEADNMVQDIASSAEELSASV
FT                   EEVTSSVEEVSSIAEESSSSTEEASASVEEQTSSMQELSKSAQDLNQMAEELNQSVKSF
FT                   KVDSSDKKDKNSK"
FT   gene            complement(366015..367115)
FT                   /locus_tag="Metev_0374"
FT   CDS_pept        complement(366015..367115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0374"
FT                   /product="histidine kinase"
FT                   /note="KEGG: mbu:Mbur_0262 PAS/PAC sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73296"
FT                   /db_xref="GOA:D7E6S4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6S4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADI73296.1"
FT                   /translation="MNYEITYKPELPDLKDNIIKDLPDNFVVIDTDGTILYVNDSWRDF
FT                   ARDNDLPPEHCSEETNYLTVCDEATGENSEEAPIAAEGIRNVIHGKREYFELEYPCHAP
FT                   NKRRWYIMKVIPLKDEKPRPVLAYHLNITKRKLSEIELEKLNETREMFSDILRHDLKNP
FT                   VGISKGFAEILYKNETDPKKLEIIEKIINNNNRAIDLIEKAGDLARVECMDHIEYEHLD
FT                   LGHIIENVIDSLQDKLTDKNMNIVFVNQGGYYAYVNSIIEQAFSNLISNSIKYSPENSE
FT                   IIVDIVDDNDYWKIRVIDSGPGIPDDEKERLFDRFKRGSGEKSLGKGIGLSIVKNVVEL
FT                   HGGNIGVEDNPEGKGSMFWITVKKAD"
FT   gene            367849..368448
FT                   /locus_tag="Metev_0375"
FT   CDS_pept        367849..368448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0375"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="PFAM: PAS fold domain protein; PAS fold-4 domain
FT                   protein; KEGG: mgm:Mmc1_0232 multi-sensor hybrid histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73297"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6S5"
FT                   /inference="protein motif:PFAM:PF00989"
FT                   /protein_id="ADI73297.1"
FT                   /translation="MQNYSELLSTTELLNSVFESIKEGVCLHEIIYDSNNNPVDYRIID
FT                   TNPAYESIIGLKREDVSGKKASDIYGTIEPPYLHLYAKTAETGEKAYFETFFPPLNKHF
FT                   SISVISPGRGMFITIFTDITGQKNIDKELEAIYENSPVVSMVVDSDRRIIKMNKSAEQF
FT                   AGAISDEVKGMKGGDALRCLHSLDDPDGCGFGPHCK"
FT   gene            368527..371040
FT                   /locus_tag="Metev_0376"
FT   CDS_pept        368527..371040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0376"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-3 domain protein; PAS fold domain
FT                   protein; GAF domain protein; KEGG: mac:MA2294 sensory
FT                   transduction histidine kinase; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   GAF domain protein; PAC repeat-containing protein; PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73298"
FT                   /db_xref="GOA:D7E6S6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6S6"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADI73298.1"
FT                   /translation="MIGGCINHLTFLLSTSPIKVENESKVLVNFLDISERKKVQEDLRK
FT                   EKKFFERVAETSPISITHLDKSGNIIYANHTAEKVLGLSKNDINRRTYDDVKWKITDYD
FT                   GNDFPQDELPFELVKKYHQPVYDVQHAIEWKNGKRIYLSINAAPIFDKYGNFDGMIAAI
FT                   EDITKQKNTESNLEHALYNSHEREKEINELLNATRTILEVNDFNTAARYIFDSCSRLLG
FT                   AKAGYVSLLSDTGDENEILFLEDGGMPCSVDIDLPIPVRGLSAEVSRTGDVVYDNDFMN
FT                   SNRVKYMPECHMNLPNVLISPLTVDGKTLGFMGFAYKEGGFTDNDAQLAKTFGEYAAIA
FT                   LKNSKAFQALEKSEERYRSIFETAASLITSVDENGTIVDCNNQIKNILGYEKEEVIGQS
FT                   MTKIIHPDYVNKSFEILHEILNYGFSYNKEYKMVRKDGELIDVLINSSGVDKINGNYSR
FT                   TICIINDITKSKEFEHELKKSEEKFRKVTEQAADVIIAYDFDGNILYVNNLACEKLGYT
FT                   KNELLSMNITDIDPENNIETYRKYWYGLSQNNSVHIETSRKRKDGSVYPAELRMTLIDL
FT                   NGKPVILGFSRDMTVQKEAEENLINAKLEAEAASQAKSDILANVNHELRTPLTSIIGFS
FT                   DVLLKGKAGDLNESQKMYLSRVHNNGKHLLDLITDILDLSKIESGKSGLNYERISIIEL
FT                   VNDLKEYIQPFVSNKVLILHSRVDSGLNYIYADYIKIKQILSNLLYNAVKFTEEGSITL
FT                   EVSQNEDDVQFSVIDTGIGIPKGSHEAIFDSFKQLDSGPARKYQGTGLGLALVNKLVNM
FT                   HGGQIWVESEIKKGSRFTFTIPDNR"
FT   gene            371320..371808
FT                   /locus_tag="Metev_0377"
FT   CDS_pept        371320..371808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0377"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mno:Mnod_6310 FG-GAP repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73299"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6S7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73299.1"
FT                   /translation="MDKRKLIIGAILVITFIFSISATTADDINSIGQKATKGFEGFENL
FT                   PHGNPEYTRSLSVTDINNDGIKDIVVYKHGVNYLYEGTETGKFEGYKIHDNSDHTNSLS
FT                   VCDINRDGNNDIMAGNDGINYWYEGDGTGEFTRNVARKPTVLTVGGIATVGICIFVQV"
FT   sig_peptide     371320..371397
FT                   /locus_tag="Metev_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.487 at
FT                   residue 26"
FT   gene            complement(371755..373071)
FT                   /locus_tag="Metev_0378"
FT   CDS_pept        complement(371755..373071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0378"
FT                   /product="HNH endonuclease"
FT                   /note="KEGG: ate:Athe_2426 HNH endonuclease; PFAM: HNH
FT                   endonuclease; SMART: HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73300"
FT                   /db_xref="GOA:D7E6S8"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR025938"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:D7E6S8"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ADI73300.1"
FT                   /translation="MVFVLNKNKKPLTPCHPAKARILLKAGKATIHKKYPFTIRLKELK
FT                   SDDVKDDFRLKIDYGSRYTGLAILKNNKDVIWLDQVHHRTDIKKKLDDRRNFRRRRRSQ
FT                   NLRYRKPRFDNRKKPEGWLPPSLQSRVDNIQTWITRLRELVPINCLSYENVNFDTQLMQ
FT                   NPEIKGVEYQQGTLQGYNVREYLLEKFQRTCAYCGKQDVQLEIEHIVPRSRGGSNRVSN
FT                   LTIACHDCNQRKSNLTAEEFGHPEVYEKAKKPMKDAAVINATKDKVLDVLKNTGLPIEC
FT                   GTGALTKMNRIKLNLPKDHHFDACCVGESTPDELRFKTNSVLHIHAKGRGSYKRCKLDK
FT                   YGFPRKPAPRIKYIFGFQSGDIIKAIVEKGKYKGTWKGAVACRSNGYFDIKNGTKKIAQ
FT                   GINHKYFKLVQRFDGYTYQLDRLNLNKNTNTDGRNSSHC"
FT   gene            373348..374052
FT                   /pseudo
FT                   /locus_tag="Metev_0379"
FT   gene            374167..375279
FT                   /locus_tag="Metev_0380"
FT   CDS_pept        374167..375279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A3443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73301"
FT                   /db_xref="GOA:D7E7V9"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7V9"
FT                   /inference="similar to AA sequence:KEGG:Mbar_A3443"
FT                   /protein_id="ADI73301.1"
FT                   /translation="MNNKQIPEFICKIFLMILLLVAFSTVSAGYESSNAKISNIYSDIN
FT                   SCDVTIKSETTIQNLILSLQLFDDGNFVDEKRLFIDELEPESKNIRVVSWDIKNPDESS
FT                   YKVSARLIQNSSIVDSKNHSFHFGSPAIPRITVDDVVSDSNGLNLIVNPRESVIADIEY
FT                   MLVNGSEVIYTAEDMKVSIHSRSVELRKRWGVILKNNRVYHGRLKINLHTPVNDVHAFM
FT                   TSFTAKDNAVITDIYKDEVGSSVTIAGKSQVPFSGYLEFRVLKNKSGSVKVVESAVKKS
FT                   PVLLDGEDETVEVIWNNTLPKGIYKLTVELVGNDGDLIDKKETIIESDYRQTSDKKDEE
FT                   KEAGKPVPGFLIFDSLMIFTTIAVMYWIRK"
FT   sig_peptide     374167..374256
FT                   /locus_tag="Metev_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.595 at
FT                   residue 30"
FT   gene            375293..376450
FT                   /locus_tag="Metev_0381"
FT   CDS_pept        375293..376450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0381"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   mba:Mbar_A3444 putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73302"
FT                   /db_xref="GOA:D7E7W0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7W0"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADI73302.1"
FT                   /translation="MHYELFIAIKYITSRKRQTFLSVGAIGIAVMMIVISQGFMAGFTE
FT                   ELYDTTVDELAHVTISPEDGNNYIHLYKNLINSVGKIEGVTGVSPYLTGEAIVKHKDDT
FT                   QNVILKGIVPERETEVSQINRDIIKGNFSELKYTKNSIVVGDDLLPEINAKIGDVVDAS
FT                   FPDANPVSLKIVGVYDTGSDDDRDLIYTSLKTAQDFYGTSDVVNGVSLRIRNVNNDRKI
FT                   ADNIQKMGYEASGWTETNPEILRTIAIETMSNNIMLGLIVIIASFGVVSNLNMTVLEKK
FT                   KEIGIFRAMGMGKSNIRLIFILESGILGLIGAVTGTIFGIIIALSIGNYPIPAGLYGGL
FT                   TSIPVVVRPLDVTITVTAVFLLNLIAGVYPAHKAASLNPVEAISG"
FT   gene            complement(376455..377621)
FT                   /locus_tag="Metev_0382"
FT   CDS_pept        complement(376455..377621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0382"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   mac:MA1674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73303"
FT                   /db_xref="GOA:D7E7W1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7W1"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADI73303.1"
FT                   /translation="MYEFAIAFRHISSRRRHSIFSVLSVALAIAMIVVLMSMVSGFRIE
FT                   LIDSTTENSPHIIVNPESDDEFIHLYRHLDKIIKQHEGVVATSPYFEKQVALDYKDNSH
FT                   GVKLKGVNPDAEMNVMHVDDDIIKGSFTDLSTIRNGIILGDKLAENLEVDLGERVDASS
FT                   PVSGSVSFKVVGIMDTGTPKDETLAYSKLDDVQDFSDENDVVTGIGVRVQDIYQADNIA
FT                   FYIEDNSAYEAESWLESNAEILELLNTQLVFSWILYTLIYITAGFGIANTLITVVMEKK
FT                   REIGMLKAMGATRSSILLIFISESTILGTAGVLSGCILGYLLAALIDAYSIQIPSEVYL
FT                   GLTTLPVNIEIMNFVYATVFAFIINIIAGVYPANRAAKLDPVDAIENA"
FT   gene            complement(377672..378352)
FT                   /locus_tag="Metev_0383"
FT   CDS_pept        complement(377672..378352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0383"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: mba:Mbar_A3446 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73304"
FT                   /db_xref="GOA:D7E7W2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7W2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADI73304.1"
FT                   /translation="MYNQYLIEIKNLNKIYSDGTEVKALDGVNLTIKHGEFMAIVGPSG
FT                   SGKSTLLHILGILDTPTQGSIIIDNKNITSMSDKERSKARNKMLGFIFQYHNLLPDFTA
FT                   LENVMIPLLISGYSKNEAKESAQNMLKEVGLEDRMYHKPGELSGGQNQRVSVARALVNN
FT                   PTIVIGDEPTGNLDTKTSDRIYELLRKLNRERGQTFILVTHDENMAKKTDRIERLIDGK
FT                   IVNS"
FT   gene            378400..378734
FT                   /pseudo
FT                   /locus_tag="Metev_0384"
FT   gene            complement(379060..379520)
FT                   /pseudo
FT                   /locus_tag="Metev_0385"
FT   gene            complement(379574..379873)
FT                   /locus_tag="Metev_0386"
FT   CDS_pept        complement(379574..379873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0386"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpv:TP02_0674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73305"
FT                   /db_xref="GOA:D7E7W3"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7W3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73305.1"
FT                   /translation="MQFLKYFYSKKLIISITLRLGLLILIIEGIIDYIEPDATYSSYNL
FT                   LIYVLIFPIFILFGITIANAMDESKKLNRVMKAIIDVNQIIIREKYRPSYTKNL"
FT   gene            380084..380500
FT                   /locus_tag="Metev_0387"
FT   CDS_pept        380084..380500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0387"
FT                   /product="Insertion element protein"
FT                   /note="PFAM: Insertion element protein; KEGG: mma:MM_2697
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73306"
FT                   /db_xref="GOA:D7E7W4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010332"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7W4"
FT                   /inference="protein motif:PFAM:PF03811"
FT                   /protein_id="ADI73306.1"
FT                   /translation="MNCPKCNSFNHKKNGKVNGRQRYKCHDCGYNFSVELKSTAFPQSV
FT                   KRQALQLYLEGLGFRSIGRFLGVSHVSVQKWIKKFGQELEDLKSENEMDIVELDELHTY
FT                   IANKKNIAGSGLLLIELGKNSSTARLAVEEQKRE"
FT   gene            380497..380766
FT                   /locus_tag="Metev_0388"
FT   CDS_pept        380497..380766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0388"
FT                   /product="IS1 transposase"
FT                   /note="PFAM: IS1 transposase; KEGG: mac:MA4107 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73307"
FT                   /db_xref="GOA:D7E7W5"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7W5"
FT                   /inference="protein motif:PFAM:PF03400"
FT                   /protein_id="ADI73307.1"
FT                   /translation="MKLWDKLKGIDIRQGMTDYWKAYAEFIPGDIHIKSKSETFTVEGY
FT                   NSIFRHFLARLRRKTKCYTKSLEMLKYSILLLMKYRNNELTMID"
FT   gene            381092..382018
FT                   /locus_tag="Metev_0389"
FT   CDS_pept        381092..382018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0389"
FT                   /product="Conserved TM helix repeat-containing protein"
FT                   /note="PFAM: Conserved TM helix repeat-containing protein;
FT                   KEGG: mbu:Mbur_0269 TM helix protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73308"
FT                   /db_xref="GOA:D7E7W6"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7W6"
FT                   /inference="protein motif:PFAM:PF05552"
FT                   /protein_id="ADI73308.1"
FT                   /translation="MAVHTPIMDSLYNAASQFIEFIPMLVAIIVLLIVGKYTGKGLGKL
FT                   GSKILDKIGLDNLLDKTVVGKMIKNSAMTTVGFFDAVIRWFVYLIFAVIIVDMLNIQIV
FT                   SDFITDVIAFLPLIASAAIVIVIGFIVIDFLADVVKKALSAAGLDDKIAESSIGSSMKE
FT                   SGTSASGLISGFVKLFGYLLFLAAALNILQLDIIANLIGQMVEYVPNLAAGILILLAGI
FT                   LALGMFEKYLDGFLKGMNVGSADVLLPLLKGVLFLLVIFIALDTMLVNIGVFNFVIQPL
FT                   AWGIAIIIAFRFGIKDAIVAYAKEKRE"
FT   gene            complement(382037..382321)
FT                   /locus_tag="Metev_0390"
FT   CDS_pept        complement(382037..382321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0390"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="KEGG: dps:DP2192 RNA polymerase sigma-B factor"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73309"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7W7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73309.1"
FT                   /translation="MPTDTGTDIKDYKQIRNDIKKHLKESDITIGDLANRFGVSKVFVR
FT                   EIKRELRTQNQAYFQRNIPDKNNWFYCYKCKVYIPACNYKACEYYPCKK"
FT   gene            complement(382466..383005)
FT                   /locus_tag="Metev_0391"
FT   CDS_pept        complement(382466..383005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0391"
FT                   /product="ISA1083-3 transposase"
FT                   /note="KEGG: afu:AF2139 ISA1083-3 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73310"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7B1"
FT                   /inference="similar to AA sequence:KEGG:AF2139"
FT                   /protein_id="ADI73310.1"
FT                   /translation="MDENTIIGFLDETSPQNNANTLRFWSFNKPQIYRNTWIKVNTLGF
FT                   YALNGKSVIEFSPHSKKEDVCEFLMNIRKNNPDKRIVIILDNFRSHHAKTVVECAANNG
FT                   IELVYLPPYSPELNPIEFIWKSIRRVISGFFAIDTDHMKQLIYEAFMQLSANISFAKGW
FT                   IKEFIVDKFIQRKLCY"
FT   gene            complement(383007..383489)
FT                   /locus_tag="Metev_0392"
FT   CDS_pept        complement(383007..383489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0392"
FT                   /product="ISA1083-3 transposase"
FT                   /note="KEGG: afu:AF2140 ISA1083-3 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73311"
FT                   /db_xref="GOA:D7E7W9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7W9"
FT                   /inference="similar to AA sequence:KEGG:AF2140"
FT                   /protein_id="ADI73311.1"
FT                   /translation="MTKPEQIPIQKHITYDELLYLIRHEKYARVLTRLYFIKYRYEGNS
FT                   VIISSERVGISSPVGHRWQKRWNESGYEGLIPRYTGGRPPKLTQQQKDQLKQILKSRNG
FT                   WTTNQVRELIINEFGVEYCLMQIRRILKEFGMKYAKPYPHDYRKPDDADEILKKHS"
FT   gene            383716..384519
FT                   /locus_tag="Metev_0393"
FT   CDS_pept        383716..384519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0393"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: hha:Hhal_1678
FT                   methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73312"
FT                   /db_xref="GOA:D7E7X0"
FT                   /db_xref="InterPro:IPR014369"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7X0"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADI73312.1"
FT                   /translation="MNNTKNQDFGDNPTDVRKSDHYQEEYVTGFVDKWDELIDWESRAK
FT                   GEGNTIINILKERGVKKVLDVATGTGFNSVRLLQAGFEVVSADGNPEMLAKAFENARKY
FT                   GYLMRTVQADWRWMKQDVHENFDAIICLGNSFTHLFNERDRRKALAEFYALLKHDGVLL
FT                   LDQRNYDSILDQGYSSKHAHYYCGDSVSVYPEHVDEGLARFRYEFLDNSVYYLNMFPLR
FT                   KGYTRRLLHEVGFQEIKTLGDFKETYKEDEPDFFLHVAEKEYKME"
FT   gene            complement(384643..384948)
FT                   /locus_tag="Metev_0394"
FT   CDS_pept        complement(384643..384948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nth:Nther_2648 copper amine oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73313"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7X1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73313.1"
FT                   /translation="MNKDQNSQKKVRCSYCNQTITVDEIYSSYDIMSNLKKMCTEKDVN
FT                   TRLQYFCSMECEVFFKIKSYKIAGIEKNQIVDLLLSDFQYSKNDILDIVDKYFMES"
FT   gene            385081..385668
FT                   /locus_tag="Metev_0395"
FT   CDS_pept        385081..385668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_0644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73314"
FT                   /db_xref="GOA:D7E7X2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7X2"
FT                   /inference="similar to AA sequence:KEGG:Mbur_0644"
FT                   /protein_id="ADI73314.1"
FT                   /translation="MKNFRNGWKQNIDHDRIIIILIFTFIVFWSILLYYYPPSEIVSKV
FT                   GVHNVYVFAFLLAMIGGVSAFTSTSFYITLITLSAGGADPVYIGVFASIGLTLGDLLFY
FT                   YLGKKGKQYIPERYGWGIRKLSSYVQKIKDRYIGVLIFTYSLTPLPSDILALTLAVIGY
FT                   PLKYMIIPLLLGNFALISIMATISQIGFNFLT"
FT   gene            386044..386559
FT                   /locus_tag="Metev_0396"
FT   CDS_pept        386044..386559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0396"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="KEGG: ptm:GSPATT00039334001 hypothetical protein;
FT                   PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SMART: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73315"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7X3"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ADI73315.1"
FT                   /translation="MSTNQDNKNNDSINNEEQILLYEKLTNLSEYIENEQFEDALELCN
FT                   GLLDKYPEYTPVMLSKANVLSFLERYDEALITYDKILELEPENSQVLYAKAITLSKLGN
FT                   YHDSILILNDLISYDPDNSYYWIARGFNYYDLNQFHDALQDFESAQHLDPENEKLNELV
FT                   NLLEKEAD"
FT   gene            386841..387245
FT                   /locus_tag="Metev_0397"
FT   CDS_pept        386841..387245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0397"
FT                   /product="Protein of unknown function DUF1699"
FT                   /note="PFAM: Protein of unknown function DUF1699; KEGG:
FT                   mbu:Mbur_1508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73316"
FT                   /db_xref="InterPro:IPR012546"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7X4"
FT                   /inference="protein motif:PFAM:PF08004"
FT                   /protein_id="ADI73316.1"
FT                   /translation="MKIRVLSSKDEIENLDENEEMVHLAFRPSNTDIFSIVSKCTNLKA
FT                   LHIPSSYKRTLSESAKMFLDMQGINLLEGDVWGHRKDINEYSEVSDNIYNRIKELKDEG
FT                   LSDDEIVDKMKKETKLGPDFVEFLIKQKYA"
FT   gene            387850..388179
FT                   /locus_tag="Metev_0398"
FT   CDS_pept        387850..388179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0398"
FT                   /product="translation initiation factor eIF-1A"
FT                   /note="TIGRFAM: translation initiation factor eIF-1A; PFAM:
FT                   S1 IF1 family protein; KEGG: mbu:Mbur_0456 translation
FT                   initiation factor IF-1A; SMART: initiation factor 1A
FT                   (eIF-1A)"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73317"
FT                   /db_xref="GOA:D7E7X5"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7X5"
FT                   /inference="protein motif:TFAM:TIGR00523"
FT                   /protein_id="ADI73317.1"
FT                   /translation="MRKDRNNNRKQSTDAPAVTRVRTPRKDKNEVFATVSTLLGGKRVK
FT                   LQCMDGTERMGRIPGSKKKRMWIREGDIVIALPWDFQDEKADVIWKYTRPQIEWLDKKG
FT                   YLSKG"
FT   gene            388315..388893
FT                   /locus_tag="Metev_0399"
FT   CDS_pept        388315..388893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0399"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cho:Chro.30043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73318"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7X6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73318.1"
FT                   /translation="MKKHLVVSVGGGPLASLYGTPELNSQAPERFLGDIYNTYIQSGAK
FT                   SIELICVDPNTDAPYTNDLDENEAGFKNPNYCGTGWNACIYQYESEEIKNLVKRLSEYN
FT                   KIDNADQLGGKAILSIHYYCGSASTNLNNGYWMKEIPDSIMDEAKKRFKKQFPNIEIMF
FT                   NIYSKKQKTGKVPKDLQEKTKTSYNNPPT"
FT   gene            389113..389715
FT                   /locus_tag="Metev_0400"
FT   CDS_pept        389113..389715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM_2869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73319"
FT                   /db_xref="GOA:D7E7X7"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="InterPro:IPR033580"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7X7"
FT                   /inference="similar to AA sequence:KEGG:MM_2869"
FT                   /protein_id="ADI73319.1"
FT                   /translation="MVLSSTIILVFCLVAFAVIHSALASLPFKRRLMQFLGSKADTLYM
FT                   PVYSLIAVLTISPLIYLLIYNPGPILYIVPSPWRWIMVGGQIIAAIVAPRALLDAPHRF
FT                   KIHSQLSGPNTPEAGALNIKGIYRWVRDPFLLSGIIIIWLTPFMTFNLLVIYALTTIYL
FT                   YLGSLHWEKRLIAQFGDEYREYQKQVHRIIPYLRGHY"
FT   sig_peptide     389113..389187
FT                   /locus_tag="Metev_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.993 at
FT                   residue 25"
FT   gene            389894..390730
FT                   /locus_tag="Metev_0401"
FT   CDS_pept        389894..390730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0401"
FT                   /product="CbbQ/NirQ/NorQ domain protein"
FT                   /note="PFAM: CbbQ/NirQ/NorQ domain protein; ATPase
FT                   associated with various cellular activities AAA_5; KEGG:
FT                   mma:MM_2988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73320"
FT                   /db_xref="GOA:D7E7X8"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7X8"
FT                   /inference="protein motif:PFAM:PF08406"
FT                   /protein_id="ADI73320.1"
FT                   /translation="MTSKNILCNGQAFEEYIFENEPYYVPTGNEIEIFTAAYKNNLPVN
FT                   LKGPTGCGKTRFMEYMAYHLNRPLITVACHEDLTATDLIGRFIIKGGDVEWNDGPLTKA
FT                   VKNGAICYLDEVVEARTDTLVVIHPLTDERRILPIDKQGIVLKAKPEFMLSISYNPGYQ
FT                   SVIKDLKQSTRQRFIAIEFNYPSMNTETQIVAHESGVSQNTAHSLVEIGHRIRNFKQHG
FT                   LEEGISTRLLIYAGKLINEGIAPNTACRSAMIEPITDDFDLQMSISEIISAVLEWE"
FT   gene            390733..394158
FT                   /locus_tag="Metev_0402"
FT   CDS_pept        390733..394158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0402"
FT                   /product="von Willebrand factor type A"
FT                   /note="KEGG: mma:MM_2987 hypothetical protein; PFAM: von
FT                   Willebrand factor type A; SMART: von Willebrand factor type
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73321"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7X9"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ADI73321.1"
FT                   /translation="MSYGRTTYPLDSELEKLIRLKLPKLSDTEIKNVTLQFKNLDDSDA
FT                   KFIVSRINTFKCGQPRVQLLLFKTSPKICGYLGVSGFLDWFMLAVYVANINISCLEGFI
FT                   KSSAKIIKKTGLYELEEWLEIGISLAETSSKVAITYFGTTSDVFLSVGYDRFKNLSDIG
FT                   IKLAKQDAQVSECYFKNLPFLQRCLLHDYINDFAEVVKGLAISDRKSAIDLIENTESVF
FT                   KQIPSFKKRKFLYQVKKTACIDTSTAHLLYHKSGYILYWLTESEFDQLVNFVIEFAKID
FT                   PNVACSFLNACPEFFKKVETSEVFKWSNIGMYLIQKNVESSKAFFDKLLDNIDLMKENF
FT                   NQAERVDLIYKSADFALSSWVCLDDFFKSLPAIYNILSKSEFYEWLELGKNIALHNSII
FT                   GSAFYRDSTWVIVHANPRYRRQIFKTGKELLSSNPMIAGLFFNALPEASDNLHLNHIDE
FT                   WAKHGLSLYNIDQKIAASYFEHTPSLLKDIDIIGVKDWTQKGIELFYKDFVSGRLYFNL
FT                   ESRKSREVIGSLSNGVELEKVQKTLKYYTLGLSGINYKIYSKNMISDFDTPNPVVYNNI
FT                   IYLKPRVNLFDNPEYNFRFYKLCLIHEIAHKLYGSDLISALKNNRSGITYHEILSVLPE
FT                   KNTDNNFDLQTLTSRFIYPKVIEDIFTIIEDARVEYKIMESYRGLYKDFKLRYLLLSKR
FT                   SLSKDVPEIFVDSLLWVTCGYRPSSNKRDVQCLIDFSKSVLNKMVFHSESSVIESFVVA
FT                   CKIYNKIKELLNCETHLEYNPIQNLEYRSVEFKNTIKTSKETEKPGMEDLEYTSPVTYV
FT                   QASDKAEETCYPHDHITPKSPSCTKNIIASYRYDEWDERINDYKYEWCIVNEVEPDKDT
FT                   SNFYEETLESYIYEINYLKKVFSSIKPEDYQMLKRQSDGDEIDIDSVIDSLVEKKYGSH
FT                   PNEDFYIKNVKKERDVATLFLVDVSASTQKKLGMGGKTILDIEKEALIVMSHALENIGD
FT                   KYAIYAFSGTTHRNVEYYVVKKFDEGLSTDMKSRISALEPISNTRLGPAIRHSIKKHKD
FT                   IEAKTKLIILISDGEPYDFGTNGPPYQGDFAERDTKMAIREGYEKGIHFFCVTVDKEAK
FT                   DYMDSIFSDAGYTIIDDVALIPERLPMIYKKLTT"
FT   gene            394303..394691
FT                   /pseudo
FT                   /locus_tag="Metev_0403"
FT   gene            complement(394756..395601)
FT                   /locus_tag="Metev_0404"
FT   CDS_pept        complement(394756..395601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0404"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: mbu:Mbur_0524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73322"
FT                   /db_xref="GOA:D7E7Y0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Y0"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADI73322.1"
FT                   /translation="MISIETFAVVFGIASAVSWGTGDFVGGYATRRTSAYSVVLVTQIM
FT                   GVITFPILAFTFSESLPSLNNLIWGAFAGFFGASGLISLYTGLAKGKMSIVAILAAVIS
FT                   MITPVIYSAFYEGIPSIFKITGFIFAFIGIWFIVSMNVGPKLKASDLGFPLLAGTLFGL
FT                   FFISIDNFSATAIYWPLTVSRTTAFIMLTGFIMLTKTVRKPTSDVILIVILAGLFNTGG
FT                   AAFFALASGAGRLDVATVLSSLSPAVTVLLACILLKEQLASRQWLGVIAALIAIIFLSV
FT                   "
FT   gene            complement(395997..396071)
FT                   /locus_tag="Metev_R0011"
FT                   /note="tRNA-Glu2"
FT   tRNA            complement(395997..396071)
FT                   /locus_tag="Metev_R0011"
FT                   /product="tRNA-Glu"
FT   gene            complement(396159..397433)
FT                   /locus_tag="Metev_0405"
FT   CDS_pept        complement(396159..397433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0405"
FT                   /product="26S proteasome subunit P45 family"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: 26S proteasome subunit
FT                   P45 family; KEGG: mbu:Mbur_2301 proteasome-activating
FT                   nucleotidase; PFAM: AAA ATPase central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73323"
FT                   /db_xref="GOA:D7E7Y1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Y1"
FT                   /inference="protein motif:TFAM:TIGR01242"
FT                   /protein_id="ADI73323.1"
FT                   /translation="MTTSNSSSESNPTTNTVNSNNEYDELEKSESSDTEDLENKDIDTL
FT                   ISDIKSLRVQNENLRANLLDANMTISNYEEEIEKLNKQIDQLSKPPLFVATVLEINDDT
FT                   VVLRQHGNNQEVVTNVSSDFKDQLEPGVRVSVNAAFSVISVISRAADVRAQIMEVINSP
FT                   GIDYDMIGGLDDIIQEVIESVQLPLTEQELFDNIGIEPPSGVLLYGPPGSGKTLIAKAV
FT                   ASQANATFIRMSGSDLVQKFIGEGARLVKDVFEMARSKSPSILFIDEIDAVGGMRTHDG
FT                   TTGSAEVNRTMLQLLAEMDGFDPKGEVKIIAATNRADLLDPALLRPGRFDRLIEIPKPD
FT                   NKGREDILRIQTRKMNLSDDVDFTRLADITEGLTGADLMALVKEAGMFVLRRRGNQINM
FT                   QDFLDSYEKIVEEEEVHTPIGGMFG"
FT   gene            397990..398721
FT                   /locus_tag="Metev_0406"
FT   CDS_pept        397990..398721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_2302 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Y2"
FT                   /inference="similar to AA sequence:KEGG:Mbur_2302"
FT                   /protein_id="ADI73324.1"
FT                   /translation="MKIRLEIIDDDGNEKVNVEFAGENWREYLTKFIYTIDVHSSSTES
FT                   SSSQMPNQNQPISQQYQYYPTNQQPSQTQYQQPVNQPLFTQQPVQQQPANTQFNQPPQY
FT                   QAPINQQPPQNFAPVNNQQIVNREPKTPSLREKLNDATLTINERLELFLKYEYPRVWFS
FT                   SQDIQEQYEKIYGKIKLSTVSTYLSRMYRKNLLERRGNRTQREYRYIGDMGTEDEYVNE
FT                   NVNDNMGYVPHNQSNTFQTYR"
FT   gene            398762..398992
FT                   /locus_tag="Metev_0407"
FT   CDS_pept        398762..398992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0407"
FT                   /product="Protein of unknown function DUF131"
FT                   /note="PFAM: Protein of unknown function DUF131; KEGG:
FT                   mba:Mbar_A0401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73325"
FT                   /db_xref="GOA:D7E7Y3"
FT                   /db_xref="InterPro:IPR002849"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Y3"
FT                   /inference="protein motif:PFAM:PF01998"
FT                   /protein_id="ADI73325.1"
FT                   /translation="MQTSNLLKLGSLLIFIGFAMVFLGMIFTAGTGQNDFGGLIMIGPI
FT                   PIVFGTSPEITSSMLLLGLLILIVYLLIIKR"
FT   sig_peptide     398762..398857
FT                   /locus_tag="Metev_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.547 at
FT                   residue 32"
FT   gene            complement(398995..399129)
FT                   /locus_tag="Metev_0408"
FT   CDS_pept        complement(398995..399129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73326"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Y4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73326.1"
FT                   /translation="MTATKEDEEPKSCKKNGDKNLCMFIRTVKTFHKMAKEMDYCKKD"
FT   gene            399283..399606
FT                   /locus_tag="Metev_0409"
FT   CDS_pept        399283..399606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0409"
FT                   /product="Protein of unknown function DUF131"
FT                   /note="PFAM: Protein of unknown function DUF131; KEGG:
FT                   mac:MA4119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73327"
FT                   /db_xref="GOA:D7E7Y5"
FT                   /db_xref="InterPro:IPR002849"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Y5"
FT                   /inference="protein motif:PFAM:PF01998"
FT                   /protein_id="ADI73327.1"
FT                   /translation="MAGEYLIYTGIFVIIIGFIIIAISIIINTMKEYEKEEHNYYKTPD
FT                   YQDQHHSENYNKPRTDVKGGGVVMIGPIPLVFGSDNQSLQKLMILAIILMLLGFAFTFV
FT                   YSL"
FT   gene            399741..401735
FT                   /locus_tag="Metev_0410"
FT   CDS_pept        399741..401735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0410"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="SMART: DEAD-like helicase; helicase domain protein;
FT                   manually curated; TIGRFAM: excinuclease ABC, B subunit;
FT                   KEGG: mbu:Mbur_2303 excinuclease ABC subunit B; PFAM:
FT                   helicase domain protein; type III restriction protein res
FT                   subunit; UvrB/UvrC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73328"
FT                   /db_xref="GOA:D7E7Y6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Y6"
FT                   /inference="protein motif:TFAM:TIGR00631"
FT                   /protein_id="ADI73328.1"
FT                   /translation="MKPFKVVTSYEPRGDQPSAISNLTNGLNKGFKHQTLLGVTGSGKT
FT                   FTMANVIENVQKPTLVIAHNKTLAAQLYSEFREFFPDNAVEYFVSYYDYYQPEAYIPTT
FT                   DTYIEKESSINEEINRLRLSATKSLMERRDVIVVSSVSCIYNIGSPDEWKEMSLFLSPG
FT                   EEVDKSSLSASLVNMQYERNDIEFTQGTFRSRGDTIEIYPAQEEHGIRIELFGDEIEKI
FT                   SYFDPLTGKVQNTLNEDEYIAIYPAKHFVMPQEQIDRAMDSIEKELEEHVSRFEANNQQ
FT                   LEAQRLLQRTNFDMEMLREIGYCSGIENYSRHFDGRRPGDPPYSLLDFFPDDYLIFIDE
FT                   SHVTIPQIGGMYNGDKSRKDSLVEYGFRLPSAYDNRPLKFDEFENRVNQIIYVSATPAN
FT                   YEFNKSEQVVEQIIRPTGLVDPEIIVRPIENQIDDLIGEVREVAEEGYRTLVTTLTKRM
FT                   AEDLTDYLLEVGIRVKYMHSDIDTLERAEIVRSLRKGDFDVLVGINLLREGLDIPEVEL
FT                   VAILDADKEGFLRSERSLIQTIGRASRNANGRVILYADKTTGSMKRAIDETNRRRELQI
FT                   DFNQRNGIVPQTITKAIQKELVEVEYPEPQTSEYSETVALAENKSTKDIENLIIDLEED
FT                   MHLAAKNLEFEKAAELRDKINDLRRKYSL"
FT   gene            401798..401869
FT                   /locus_tag="Metev_R0012"
FT                   /note="tRNA-Gly1"
FT   tRNA            401798..401869
FT                   /locus_tag="Metev_R0012"
FT                   /product="tRNA-Gly"
FT   gene            401980..402264
FT                   /locus_tag="Metev_0411"
FT   CDS_pept        401980..402264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0411"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: mma:MM_2872
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73329"
FT                   /db_xref="GOA:D7E7Y7"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Y7"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ADI73329.1"
FT                   /translation="MLSKIPIDLNKVQLENKDKEILRAAIIAELDAINLYEEMADLADN
FT                   DEIKSVLLDVAKEEKTHVGEFQTMLLKSDSQQVEELEAGKKEVEEELSK"
FT   gene            402384..403037
FT                   /locus_tag="Metev_0412"
FT   CDS_pept        402384..403037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0412"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="KEGG: mma:MM_1635 beta-phosphoglucomutase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73330"
FT                   /db_xref="GOA:D7E7Y8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Y8"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ADI73330.1"
FT                   /translation="MLKAIIFDFDGVLADSMPYHAQAWKIAFEKAGIEINKDDIYEIEG
FT                   SNHVGIIQLMFQKMGKSPQPHQFDEIAQEKRKIFSQIANLKNFEDMDKCLSQLKNKFKL
FT                   AVVSGADRNAVFNMVGRFYPDVFDVIVTGEDVDNGKPSPEPYLKALGMLNVEKNECLVV
FT                   ENAPLGVDSAKNAGLYCVAVPTYVDPEKLDKADVVVEDHSDLKKYLQKIYSEQA"
FT   gene            complement(403097..405013)
FT                   /locus_tag="Metev_0413"
FT   CDS_pept        complement(403097..405013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0413"
FT                   /product="KH-domain/beta-lactamase-domain protein"
FT                   /note="TIGRFAM: KH-domain/beta-lactamase-domain protein;
FT                   PFAM: RNA-metabolising metallo-beta-lactamase; K Homology,
FT                   type 1, subgroup; KEGG: mbu:Mbur_0375 beta-lactamase-like
FT                   protein; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73331"
FT                   /db_xref="GOA:D7E7Y9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019975"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR033769"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Y9"
FT                   /inference="protein motif:TFAM:TIGR03675"
FT                   /protein_id="ADI73331.1"
FT                   /translation="MDIEEMLLDLKKKIESKLPNDTTISTVEFEGPQLVVYTEEPRKFA
FT                   DNGNIIRTLAKDLRTRIVVRPDPKVLVPPEESMDKIGNIVPEEAATSNYHFDPDVGEVI
FT                   IEAEKPGLVIGKQGDTLREITKEIGWTPKVVRTPPIKSRTVKNIREFMRNNHKERKDIL
FT                   KSVGRQIHRETTTKDQWVRITSLGGCKEVGRSCFILSTPESRVMIDCGVNIGSDENMTP
FT                   YLYVPEAYPLSQLDAVILTHAHLDHSGFIPLLYKYGYQGPVYCTLPTRDLSALLQLDYI
FT                   DVAGKEGRIVPYESSQVREALKHTITLDFEEVTDIAPDIKLTFHNSGHILGSAIAHFHI
FT                   GDGLHNVVFTGDYKYGSTRLFDPAVNKFPRVETVVTESTYGSSNAVQPTLKDAEKHLQQ
FT                   VIINTLQKDGIVLIPAFAVGRSQEVMIVLEDAIRKGLIDDVPIYLDGMIWEATAIHATY
FT                   PEYLNNELRKSIFQKGQNPFLSDSFKPVDSNELRQKIIDEPHPCVILATAGMMNAGPIL
FT                   EYFKAFASNENNTLVFVGYQADGTLGRRIQKGWKEIPMSSSVNGGTQTINVNMNVEVVD
FT                   GFSGHSDRKQLMDFVKKMKPRPERVYTEHGEEKFCIDLASSIYKKNKIETRALTNLETI
FT                   RLV"
FT   gene            complement(405140..405775)
FT                   /locus_tag="Metev_0414"
FT   CDS_pept        complement(405140..405775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0414"
FT                   /product="proteasome endopeptidase complex, beta subunit"
FT                   /EC_number="3.4.25.1"
FT                   /note="TIGRFAM: proteasome endopeptidase complex, beta
FT                   subunit; KEGG: mbu:Mbur_0374 proteasome endopeptidase
FT                   complex; PFAM: 20S proteasome A and B subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73332"
FT                   /db_xref="GOA:D7E7Z0"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR019983"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Z0"
FT                   /inference="protein motif:TFAM:TIGR03634"
FT                   /protein_id="ADI73332.1"
FT                   /translation="MSSDNQHLKGTTTVGIACSDAVVLATERRATMGNFIASKTAKKIY
FT                   QIDDRIGMTTAGSVGDAQQIVRIISVESKLFKMRRNEPITIKGITTLLSNLLSGQRYFP
FT                   LMVQLIVGGVDKTGPNMYSLDPLGGRIEETNIVATGSGSPITYGLLEDRYHKDMTSDEG
FT                   AELAIRALHNAMKRDSASGDGIDVVVITKDGYKQLDEEEVNNKRAALN"
FT   gene            complement(405894..406400)
FT                   /locus_tag="Metev_0415"
FT   CDS_pept        complement(405894..406400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0415"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   mma:MM_0693 hypothetical protein; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73333"
FT                   /db_xref="GOA:D7E7Z1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004454"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Z1"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADI73333.1"
FT                   /translation="MLSRTKALNLLSEMGCEPHVVEHCKAVSSFAVEVAKELKKTGKSV
FT                   DMELVEIGGLLHDIGRSHTHGVKHIVEGAKIAESLGLDSRIVRIIKTHIGAGLTPKEAV
FT                   NLGFPDDDYMPRTIEEKIIAHADNLVEGTKRRSLDEYISQMRDKNLDESVIERVKQLAY
FT                   EIGVY"
FT   gene            complement(406406..406903)
FT                   /locus_tag="Metev_0416"
FT   CDS_pept        complement(406406..406903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0416"
FT                   /product="Transcription factor TFIIE, alpha subunit"
FT                   /note="KEGG: mba:Mbar_A0196 transcription factor IIE
FT                   (TFIIE), alpha subunit; PFAM: Transcription factor TFIIE,
FT                   alpha subunit; SMART: Transcription factor TFIIE, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73334"
FT                   /db_xref="GOA:D7E7Z2"
FT                   /db_xref="InterPro:IPR002853"
FT                   /db_xref="InterPro:IPR016481"
FT                   /db_xref="InterPro:IPR017919"
FT                   /db_xref="InterPro:IPR024550"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Z2"
FT                   /inference="protein motif:PFAM:PF02002"
FT                   /protein_id="ADI73334.1"
FT                   /translation="MVDLNDPVIRGYLKQLVGDEGLKMIENMPEGEVTDEKIAEETGVL
FT                   LNIVRRTLFILNEYKLVVCRRERDTSSGWLTYLWRLDLSGIETRLEKERKKLIQNLEQR
FT                   LEFEEGNVFFECPEGCLRLLFNEATNYHFLCPLCGEDLVAQDNSKTIENIRSRLNKLKK
FT                   CG"
FT   gene            complement(406943..408163)
FT                   /locus_tag="Metev_0417"
FT   CDS_pept        complement(406943..408163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0417"
FT                   /product="protein of unknown function DUF201"
FT                   /note="KEGG: mac:MA3870 hypothetical protein; manually
FT                   curated; PFAM: protein of unknown function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73335"
FT                   /db_xref="GOA:D7E7Z3"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016677"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Z3"
FT                   /inference="protein motif:PFAM:PF02655"
FT                   /protein_id="ADI73335.1"
FT                   /translation="MNHIQNILIIGYDTRNIVCSANKSGYNVYSIDAFCDFDLKESAVS
FT                   TKKIPSNYVEDIKSISCKKVVEWISEFEIDFDAIVLDSGFEYINQEQLPSKVLNNSQEI
FT                   MNEVTDKYRFARKLESMDIPHPITYSANDIKNINDYPIIVKPKRAGGGMFNRKAESFDE
FT                   LESVIDELLETYPLWTLDDLIIQKFEKGIPVSVSMVSTGDNAYAIAINEQLIGEPWLTD
FT                   TEFAYCGNITPFETLYQDEMYKISKQLMLELGLKGSNGVDFIITEDGPVVLEINPRLQG
FT                   SLDTVEIATDMNLFDTHVKSFSGILPETTDVKQFAARAVVYSQNDVLINKQILNGLIGQ
FT                   NTVDIPDVGHHIGIDEPLTSVVHKGHSRRDVMEKLRISVEKIHCLTDGKGKEKNKTIPN
FT                   LNTKLKS"
FT   gene            complement(408198..409241)
FT                   /locus_tag="Metev_0418"
FT   CDS_pept        complement(408198..409241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0418"
FT                   /product="NMD3 family protein"
FT                   /note="PFAM: NMD3 family protein; KEGG: mba:Mbar_A0198
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73336"
FT                   /db_xref="GOA:D7E7Z4"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Z4"
FT                   /inference="protein motif:PFAM:PF04981"
FT                   /protein_id="ADI73336.1"
FT                   /translation="MSLILCPKCGNETDVLYENVCKDCFFEQFQLARLPHVIHVKFCSR
FT                   CGSVYYQGVWDDVDSTGDMVIRLVEDELMVHEYASDLEIYFEPQQLTSYMYRVRVIVDA
FT                   RVEGVPVNQELETEVRIGRESCDRCSRIAGGYFEGIVQIRGTNRVPDKNEVEDCIRIAN
FT                   DVIDRMYKKGERFAFISKSVESKHGIDLYIGSSNTSRQICKQIESERGGKFSESPTLFG
FT                   QKDGKEIYRITFSMRLPEFKAGDIIEYKDRVIEIKNSGNRVSGIDLSNGSRFVEYQDKM
FT                   NKAVHVASRDDAITAVLVSEGDNEIMVLDPETYKTLTLKKPVTFESGNKSEIPVIKTEH
FT                   GLFVLSD"
FT   gene            complement(409291..409515)
FT                   /locus_tag="Metev_0419"
FT   CDS_pept        complement(409291..409515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73337"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Z5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73337.1"
FT                   /translation="MFCGVNCYDPEAVGGNIQESQNICEGKLVGKRLICANCLYQLRRI
FT                   LGIEDLESEIFEEDILEGGEVKNDKWQLW"
FT   gene            complement(409677..410738)
FT                   /locus_tag="Metev_0420"
FT   CDS_pept        complement(409677..410738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0420"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mem:Memar_0224 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73338"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Z6"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADI73338.1"
FT                   /translation="MSNVYFKPVDSISPNQTQIDQVKELYPEISPVEEGDLVAIKIHPG
FT                   EHGNTTHIHPAIVRAVVDMVKDEGGIPFVVDTTVLYNGMRFNAADALWTASVNGFTQES
FT                   MNAPVIIGDGLMGDESVTVEINGEELKQTTVASAIAKADSMIVLSHVKGHPATGFGGAV
FT                   KNLGMGCLDKDGKTDCHEVGIPTIEPEKCVGCETCIDMCAWGALKMEDGKAVVDTELCK
FT                   GEGFCVESCPEGAIVPPENFTEGLQKRIGEASIATINSLSGKIGYINWIFDLTLGCDCF
FT                   GFYTPSFSKDVGILASKDPVAIDMASIDLINSKMEEHGSKSSMKDVWGVDPKIQVDAAE
FT                   KIGAGSEGYTLKK"
FT   gene            complement(410854..412263)
FT                   /locus_tag="Metev_0421"
FT   CDS_pept        complement(410854..412263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0421"
FT                   /product="CO dehydrogenase/acetyl-CoA synthase delta
FT                   subunit, TIM barrel"
FT                   /note="PFAM: CO dehydrogenase/acetyl-CoA synthase delta
FT                   subunit, TIM barrel; Fe-S cluster domain protein; KEGG:
FT                   mbu:Mbur_0863 acetyl-CoA decarbonylase/synthase complex
FT                   subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73339"
FT                   /db_xref="GOA:D7E7Z7"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016041"
FT                   /db_xref="InterPro:IPR016218"
FT                   /db_xref="InterPro:IPR023427"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Z7"
FT                   /inference="protein motif:PFAM:PF03599"
FT                   /protein_id="ADI73339.1"
FT                   /translation="MKINSPLQAYKYLPGDNCGICGESTCMAFASRLIERSAELTDCEP
FT                   ILREDQKKNFEKLQELLRPEIREVDIGVGDKAVTIGGDDVLYRHKLTFFNKTALTYDVW
FT                   DTMDENDLAERVNHIENFQKFYVGEFLNPDAIAIRSVSDDPTQFSETVKKVIEITNLPM
FT                   VLCSFNPEVLRAGLEVSSDRNPLIYAANKDNWQEVADIANDYGVPVTLFAPGDLDLLKS
FT                   MALTFTKMGMENLVLDPGTYPTGTQLRDTFNNFIKLRRAGINGDREIAFPLMSVPLTSW
FT                   LVYEDTVSASYWETVLACTFIIKYGDIMLLHSTEPYAMLPELHMRDTIYTDPRKPVMVD
FT                   PGVYEVGSPTADSPVIITTNFALTYYTVESDLASNDIDCYLAAIDTEGIGVEAAVAGGQ
FT                   LTASKIKKGLEESEFDLKEQTNHKTLMLPGLAARLQGDVEDETGANVVIGPADSGRIPG
FT                   WMDKNWPPSTG"
FT   gene            complement(412267..413595)
FT                   /locus_tag="Metev_0422"
FT   CDS_pept        complement(412267..413595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0422"
FT                   /product="CO dehydrogenase/acetyl-CoA synthase, delta
FT                   subunit"
FT                   /note="KEGG: mbu:Mbur_0862 acetyl-CoA
FT                   decarbonylase/synthase complex subunit delta; TIGRFAM: CO
FT                   dehydrogenase/acetyl-CoA synthase, delta subunit; PFAM: CO
FT                   dehydrogenase/acetyl-CoA synthase delta subunit, TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73340"
FT                   /db_xref="GOA:D7E7Z8"
FT                   /db_xref="InterPro:IPR004486"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016041"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Z8"
FT                   /inference="protein motif:TFAM:TIGR00381"
FT                   /protein_id="ADI73340.1"
FT                   /translation="MTKKMKLSDLTEMLKDLDVEALEGVNIEGDIEFDVSGVGLDPNLS
FT                   YALGYEAAQVSFHIANIAKLLGYPVDQLFGASMGAVGQEAPSAEGIAAKTGFSELASSS
FT                   FEVSPVKEWTHTIEEVTLGATSSDGGSRGNTITLGGENALPYYFDAEMPHRNYVTMDVF
FT                   DLPISMAKSVRTNYEDVMDDPAEWAKKVVNEYNADMVTIHLVSTDPNIEDTSAKEASKV
FT                   VEDVLQAVDVPLVIGGSGNPDKDPEVLEKAAEVAEGERALLASASLNLDYERIAKAATD
FT                   YGHAILSWTQLEINAQKELNRKLMTQCNVPRDSILMDPTTAALGYGLDYAYTNMERIRL
FT                   AGLTGDDELTFPMSSGTTNAWGARESWMKESPIQNDSDWGPREYRGPIWEISTGLALAL
FT                   AGNDLFMMMHPTSVQVLKETTQSLFGTKEAEDIDISNWIGAEV"
FT   gene            complement(413679..414431)
FT                   /locus_tag="Metev_0423"
FT   CDS_pept        complement(413679..414431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0423"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   mbu:Mbur_0861 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73341"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E7Z9"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ADI73341.1"
FT                   /translation="MTRIIAVTGKGGTGKTAITAMLMRHLVKDDNLVLAVDADPDTNLP
FT                   DALGCEIDHTLGEMREFMLNERDNFPPDSNKESVLESKVYEAINEMDDYDLLVMGRPEG
FT                   PGCYCYVNNLLRGIMTRLVTNYDAVIIDTEAGLEHFSRKLIPEIDDLIVVTDGSKRGMQ
FT                   TGERIRQLVGELETKVKNVYVVANKVTESNRELIEQNAKDLDLRLLGAVPVDKIIEERD
FT                   LKGLPLFDLPDESVAIKEINNIANDLNL"
FT   gene            complement(414457..415866)
FT                   /locus_tag="Metev_0424"
FT   CDS_pept        complement(414457..415866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0424"
FT                   /product="CO dehydrogenase/acetyl-CoA synthase complex,
FT                   beta subunit"
FT                   /EC_number="2.3.1.169"
FT                   /note="TIGRFAM: CO dehydrogenase/acetyl-CoA synthase
FT                   complex, beta subunit; KEGG: mbu:Mbur_0860 acetyl-CoA
FT                   decarbonylase/synthase complex subunit beta; PFAM: CO
FT                   dehydrogenase/acetyl-CoA synthase complex beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73342"
FT                   /db_xref="GOA:D7E800"
FT                   /db_xref="InterPro:IPR004461"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR023432"
FT                   /db_xref="InterPro:IPR038571"
FT                   /db_xref="UniProtKB/TrEMBL:D7E800"
FT                   /inference="protein motif:TFAM:TIGR00316"
FT                   /protein_id="ADI73342.1"
FT                   /translation="MAEFPLEISPMFEGERIRKNDMYVELAGPKSKGFELVRATDSDEI
FT                   EDGKFTLIGPDISEMEEGSRYPFAMLYKIGGELVEPDLEAIVERRNHDFYNYMQGVMHL
FT                   NQRYDIWVRLSKDAVNKGLNSFEQMAAAMMSLFKNELSFIEKIEAVYITDPEEIDKELE
FT                   NAMEIYKERDERTANLHEEDVDTFYGCTLCQSFAPSNVCVITPDRIALCGAINWFDGRA
FT                   AAKVDPEGPQFPIEKGEVIDEVGGEYSGVNEAAKSLSGGEFDRIKLHSFFEYPHTSCGC
FT                   FEVVGFYIPEVDGIGWVDRDFTGNAPNGLPFSTMAGQTGGGKQVVGFLGIGINYFRSPK
FT                   FLQADGGWDRVVWMPSHLKEKVVDYIPEDVVNKIPTEQDVGDISELETYLKETEHPVIE
FT                   RWSEEEEEETEAEEEQSGQPESAPSQYMTQMPASMPSAPSWTPSASSGGVKVTLKNAKV
FT                   SIDRIIVKNKE"
FT   gene            complement(415889..416404)
FT                   /locus_tag="Metev_0425"
FT   CDS_pept        complement(415889..416404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0425"
FT                   /product="CO dehydrogenase/acetyl-CoA synthase complex,
FT                   epsilon subunit"
FT                   /note="KEGG: mbu:Mbur_0859 acetyl-CoA
FT                   decarbonylase/synthase complex subunit epsilon; TIGRFAM: CO
FT                   dehydrogenase/acetyl-CoA synthase complex, epsilon subunit;
FT                   PFAM: CO dehydrogenase beta subunit/acetyl-CoA synthase
FT                   epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73343"
FT                   /db_xref="GOA:D7E801"
FT                   /db_xref="InterPro:IPR003704"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D7E801"
FT                   /inference="protein motif:TFAM:TIGR00315"
FT                   /protein_id="ADI73343.1"
FT                   /translation="MVDAIKNTRVYTTWGTKNAKPVQPKVAAKTISKAKRPLMIVGAEL
FT                   LKNKEVLDRAVTIAKTAGIPVAATGHSIKELVDKGVNAKYINIHSLGLYLCDPNWGGLD
FT                   GNGCYDMAIILGHKKYYINQVLSGLKNFTNLKTISIDKHYLQNATMSFGNLNDEKHIEA
FT                   LDELIENL"
FT   gene            complement(416408..418813)
FT                   /locus_tag="Metev_0426"
FT   CDS_pept        complement(416408..418813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0426"
FT                   /product="CO dehydrogenase/acetyl-CoA synthase complex,
FT                   epsilon subunit"
FT                   /EC_number="1.2.99.2"
FT                   /note="TIGRFAM: CO dehydrogenase/acetyl-CoA synthase
FT                   complex, epsilon subunit; KEGG: mbu:Mbur_0858 acetyl-CoA
FT                   decarbonylase/synthase complex subunit alpha; PFAM:
FT                   Prismane; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73344"
FT                   /db_xref="GOA:D7E802"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR004460"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7E802"
FT                   /inference="protein motif:TFAM:TIGR00314"
FT                   /protein_id="ADI73344.1"
FT                   /translation="MSNITTGKFSIEDLENVQVTIENIVGAIEEVEEKEEEMGVTPKPG
FT                   ISSLRHWDFNLLNRYEPIYTPMCDQCCYCTFGKCDLSGNKEGACGIDMKAHQAREFLLR
FT                   VITGASAHTGHGRHLLHHLIEKYGRDHPIDVGPSNLKTPVMQTVTGYKPETLGDLEKVL
FT                   DYVEEQITQLLATIHMGQEGEAIDFESKALHGGMLDHVGMEISDIAQISCLKMPKSDAE
FT                   SPLAEIGMGCIDSSKPMLLTIGHNVSGVTNIMDYIDEQSLSDDIEIAGLCCTAIDMTRY
FT                   NTDEGDEPKAKVIGSLAKELKMIRSGVPDVIVVDEQCVRADILREAQKLSIPVISTNDK
FT                   IMYGLKDRSSDDVDDILEDLKSGIEPGALILDFDKLGELAPRLAMDMAPIREEKGIKSL
FT                   PTSEELQELTERCVHCKECELVCPTNLSISDAMSAAETGDFAPFEELHDKCIGCGRCEQ
FT                   VCPKDIPVLNVIEKSAQRVIREEKGTLRAGRGQVSDPEIREEGVNLVLGTTPGIIALVG
FT                   CSNYPEGTKDLYRIADEMLKRNYIVVVSGCSAMDLGMYRNEDGNTLYEEYPGKFIKGNL
FT                   LNVGSCVSNSHITGTAIKVASIFAQRNVTGNFEEIADYILNRVGAVGVAWGAYSQKASS
FT                   IATGCNRFGIPVIVGPHGSKYRRALIGKPYEKDKWTVYDARNGEELPIPSSPEFLLSTV
FT                   ESVEELMPILAKNCMRPSDNNMGRMIKLTNYIELSEKYLGVMPEDWYQFVRTETDLPLT
FT                   KRGDLLKKLESEHGWEIDWKKKKIISGPSMKFDVSAQPTNVKRLCKEA"
FT   gene            419087..419674
FT                   /locus_tag="Metev_0427"
FT   CDS_pept        419087..419674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0427"
FT                   /product="Resolvase domain protein"
FT                   /note="KEGG: afl:Aflv_2745 predicted site-specific
FT                   integrase-resolvase; manually curated; PFAM: Resolvase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73345"
FT                   /db_xref="GOA:D7E803"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:D7E803"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ADI73345.1"
FT                   /translation="MKAGDVLKTLRITRPTLYRYVENGYIKRTSLPNGQYEYDDESVYA
FT                   FLNKDVKRKTVIYARVSTSKQKKDLENQVQMLKTWAFNSGYQVNHVYSDVASGISFEKR
FT                   KDFFKMLDEITNYKVENVIISYKDRLSRVGFELFYHLFSKYGTNIIVVSDIGSKKLDDE
FT                   EVFSEIKSLLHCYSMKLYSKTRAKSIEIKKEE"
FT   gene            419687..420889
FT                   /locus_tag="Metev_0428"
FT   CDS_pept        419687..420889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0428"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: tte:TTE0715 transposase; TIGRFAM: transposase,
FT                   IS605 OrfB family; PFAM: transposase IS605 OrfB; putative
FT                   transposase IS891/IS1136/IS1341 family"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73346"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D7E804"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADI73346.1"
FT                   /translation="MIVSRTETIHLKYDDRLSRLCHISKNLYNQANYIIRQNWLNGYGY
FT                   TKYEKVNEELKGTENYSILPSQTAQQTLKMVDRNWKSFFNSLKDYKINPHKYEGKPKPP
FT                   NYKKKDGEFLLIFTSQQLTRGIKNNYLKFPKKLGLKIKTRLNEDTNIQQVRIVPLGVGY
FT                   KCEIVYKQKIIHNKLDENNIASIDLGINNIITMVNNIGEKPIVIKGGGVKSINQYYNKK
FT                   KSQWKSFYDKRGFDETKRLEKIYQKRNNKINDFFHKVSKKIINYCIENNIGTLIVGYNE
FT                   GWKQECNIGKKNNQNFVQIPFFKLKKQIEYKSEDAGIKVLFQEESYTSKCSFLDDEPVE
FT                   KRTSYLGKRIMRGLFKSNTGKVINADVNGAYNILKKAFPGAMKGIEGVALHPVSISHEY
FT                   N"
FT   gene            421009..421908
FT                   /locus_tag="Metev_0429"
FT   CDS_pept        421009..421908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0429"
FT                   /product="Rhomboid family protein"
FT                   /note="KEGG: mbu:Mbur_0857 rhomboid-like protein; PFAM:
FT                   Rhomboid family protein; AN1-type Zinc finger protein;
FT                   SMART: AN1-type Zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73347"
FT                   /db_xref="GOA:D7E805"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035896"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D7E805"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ADI73347.1"
FT                   /translation="MSNNCWICGKQDSTLFRCRFCGKTFCVEHRLPERHACEGLEHQKK
FT                   YGFTKSPGDGSNYSNFDTEGIFKNMFKETAKQASKGLAFSFLNKIKRWATTSPTMAIII
FT                   ICVASYIIGNLIITNVIGINYFALLGLPADISQILVKPWTIVTHIFVHSNFAHLFLNMF
FT                   VLFFFGNEFEKRFGKQRFLTVFFLAGIIASIGFALITTTPFPLVGASGAVIGIFASLAI
FT                   LVPDLPIFVFFIPMRIKHAILLLIGIEFLFFIINTQDMIAHSAHLMGMAVGILMGFWIK
FT                   KTISVYRTSTRNEYVRRW"
FT   gene            421911..422318
FT                   /locus_tag="Metev_0430"
FT   CDS_pept        421911..422318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A0206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73348"
FT                   /db_xref="UniProtKB/TrEMBL:D7E806"
FT                   /inference="similar to AA sequence:KEGG:Mbar_A0206"
FT                   /protein_id="ADI73348.1"
FT                   /translation="MDDDLRHLTKYFPRPREGEEIPVQFIEFQKKIAAWSPKKKRTLYL
FT                   EDAANIEGLKRIRETNLLKVYNWISGHESLIELSNEERKQFEETMELLLKYGGEIRYTR
FT                   KKVGRKMMNQFKLVKKTVFNSVKKQCLAEKL"
FT   gene            422390..422926
FT                   /locus_tag="Metev_0431"
FT   CDS_pept        422390..422926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0431"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   mbu:Mbur_0855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73349"
FT                   /db_xref="InterPro:IPR002790"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D7E807"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ADI73349.1"
FT                   /translation="MKPVKSGLNSIVKYLSTKKETGRRNIGLLVDGPNVLRKEFNVNLE
FT                   AIRDVLKEYGNVKIGLVFLNQYASEKLVEAIENNGFEPVICSSDVDVRLAVEGTEMVCN
FT                   PNIDTITLVTRDADFKPLLNKANKHGKETILFGVEPGFSPALKNSADYVIMLNTEEMKL
FT                   THPNNLDDEKHPVSE"
FT   gene            complement(422945..424129)
FT                   /locus_tag="Metev_0432"
FT   CDS_pept        complement(422945..424129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0432"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   mbu:Mbur_0854 trans-homoaconitate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73350"
FT                   /db_xref="GOA:D7E808"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7E808"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADI73350.1"
FT                   /translation="MSKIEENSYSGNKLIDDLDLNPIDIEICDVTLRDGEQTPGVVFTK
FT                   EEKMNISNQLDSLGVEVIETGFPVVSSDEKDTVKQISNMGLNARTCCLSRALTSDVDSA
FT                   LDCNVDMVSIFVAMSDLHLIHKYNKSCEEMISCALDTIEYAKDHGLEVRFAAEDASRTN
FT                   VDTLKNVFLRAQDYGVDYVSLADTVGVLNPSTTYHLVNEINKSVETPICIHCHNDLGMA
FT                   TANTLMAAEAGAKQLHTTVNGIGERAGNAPLEEVLMGLLVEYNIDRYDTTGLTDLSRMV
FT                   EDYANITPPVNKAIVGKNAFTHESGIHVMAILENPRTYELFNPELVGGKRNLIVGKHTG
FT                   IKALKGIVKSMGYSLEHDELCELKEKVKNCTDIKHGISRNKLEEMIKDIKTHGI"
FT   gene            complement(424223..424996)
FT                   /locus_tag="Metev_0433"
FT   CDS_pept        complement(424223..424996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0433"
FT                   /product="1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate
FT                   (AIR) carboxylase"
FT                   /note="PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; KEGG: mmp:MMP0809 phosphoribosylaminoimidazole
FT                   carboxylase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73351"
FT                   /db_xref="GOA:D7E809"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:D7E809"
FT                   /inference="protein motif:PFAM:PF00731"
FT                   /protein_id="ADI73351.1"
FT                   /translation="MKLEDVLLKIQNGEMDIDSAANEIHSMSYTEVSDFAKIDSHRMCR
FT                   TGIPEAVLAEGKEPDDLVEIVKKQVDCAGRVLVTRVSAEQIAKLRSNFESDNIEWNERA
FT                   NAAVINNGTQCPETGGVVGILSGGTTDVGVAEEANIVASEMGCKTITAYDVGVAGIHRL
FT                   FPQISRLKETGVDAVIVAAGREGTLPTIVSGLIDVPVIGLPVSTGYGAGGLGQAALMSM
FT                   LQSCSVISVVNIDAGFVAGAFAAQIANKVAKARNG"
FT   gene            complement(425003..425845)
FT                   /locus_tag="Metev_0434"
FT   CDS_pept        complement(425003..425845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0434"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: mbu:Mbur_0853
FT                   NAD(+) kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73352"
FT                   /db_xref="GOA:D7E810"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D7E810"
FT                   /inference="protein motif:PFAM:PF01513"
FT                   /protein_id="ADI73352.1"
FT                   /translation="MKIKKIGLVSRLDHEGALEMTKSIIDEFSSVVEIAVSPNTAKEIG
FT                   IEDDVIRIEAIEDMRNTGVEFLIVVGGDGTVLLTLSRMYDPIPILGINMGKVGFLVDTE
FT                   PEEALSTIEKALHGFTYNEQIRLGVKLNGDILPPATNEIVLMTGRPAKILTTKVKIDDY
FT                   ELEELRSDGIVFSTPTGSTAYAMSAGGPIIDPRVNAALIVPLAPFKLSSRPLVVPADCV
FT                   INVETTIPEKEAILVIDGQHTYKIHENHVVTLTKADQPARFVKSSIYRFYDKIQYKLC"
FT   gene            complement(425847..426653)
FT                   /locus_tag="Metev_0435"
FT   CDS_pept        complement(425847..426653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0435"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: mbu:Mbur_0852
FT                   bifunctional inositol-1
FT                   monophosphatase/fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73353"
FT                   /db_xref="GOA:D7E811"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:D7E811"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ADI73353.1"
FT                   /translation="MAPYFSFFDLCNYAVSAVETAVKDLLGTQKAYETLYTGADGTDTK
FT                   LIDDVAERAIIEVLKKDGRSMRIISEEMGVKILGNNPEFTIIIDPIDGTYNASFCIPFY
FT                   SVSIAIGSPDLSYIWAGYVKNISSKDIYYAESGKGAYLNGKRISPSKKSELNECCASVY
FT                   GYRLHVERTVDLSRNIRRMRILGCVSLEICYVASGRFDAFVDVRGSLRLTDVAAGKFIV
FT                   DESGGRVTDGFADSIELQDNSIYHVYMIASNGIVHDKLLKLTGGIN"
FT   gene            complement(426665..427681)
FT                   /locus_tag="Metev_0436"
FT   CDS_pept        complement(426665..427681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0436"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type
FT                   II"
FT                   /EC_number="1.2.1.59"
FT                   /note="TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase,
FT                   type II; KEGG: mbu:Mbur_0851 glyceraldehyde-3-phosphate
FT                   dehydrogenase; PFAM: Glyceraldehyde 3-phosphate
FT                   dehydrogenase, NAD(P) binding domain; Glyceraldehyde
FT                   3-phosphate dehydrogenase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73354"
FT                   /db_xref="GOA:D7E812"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR006436"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7E812"
FT                   /inference="protein motif:TFAM:TIGR01546"
FT                   /protein_id="ADI73354.1"
FT                   /translation="MDKVKVGINGYGTIGKRVADAVHQQEDMELIGISKTKPNYEAVMA
FT                   QRMGYNVYTPSDKTSKMKDGGIKVAGTVEDMVNEADVIVDATPKGVGEKNKELYEKAGV
FT                   KAIWQGGEDHEVAGFSFNADSNYNEAIGRDYTRVVSCNTTALCRLISNIDREYGVKKCR
FT                   VTLIRRAADPSDIKKGPINSIVADPVKLPSHHGPDVQSVIPSIDISTMAVKVPNTMMHI
FT                   HTVNMELKNDCSADDIKNLLAKNPRMHYLEPGITSTSETMELARDLGRPRNDMWENCIW
FT                   EDSIDFYEGELYLLQAVHQEADVVPENIDAIRAMCELEKDADKSKSKTNKAMGIGTK"
FT   gene            427916..430132
FT                   /locus_tag="Metev_0437"
FT   CDS_pept        427916..430132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0437"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; UspA
FT                   domain protein; KEGG: mma:MM_0530 amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73355"
FT                   /db_xref="GOA:D7E813"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:D7E813"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADI73355.1"
FT                   /translation="MGFYVADIETSERLGRNLGFFSTFAIGTGTMIGAGIFVLPGMATA
FT                   AAGPAAILSFIFGGLIAMATAISAAELATGMPRAGGSYYFVSRAMGAVFGTIIGIGAWI
FT                   GLVFKGSFALVGFGDYFYTLFPSPVLITATIIGLLLLFINYKGAKSSGFLQNVIVIILF
FT                   IILSVFIIKGAFIIDPNKYHPVVPYGYSSIFTTTGLIFISYLGIIKLAAISEEVKDPSK
FT                   NLPRAFIGSVATVIVLYTGIMVVVNGVLPFEDAVNTETPLVDVAEVMLGPTGQIIIILA
FT                   GLLATLSTANAAIMSSSRFPFAMGRDDLVPHWFIHIHGKYNTPYRAIVITGLLMVILLF
FT                   IFNVEQLAKLGSAFNILVFVLVNLSAIILRRSAVNWYKPAFKDPFYPVTQIFGIAGSLV
FT                   LLPVIGVLPFIFAVAVIIAGIIWYNAYGKAKALPKYNLLDMIESSRITKDHKRMKILVP
FT                   IANPEHESDLVYLSENIGDDILGLHVRKVPNQTSLQAARDEYHEHKPEIDSLLENQFRR
FT                   CSVMEGCEHQYIVAFDHDVSNSIIEQGRIENVDLIVIGWHEGYSFIGDIAEKVLSCARK
FT                   DIAVLKGKLPSKINSITVAYNNKENTRYALYLVKQFAKRTGAKIKLVRVINPDLEVYQK
FT                   NREIEMIKETAQDDELEFNYEINESYHTKEAIIESAKKSDLLVIGDSSQRFSKALLGTL
FT                   SQNIAQDCDRPVMIVKRYRPITKEKIPYYCRLKFLKKKLFKMLR"
FT   gene            complement(430150..430341)
FT                   /locus_tag="Metev_0438"
FT   CDS_pept        complement(430150..430341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0438"
FT                   /product="RNA-binding protein, predicted"
FT                   /note="PFAM: RNA-binding protein, predicted; KEGG:
FT                   mbu:Mbur_0850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73356"
FT                   /db_xref="InterPro:IPR019300"
FT                   /db_xref="UniProtKB/TrEMBL:D7E814"
FT                   /inference="protein motif:PFAM:PF10133"
FT                   /protein_id="ADI73356.1"
FT                   /translation="MCELNAVLETGNERQVIMESVTRMVNNDGDIELTGIFGDKKTIKG
FT                   TIKEVDFSKGETIITQNS"
FT   gene            complement(430359..431240)
FT                   /locus_tag="Metev_0439"
FT   CDS_pept        complement(430359..431240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0439"
FT                   /product="protein of unknown function DUF89"
FT                   /note="PFAM: protein of unknown function DUF89; KEGG:
FT                   mbu:Mbur_0849 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73357"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR014444"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="UniProtKB/TrEMBL:D7E815"
FT                   /inference="protein motif:PFAM:PF01937"
FT                   /protein_id="ADI73357.1"
FT                   /translation="MKINPRCAHCLLTRVHYEARLSTDDEQLLHKAVMTGIDELNRTYK
FT                   PGKPAGEISTAVHQKVYEVLGDEDPYLELKKLSNKTAEDIFPVAQKRVYEDDVSDKELF
FT                   RRSVLASVIGNTFDFGVVGFDVAPEIFDETFKQTFENGLDVDDTSSMFEMLDNVVYVAD
FT                   NCGEILLDTIVFDIIKKLGGKITLVVRGAPILNDATLDDVYDYGIDKKVDRLLTTGSNA
FT                   IGVNFEEAPNELFEAFDNASLIISKGMANYETLSEYNLGPIAYLLKTKCESVASDLGLD
FT                   TGCTIAKLVNEQ"
FT   gene            431373..431720
FT                   /pseudo
FT                   /locus_tag="Metev_0440"
FT   gene            431942..433093
FT                   /locus_tag="Metev_0441"
FT   CDS_pept        431942..433093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0441"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: mba:Mbar_A1973 transposase; TIGRFAM:
FT                   transposase, IS605 OrfB family; PFAM: putative transposase
FT                   IS891/IS1136/IS1341 family; transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73358"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D7E816"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADI73358.1"
FT                   /translation="MLNHNNYGMLKAYKYRMYPNQIQQELIAKHIGACRFIYNWALENK
FT                   IKSYEQDGKAISRFELNKQIRVLKQDHEWLKEINSQSLQGATLNLENAFTKFFREKSGF
FT                   PKFKSKKNPVQSFSVPQYYKVDFGNNKVYIPKIGWIKTRLHRSFDGKQRTATITRTPTG
FT                   KYYISILVDDDKQLPQKQTFYEVNTVGVDVGIKDFAVTSDGEKIDNPRYLKNSIERLKV
FT                   LQKRLSRKKKGSNNYRKLKHQIAKYHEKIANQREDFQHKLSNKLISENQAVALETLNVK
FT                   GLLKNHNLAQHITDASWGSFVQKLEYKAEWYGKNIIKIGRFDPSSKICHVCGYYHQDLE
FT                   LKDREWECPDCKTIHDRDINASVNIKKFALDKQNLIGINSPSG"
FT   gene            complement(433204..433902)
FT                   /pseudo
FT                   /locus_tag="Metev_0442"
FT   gene            433996..435282
FT                   /locus_tag="Metev_0443"
FT   CDS_pept        433996..435282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0443"
FT                   /product="Gluconate transporter"
FT                   /note="PFAM: Gluconate transporter; KEGG: mma:MM_1331
FT                   gluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73359"
FT                   /db_xref="GOA:D7E817"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:D7E817"
FT                   /inference="protein motif:PFAM:PF02447"
FT                   /protein_id="ADI73359.1"
FT                   /translation="MNPVIIFLIALITVLVMTTKLRVHPFLSLITASIVVGILDGNPLD
FT                   ALNSVSLGLGRVFSQFAIIITCGSIIGLILFQTGGTAIIADDLIRFSRKPLFALNLLGF
FT                   LFAVPVMCSILAYVIFIPIAKDIGSRLNIPKASVAASLGLGTLASFNMVYPSPVIFSAA
FT                   EELGANTGEILLTGLPVAVIVTIVGYYYAKISCNFGPPPVINPSEAEDNTQGLPRINRI
FT                   EAYSPICIPVILILSGVIINEQTPLINFISNRNIALLIGVMLAFISARSLGLEQIKNRT
FT                   DKAVRRSGVVLLDMCGGGALGTTLSMTGIGKDLGQMFTTLNLPDIIIPFMVAVAIQSVQ
FT                   GSRIVTMLVAPSIVVPFLPELNLPASITLLSMASGTFLISHVNDPYFWIFGELIELKTT
FT                   EIFRSYTIGGVLMGFTGLVLTYISYTILY"
FT   gene            complement(435420..436997)
FT                   /locus_tag="Metev_0444"
FT   CDS_pept        complement(435420..436997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0444"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="KEGG: mdi:METDI5436 transporter,
FT                   betaine/carnitine/choline transporter (BCCT) family;
FT                   TIGRFAM: choline/carnitine/betaine transporter; PFAM: BCCT
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73360"
FT                   /db_xref="GOA:D7E818"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:D7E818"
FT                   /inference="protein motif:TFAM:TIGR00842"
FT                   /protein_id="ADI73360.1"
FT                   /translation="MKMKINPFVFFVSATVIVMFVVLGSLFTEFMKQFFNTLQNSIISY
FT                   FGWFYILSVAFFLIFIIWLYLSPYGNIKLGKDDDVPVFSNTSWFAMLFSAGMGIGLLFY
FT                   SVAEPVLHFSNPPGGIAPESIEAAKQAINLTFFHWGLHAWAIYIIIGLSLAYFGYRHDL
FT                   PLSIRSTLYPMIGDRIYGFIGNIVEVMAIFGTVFGVATSLGLGVLQINSGLNYLGVLPE
FT                   STFNQILLIIGITLAATMSVVSGLTKGIRILSEMNLAFGFLLMMFIIIVGPTIFLLSSF
FT                   VQGMGDYLQNLISLTFNTDAYQGIEWQKSWTMFFWGWWISWSPFVGMFIARISRGRTIR
FT                   EFIRGILIVPTIVTFIWVIAFGNTALYIELFGSGGLVQIVSESVPISLFALLENLPLTV
FT                   LTSTLATVVVATFFVTSADSGSLVVCILATGGDPEPSVYQRVFWAFSQGAVAAVLLLTG
FT                   GLAALQTAAITTALPFCIIMLFMCRSLVKGLRASHLETPKKSNVSSEGDRESESRPYQL
FT                   YRQIKENL"
FT   gene            437377..437592
FT                   /locus_tag="Metev_0445"
FT   CDS_pept        437377..437592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73361"
FT                   /db_xref="InterPro:IPR020073"
FT                   /db_xref="UniProtKB/TrEMBL:D7E819"
FT                   /inference="similar to AA sequence:KEGG:Mbur_1028"
FT                   /protein_id="ADI73361.1"
FT                   /translation="MVKIVHAQTVLAEEDLNSLKEKCNVSSTKDALSIAVQHYLECEYT
FT                   NTDDDMWTHKLEKVMQKKNQSTKNEE"
FT   gene            437617..438114
FT                   /locus_tag="Metev_0446"
FT   CDS_pept        437617..438114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0446"
FT                   /product="Protein of unknown function DUF1628"
FT                   /note="PFAM: Protein of unknown function DUF1628; KEGG:
FT                   mbu:Mbur_1027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73362"
FT                   /db_xref="GOA:D7E820"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:D7E820"
FT                   /inference="protein motif:PFAM:PF07790"
FT                   /protein_id="ADI73362.1"
FT                   /translation="MKNKLNNLMQNNEDAVSPVIGVILMVAITVILAAVIGSFVFGMGS
FT                   PEQAPQASIRGSAETIDSNNSIKIEHQGGEGIELDSASTKITVAGDKVDLTSSPDNRLE
FT                   TGDVLYIYNKSAGSDLKLANNTSMNNLGIAGSTETPTNVKIIDVASQQLIADMNVRLPN
FT                   NN"
FT   gene            complement(438386..438943)
FT                   /locus_tag="Metev_0447"
FT   CDS_pept        complement(438386..438943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0447"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="KEGG: tga:TGAM_1824 thermonuclease (nuc); PFAM:
FT                   nuclease (SNase domain protein); SMART: nuclease (SNase
FT                   domain protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73363"
FT                   /db_xref="GOA:D7E821"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:D7E821"
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /protein_id="ADI73363.1"
FT                   /translation="MNKISFKIIAIITVCLFLLILSGCIDADNNNVESNDTNLVTVIKV
FT                   VDGDTIDIRYSNGTTERVRLLGVDTPETHAENKPEEFEGIDNDSYLHEWGVKANNYTSN
FT                   ILEDKEVRLEYDDISDRRGYYGRLLAYVYLKNDTMYNRMLIKDGYARVYDEAEIEYMDE
FT                   FLELEKEARENKKGLWGVIGKS"
FT   sig_peptide     complement(438860..438943)
FT                   /locus_tag="Metev_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.992 at
FT                   residue 28"
FT   gene            440059..440427
FT                   /pseudo
FT                   /locus_tag="Metev_0448"
FT   gene            440702..441145
FT                   /locus_tag="Metev_0449"
FT   CDS_pept        440702..441145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcb:PC001359.02.0 3'-5' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73364"
FT                   /db_xref="UniProtKB/TrEMBL:D7E822"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73364.1"
FT                   /translation="MLTNEEVYIISQEFVNDFDERFKQIQYIISVYTKNPQFLPKSDDC
FT                   HFHKISKRISAYIFKYSKYFYCVRFKMDTRPFSAKIKKICKRLNIDFEYKNIVNLENVI
FT                   INMVSIIKEKYGLKTYIYKVDNYIIFDTYFREVKYSANSDSSD"
FT   gene            441120..441386
FT                   /locus_tag="Metev_0450"
FT   CDS_pept        441120..441386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yen:YE0551 sucrose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73365"
FT                   /db_xref="UniProtKB/TrEMBL:D7E823"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73365.1"
FT                   /translation="MPTVIAAINYSEIVVKGNSPYPMEQNAYFLVEEDDVDIAIVNDIQ
FT                   EAIDEYKKNNPYWMYEQITVLVEKKLLEAGLTLMPATYTSVYF"
FT   gene            441508..441630
FT                   /locus_tag="Metev_0451"
FT   CDS_pept        441508..441630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73366"
FT                   /db_xref="UniProtKB/TrEMBL:D7E824"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73366.1"
FT                   /translation="MPMRERSEEEAEQYPRKDQIAQHKDCRYFDPVFLISVFAG"
FT   gene            442087..443724
FT                   /locus_tag="Metev_0452"
FT   CDS_pept        442087..443724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0452"
FT                   /product="phage/plasmid primase, P4 family"
FT                   /note="KEGG: hmo:HM1_2896 primase, putative; TIGRFAM:
FT                   phage/plasmid primase, P4 family; PFAM: primase P4; D5
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73367"
FT                   /db_xref="InterPro:IPR004968"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7E825"
FT                   /inference="protein motif:TFAM:TIGR01613"
FT                   /protein_id="ADI73367.1"
FT                   /translation="MSGTVNLTENYSTEDKTTYSKITNDKKVETSNIPDLTVMKRCRQN
FT                   NEFFDSLCNGYITELGYTQEGAVREFITLLASQTRDPNQIERIFDGSGLNNGFDDIIKN
FT                   KIIDEVLENTEPTRAKKDDPYNKYFSKKGKFVVKYLAEEILRENHFFTLKDTKEVYYYQ
FT                   NGVYLPNGIDEISKQVQDKLDEHYRKSYKKEVIDYIKTKALVDRESINNNKYIINLKNG
FT                   LYDVSKGKFLPHSPKYMSTIQLPVYYKPEAECPNIEKFLSDVTKSDKDKQLIFEWIGYT
FT                   LIPNTRLQKFVMFYGPRDGGKSVLIKLITCLLGNYNVSGESLQNLENDDFSIANLEGKL
FT                   LNAFPDLPDYGFYQNSVIKIMTGDDGYIRVNIKKVQPYKTTITARLMFSTNNLPVIKNP
FT                   DEAFFKRLMLIEFPNTFQGDSKDVNLIDKLTTSEELSGLLNKAIAALERLLKNGEFSYD
FT                   LNPLENMELYQKLSNPVAKFADECVGESNEYTFKVDMYNAYVEWCEKEDIVPLKKNEFG
FT                   KQFKNLGYRDSRLNTGDRSYCWDGVSLI"
FT   gene            445335..447464
FT                   /locus_tag="Metev_0453"
FT   CDS_pept        445335..447464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0453"
FT                   /product="signal transduction histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: histidine kinase
FT                   dimerisation/phosphoacceptor; PAS fold-4 domain protein;
FT                   PAS fold domain protein; ATP-binding region ATPase domain
FT                   protein; KEGG: mma:MM_2277 sensory transduction histidine
FT                   kinase; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein; ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73368"
FT                   /db_xref="GOA:D7E826"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7E826"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADI73368.1"
FT                   /translation="MNEGVCFHEIIYDKKGSPVDYLITDCNPAYESIIGLKRHEVIGQK
FT                   ASEVYGAGEPPYLSTYAKVAETGEQTYFETYFPPFDKYFKISAISPEKGKFVTIFNDIT
FT                   EYKNLKDDLQRTINEFNYLFDSMEDALFVGDLEGNILDVNETAVKRLGYSKQELLSMNI
FT                   KDIDELYDEDGINDNILNLPENGKQKFESVHITNNGTRIPVEINSNLIKYKEKTAVLSV
FT                   VRNITDRKNAEKLIQRKIQEQKALLSSTPAYVYLKDSKLNYLTANDAFCKVVGFSIENI
FT                   KGKNDFDFLPEKEAEKYRSDDTSVMESRKPIYNLEEKYTTSEGEIRWALTSKVPYFDTE
FT                   GNVIGIVGSSLDITERKRMYEKLERAEYEKRALLNSTSEIVVYHDLEGKILWCNKAATK
FT                   FTGLNCRDMIGQYCYKLLYNKSEICDNCPIYEIVKTGKHYEETVTFTNKILNVKKDPVR
FT                   NTSGDIIGIITVTNDITDRVKTEEKIEKYAEELEKINIELEHRVRKQTEDIINAERTRE
FT                   LELHHRIKNNLQVISSLLSLQSEKFTDDEVKDAFIDTQNRVKSMSLVHNKLYQTKGLEN
FT                   VNSKDYIEDLVDHLVGLYGGSNITIKIDVQDIYFGIDTIIPLGMIITELLSNSLKYAFF
FT                   DDEQGEVYIGLYRNEEGNYKLIVADNGKGFSEDIDIEEPNTLGLQLVNSLVDQINGDFE
FT                   AETINGTKFVIEFNN"
FT   gene            447977..448180
FT                   /locus_tag="Metev_0454"
FT   CDS_pept        447977..448180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0454"
FT                   /product="deoxyribonuclease/rho motif-related TRAM"
FT                   /note="PFAM: deoxyribonuclease/rho motif-related TRAM;
FT                   KEGG: mbu:Mbur_0304 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73369"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D7E827"
FT                   /inference="protein motif:PFAM:PF01938"
FT                   /protein_id="ADI73369.1"
FT                   /translation="MFNRDDSAPVRSGERYDVEIENIASKGDGIARVGGFVIFVPDTSV
FT                   GDEVTIAVTKVMDNFAFGEIAQ"
FT   gene            448415..449758
FT                   /locus_tag="Metev_0455"
FT   CDS_pept        448415..449758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0455"
FT                   /product="Deoxyribonuclease I"
FT                   /EC_number="3.1.21.1"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   mba:Mbar_A2969 hypothetical protein; SMART:
FT                   deoxyribonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73370"
FT                   /db_xref="GOA:D7E828"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR016202"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D7E828"
FT                   /inference="protein motif:PRIAM:3.1.21.1"
FT                   /protein_id="ADI73370.1"
FT                   /translation="MKKITKILIIMLLFTSIAALGCTENSDTGVDGTNQNDDNTETENP
FT                   NQDNDSKEASLNESDTLRIGAFNIQVFGTSKASEPETMNTIAKIIRNYDIIAIQEIRDK
FT                   SENSLPQLVELVNEGDYNYDFVMSERLGRTVSKEQYAYIYNTATVDISNNPHTYPEPEG
FT                   TDPFHRQPYIASFEAVNGNFDATFITVHTDPDEATEEINALDSVVEYTHEKYSEERDFI
FT                   VMGDLNADGSYFDEDLDSTMHNDYYYWCIGDDIDTTTGSTDYTYDRIIITEPAMEDFTD
FT                   DAHIYRYDDKYDLKHDETMDVSDHYPVYATFWTNKDDDNITSNYTPSEQTLTSENNGYI
FT                   NDSSTEDHEDVYISDLSLEDEWVKITNPGETSVDLNNWKIEDEANHAYEFTDFTLGPNN
FT                   TVTLYTDEGTDAENQLYWGSGRAIWNNDGDNAYLYDSTGELVDSYQGD"
FT   sig_peptide     448415..448480
FT                   /locus_tag="Metev_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.925 at
FT                   residue 22"
FT   gene            450057..450593
FT                   /locus_tag="Metev_0456"
FT   CDS_pept        450057..450593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A3219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73371"
FT                   /db_xref="GOA:D7E829"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D7E829"
FT                   /inference="similar to AA sequence:KEGG:H16_A3219"
FT                   /protein_id="ADI73371.1"
FT                   /translation="MSDKKIDADFIKYWMPFYDKPDIGADYSEYTSIMNKVHRDVANGT
FT                   IYESTFKDILDWKAARIKGKVDWNNFEYYDNTFKEMLKAEDDAKLSILCQLDGIGVPTA
FT                   STILHFIYPERFPIIDYRVMEVLNNFGYLNTKNATSESNYHKYRNVILNIAAESNCSLS
FT                   ELDRALFAYHKENLD"
FT   gene            450613..451050
FT                   /locus_tag="Metev_0457"
FT   CDS_pept        450613..451050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0457"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="KEGG: mbu:Mbur_0266 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73372"
FT                   /db_xref="GOA:D7E830"
FT                   /db_xref="UniProtKB/TrEMBL:D7E830"
FT                   /inference="similar to AA sequence:KEGG:Mbur_0266"
FT                   /protein_id="ADI73372.1"
FT                   /translation="MTVVVILNDGWVSSNTLGKGKPFYWKLDDDCNIHIKREIKNWKIE
FT                   TVSYDHLNKLNNYMGSGDWVGLKNNVKKLSNGTEDDGIGTFLYNLHEDTSYAQLSSHLS
FT                   ALFNYAGIWEHNGYSRNMEFKLKSDNWCRDIKKYYQQKSRE"
FT   gene            451089..452072
FT                   /locus_tag="Metev_0458"
FT   CDS_pept        451089..452072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0458"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssp:SSP0040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73373"
FT                   /db_xref="InterPro:IPR029470"
FT                   /db_xref="UniProtKB/TrEMBL:D7E831"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73373.1"
FT                   /translation="MNIFTALSQGRGSLNEENMSAMLGYLLSPEQSHGLNDVFLKKFLS
FT                   SVAEIKDGQLHDLDNLLLSKDEIKVEVNFEQPYSYHGYSRYVDIDIRIFDNHYNELYRL
FT                   IIENKIKPASSSSNQFKEEYEAVISDIEENSENSHPKVIMIFLTPTGRHSQLLNEYENL
FT                   SQDMLGKNEKVWVYWADDENTITDLLRQILKDESEVKIDPITDYTKHTLKAFIRHIQET
FT                   NIKYTSPGKVDHKPGGIVDFAYAKISDGYYKIEKYESTTIKVFNLDLQRYEVAKPILRK
FT                   VNDEKNLGVNLYLSTNNERNTRSLGNMVIKKLKQQNKDDKPSNDDL"
FT   gene            452184..452573
FT                   /locus_tag="Metev_0459"
FT   CDS_pept        452184..452573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A0604 phycocyanin alpha
FT                   phycocyanobilin lyase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73374"
FT                   /db_xref="GOA:D7E832"
FT                   /db_xref="UniProtKB/TrEMBL:D7E832"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73374.1"
FT                   /translation="MSSFETGAWLPSAIMQTVGALYGVFIAIIILTVQRMGAKSSSSNQ
FT                   KDWNTDINKFKEKILPNFKVIVIVIGITEISNGLILGYGINHKLPNWALSLSYITYVIS
FT                   TLAILLFSYWLAKHAFDDFRQFQNR"
FT   gene            453237..453830
FT                   /locus_tag="Metev_0460"
FT   CDS_pept        453237..453830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smr:Smar_0078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73375"
FT                   /db_xref="UniProtKB/TrEMBL:D7E833"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73375.1"
FT                   /translation="MNHKIELNKDNIIFYKKDRGIDGQEIESKQNISYDVFEKMDWRIN
FT                   VKDIVPNISSSGDIQKITLHISDYETFEKESKNREKIEQKQQDIEKSVIINRDTISWNK
FT                   YNQILINTAEWLYKKGYLYESKLPIYVSKGKRYLLNSVPKHDYGKDFQAKHKISDNIWL
FT                   NIHFSARDCKRHAETLMNKLAPSIDYEIRGFDLN"
FT   gene            453976..455073
FT                   /locus_tag="Metev_0461"
FT   CDS_pept        453976..455073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0461"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mfe:Mefer_1324 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73376"
FT                   /db_xref="GOA:D7E834"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7E834"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI73376.1"
FT                   /translation="METELNFAIQRNSNSSLEPWEINNEGQHGALVLRYRDCNLSCYLC
FT                   YFQPYAYLNRTTSRRPVTSSLETCVNQLNNLDRSIGWVRIQGGEPLLNDSRSKSTSILA
FT                   GEVLNHIVSNNLSSYENPRIIIQTNGIWLGNASVDKIDEFVQKIVEYLENVGYGKIVLE
FT                   ISFKGSNREMANSYAKSINTTNVDDVLATQISGYNKLHESIKNNAWDNDINRLAIYPIA
FT                   GFGPEINNPGIIPIQKIENSEYPIFHPDTWDENFSRVIDDFRNTLSTNESVYQDYLNSH
FT                   GNKIPMESMEPRRFQSGWIARINDRPQLRAFAENNLRIIRAPRLNIFMNNIGFVPEADE
FT                   NLIQKVGELREVFYEADPKSHYPYL"
FT   gene            complement(455236..455907)
FT                   /locus_tag="Metev_0462"
FT   CDS_pept        complement(455236..455907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcb:PC000075.01.0 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73377"
FT                   /db_xref="GOA:D7E835"
FT                   /db_xref="UniProtKB/TrEMBL:D7E835"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73377.1"
FT                   /translation="MINVVDYLIANPSLITAIATVLLAFVTAILVAFTGYYAKKTSEMV
FT                   EHTKINVEKTDELIEQSYIDRKVAFNEKKLKNFYYPLYDYFTNDLNLVEINTDRIFPNP
FT                   EENFDLKTIKVKAALGIEESIEVFKDDSYLSLTPLNRYASQHDYLNYMNVPQKLEHVIS
FT                   HRYLAEKKLREQLNYLLDIIYNKKNMDKAEMDNFLVNFQQLIDSDINEIEAELNKLIDK
FT                   K"
FT   gene            456142..458181
FT                   /locus_tag="Metev_0463"
FT   CDS_pept        456142..458181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0463"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: mba:Mbar_A1016 type I
FT                   restriction-modification system methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73378"
FT                   /db_xref="GOA:D7E836"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7E836"
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /protein_id="ADI73378.1"
FT                   /translation="MSNFQEKANFIWSVADEVLRDDFKRGKYRDVILPFTVLRRVECVL
FT                   EPTKDNVIQTYENVKDKVKDPHNALCHAAGHSFYNTSPYDLKKLLDDPSNIGQNFKSYI
FT                   NSFSENMRDIFDKFYLWNYIDQLIEDNLLYMLLEKFSNVDLHPDSVSNHEMGYIFEELI
FT                   RRFNEDVNENPGEHFTPREVIRLMVNLIFYQDEAKLGHNTPIRTIYDPACGTGGMLTIA
FT                   NDHILKEINSNADIWLFGQEVNPETFAIAKSDMMLKGNDRDAENIKMGSVFSNDGHPNE
FT                   TFNYMLSNPPFGKDWKKEQNFILEEAKSASSRFTAGLPRKDDGQLLFLQHMISKMKRPE
FT                   DGGSRIAVVTNGSPLFTGDAGSGESEIRRWIIENDWLEAIVALPEQLFYNTGINTYVWI
FT                   VTNRKEDHRKGKIQLVDARECYQKMRKSLGEKRHEISSEQIDTITNLHNNFNEGQYSQI
FT                   FDNHEFGYRKITIEQPLRLSFQVTPERIEQLKEQKAFKNLAVSKKRKNTEEKEKEEAEG
FT                   QKLQDSIIEMLSEMDSEKFYKNRDEFWKVLNDNLKKHGININNTVEKAILDSMSERDET
FT                   ADICVDSKKRWEPDSQLRDYENVPLDEDIYDYFEREVKPHVPEAWIDESKTDQYDNDVG
FT                   KVGYIINFNRYFYEYEPPRPLEEIESDINDLENEILELLQEVSH"
FT   gene            458178..459563
FT                   /locus_tag="Metev_0464"
FT   CDS_pept        458178..459563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0464"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: cyh:Cyan8802_3989 restriction
FT                   modification system DNA specificity domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73379"
FT                   /db_xref="GOA:D7E837"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D7E837"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ADI73379.1"
FT                   /translation="MSGVVQEQRQKFFDTSGFKPYPEYKDSGIEWLGEIPEHWDVKQLR
FT                   RVIKSLKNGTTAPQLDSGTTNYPVTRIETISNGYINYNNVGYLKENDVDKRYILNKDDI
FT                   LISHINSLEYIGNCAIYKDNETLVHGMNLLRLIPDDNIIPDFLIYYLKSKNFKYSARIH
FT                   AKPAINQASVSSTVLKSLKFSYPSNFNEQKSIANFLDKETHKIDKLIEKKQRLVELLEE
FT                   KRSALINHTVAKGLDPDVEMKDSGIEWLGEIPEHWDVVKLKYLLRSKVTDGPHESPAFV
FT                   DNGIPFLSADSIQNGKLKFENCRYVPYEDHIRYIRKCKPEKYDLLLGKAASVGKVALVD
FT                   VDFEFSIWSPLALIKPDTRELNSKLLYYVLRSRYVQKQIDMLNHTNTQDNLGMKEIENL
FT                   KIILPSVSEQKQIADYLDQRTSKIDELINKINHQIEYLKEYRTALISAAVTGKIDVRGE
FT                   EQK"
FT   gene            459560..462526
FT                   /locus_tag="Metev_0465"
FT   CDS_pept        459560..462526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0465"
FT                   /product="protein of unknown function DUF450"
FT                   /note="KEGG: mba:Mbar_A1014 type I restriction-modification
FT                   system restriction subunit; PFAM: protein of unknown
FT                   function DUF450; type III restriction protein res subunit;
FT                   SMART: DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73380"
FT                   /db_xref="GOA:D7E838"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:D7E838"
FT                   /inference="protein motif:PFAM:PF04313"
FT                   /protein_id="ADI73380.1"
FT                   /translation="MRTTVSENTFENDIVQTLVNQKGYIHRKNSDYDKELCMDPEMVIE
FT                   FIWATQSKEWEKLEKQYGEQVKERFLERLQKNIERRGTLDVLKKGIKDRGCRFDLVYFK
FT                   PETTLNVEHQDRYKANRFSVIQQLHYNTKNEKSIDLVLFINGLPIITSELKNPLNEQNV
FT                   EHAIHQYRKDRSPKEPLLSPRRCFVHFAVDTDLVYMATKLKGESTKFLPFNRGYENGSG
FT                   NPPPEDPEKYKTYYLWEEIWDKDMLLDIISDYIVLLDDDEYIFPRYHQLKAVNSMIENA
FT                   RLNGPGHRYLVQHSTGSGKSFTIAWLCNKLSGLHDENNNRIFDSIIVITDRRVLDQQLS
FT                   STMFEFEQVRGTVEWIDSNKKSEQLKQALESNKEIIVVTLQTFPFLVDEANQLSDRNFA
FT                   IVVDEAHSSQSGETARGSRKVLVSADDVQYEDEMEKDVEDVINSEIEKTVGPAKNISYF
FT                   AFTATPKQKTLELFGTKMPDGSYEPYHLYSMKQAIEEGFILNPLENYTTFETYFELKKK
FT                   IEDDPEYDRTTAYGLLRSHVDSSKPAISKKTSIMLDHFYNNIMTRIGGKAKAMVVTSSR
FT                   ANAVKYKLEFDKQINDNGYPFEALVAFSGTVEGNDVEKVYSDYEFTESKMNGFPDSKTS
FT                   QYFDENDDYRILIVANKFQTGFDQPLLHTMYVDKKLGGVNAVQTLSRLNRIHPEKHDTM
FT                   VLDFANDAEDIKKSFENFHVKTTLSEGTDPNKLHDYEDALKDFRIFTEDDVEKFAQEYF
FT                   STSGTQAKLYSILEPVIQEWESRPEEERKDFKKQMQSFTRLYAFLSHIMTFRDTELEKL
FT                   YQFSRFLVKKLKIGYKRLPTEILDCVDLESLRISEDSKGSIVLTDKEGELKPISDMGTG
FT                   TTREEELAPLSEILNELNERFGTEFTEDDRVAQVIEDMRDRLLKTEKLQRAANPEINSK
FT                   DNFARTFEWFFDDEVENLINTSLDLYKKMSDDGDLRHNVKQALLKDIYSKLVESDNRK"
FT   gene            462540..463058
FT                   /locus_tag="Metev_0466"
FT   CDS_pept        462540..463058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0466"
FT                   /product="TATA-box binding family protein"
FT                   /note="PFAM: TATA-box binding family protein; KEGG:
FT                   pto:PTO0506 transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73381"
FT                   /db_xref="GOA:D7E839"
FT                   /db_xref="InterPro:IPR000814"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="UniProtKB/TrEMBL:D7E839"
FT                   /inference="protein motif:PFAM:PF00352"
FT                   /protein_id="ADI73381.1"
FT                   /translation="MEIVNVVATVKLNSYLDLASLEDALQDTQVVSTSKVWLKMRLMPE
FT                   NYYVAFYKSGKFLITGVKSTEDISTISNRVLDILKNAGIDVDIEDTYIQNIVAVDKIEM
FT                   NSTLEKIIYNLDPSKSSYEPEQFPGLIYKNWGASFLLFSSGKVVITGVKDENYLDDLIT
FT                   KFKNEISFE"
FT   gene            complement(463061..463789)
FT                   /locus_tag="Metev_0467"
FT   CDS_pept        complement(463061..463789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0467"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcr:Pcryo_0666 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73382"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D7E840"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73382.1"
FT                   /translation="MTEFCSTTGVSHHLEQIIKNADDKLIIVSPYLQINERLKDLIQDK
FT                   DRMKIDIRVIYGKNDLKPEENNWLKSLNSIRTNFCKNLHAKCYLNDKEALITSMNMYRY
FT                   SEVHNNEMGIYVSKDSDPKLYSDIYDEAKRLIRYSEEDINSNDKSTSDVFKKQSNTKNN
FT                   SNKSDNGYCIRCGDSISLNPMYPYCKKCFSTWKKKGDENIEESACHICGKSNKSNISKA
FT                   KPTCYNCYKKYKDTYEFPLG"
FT   gene            complement(464437..464601)
FT                   /locus_tag="Metev_0468"
FT   CDS_pept        complement(464437..464601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73383"
FT                   /db_xref="UniProtKB/TrEMBL:D7E841"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73383.1"
FT                   /translation="MNDVEKNSFDDCVRCDVDLKDDDTYYTFYKLKNNSIKKGAMYCEN
FT                   CMLNEYKED"
FT   gene            complement(464594..464761)
FT                   /locus_tag="Metev_0469"
FT   CDS_pept        complement(464594..464761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00275 serine phosphotase RsbU sigma
FT                   factor regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73384"
FT                   /db_xref="UniProtKB/TrEMBL:D7E842"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73384.1"
FT                   /translation="MNCSKCNKPMGVESYLLSTGLVRKEPDEDGDIQIMGEVTGSSLLC
FT                   PNCIPSEINE"
FT   gene            464951..465505
FT                   /locus_tag="Metev_0470"
FT   CDS_pept        464951..465505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rhi:NGR_c19200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73385"
FT                   /db_xref="UniProtKB/TrEMBL:D7E843"
FT                   /inference="similar to AA sequence:KEGG:NGR_c19200"
FT                   /protein_id="ADI73385.1"
FT                   /translation="MDEKERSYRKIEIKHLQKLKDISVNDQNIFFNKNPKYEFFRDRLF
FT                   CILLVQGAALHYVNGTNGIKDFDILLLYKQNLEEKDENGKLIKIPYRRLIAYDCGMPEF
FT                   GRYPHDDINQYPNRRVDVLIREIGEDLTDNYDLITGIRKYFETGNTPSIKQWKNKDVVG
FT                   IWPEEIQGDLVWNTKSHSDNY"
FT   gene            complement(465651..465833)
FT                   /locus_tag="Metev_0471"
FT   CDS_pept        complement(465651..465833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0471"
FT                   /product="E1-like enzyme family protein"
FT                   /note="KEGG: ddi:DDB_0232142 E1-like enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73386"
FT                   /db_xref="UniProtKB/TrEMBL:D7E844"
FT                   /inference="similar to AA sequence:KEGG:DDB_0232142"
FT                   /protein_id="ADI73386.1"
FT                   /translation="MFGFCPECGTSSYVVSDKEYKHFLEKHPSNPDYYGVFYKNNHDSE
FT                   NEMVKKSYSYYNKLY"
FT   gene            complement(466090..466272)
FT                   /pseudo
FT                   /locus_tag="Metev_0472"
FT   gene            complement(466291..467139)
FT                   /locus_tag="Metev_0473"
FT   CDS_pept        complement(466291..467139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0473"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: smr:Smar_1162
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73387"
FT                   /db_xref="GOA:D7E845"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:D7E845"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADI73387.1"
FT                   /translation="MAHEAIKNLSAYVKYEDFLDLEQLAKDLEEDCALKKAREGDYSLL
FT                   VRLLFFTGARISEIVGVPRRVYTQCLFPGNRKRKGNCPKWSVAKDDRICIDEECRFFST
FT                   YIQKYHHGIRVKDIAFKDRLIAIYGKSVKTEELKPRTVVVDQKTLDIIQEHINRYSLKP
FT                   DDKIINLNENGAKVFINKLKKESKIPWLSAHKFRHGHAIYCIQNGMDIRTLQLQLGHTD
FT                   LATTAIYLQFAIDDRTKVYDKVFSAKPDYIKLQCPSCGFQYKIKKDGQINLEDKLKTIF
FT                   D"
FT   gene            467224..467679
FT                   /locus_tag="Metev_0474"
FT   CDS_pept        467224..467679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0474"
FT                   /product="Protein of unknown function DUF1628"
FT                   /note="KEGG: mbu:Mbur_1027 hypothetical protein; manually
FT                   curated; PFAM: Protein of unknown function DUF1628"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73388"
FT                   /db_xref="GOA:D7E846"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:D7E846"
FT                   /inference="protein motif:PFAM:PF07790"
FT                   /protein_id="ADI73388.1"
FT                   /translation="MGLSPVIGVILMVAITVILAAVIGSFVFGMENPESAPQASIQGSA
FT                   YSDSDGDDIVMISHQGGEEIDLHNNVRITMSGNDVNIGSDNVSKWFKAGDKLYIISNSS
FT                   SYFLVNSTNLNAVNADSGIATDNNRPEVNIIDIPSQQPIANFNLRFQ"
FT   sig_peptide     467224..467313
FT                   /locus_tag="Metev_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.821) with cleavage site probability 0.728 at
FT                   residue 30"
FT   gene            468030..468605
FT                   /locus_tag="Metev_0475"
FT   CDS_pept        468030..468605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0475"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73389"
FT                   /db_xref="GOA:D7E847"
FT                   /db_xref="InterPro:IPR026350"
FT                   /db_xref="UniProtKB/TrEMBL:D7E847"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73389.1"
FT                   /translation="MSEFVIFNGIYETLAGLIFYILGLILLLSFLVVVKIKLSQTKTDR
FT                   VFNNVSEFLENETYFRHGKHKTEKDYQQNLEGKLEVLTERHGYNIKYEAVPKNGKYRVD
FT                   FVVENLVGIEMKFYQGGHKIEEQLCRQIINYSKYYPKMIGLVLNSTNKNDKDLKKEIEE
FT                   IMDNLNVIGKKDYRIIVKSIGKSSQKKD"
FT   gene            468656..469222
FT                   /locus_tag="Metev_0476"
FT   CDS_pept        468656..469222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0476"
FT                   /product="Glycerophosphoryl diester phosphodiesterase,
FT                   membrane domain protein"
FT                   /note="PFAM: Glycerophosphoryl diester phosphodiesterase,
FT                   membrane domain; KEGG: mbu:Mbur_1249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73390"
FT                   /db_xref="GOA:D7E848"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="UniProtKB/TrEMBL:D7E848"
FT                   /inference="protein motif:PFAM:PF10110"
FT                   /protein_id="ADI73390.1"
FT                   /translation="MDVEGLLKNTWYVFRDNFVAFVVGSIVAVIGSILIVTIAPLFYGL
FT                   TYMALKGVKGVKVEINDVFEGFHHFAKSWIFAIITGVLLFIGYMAFVIPGVILSILLVY
FT                   ALPLLVIKDYNSIDAIRESISFSRENLADTLVIFVIGAFINFVGGAITFGFILSLPFAT
FT                   ILYTKATKSLIKEHETYPETEVVGG"
FT   gene            complement(469224..470684)
FT                   /locus_tag="Metev_0477"
FT   CDS_pept        complement(469224..470684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rci:RCIX355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73391"
FT                   /db_xref="GOA:D7E849"
FT                   /db_xref="UniProtKB/TrEMBL:D7E849"
FT                   /inference="similar to AA sequence:KEGG:RCIX355"
FT                   /protein_id="ADI73391.1"
FT                   /translation="MNLKFLKSSDAVSSVVGMVLILGITMISISAMMVYSYPTIYELED
FT                   DAKAQRVEQGLTVLDSRTSKVALGESPGQTTDISLMGGTINVNGETEDYNKSKMVVVST
FT                   DIDASWYDDFKKVRHQWGCWENYTDNDGFIKFNCSLGSIEYIKDGRKVAYEGGGVWSKY
FT                   PEGNAIMISPPEFHYNGETLTLPLMKVNGDSSVSGKGKVSISMNSDNIPEVLYPNTTAD
FT                   KNRTNPLKSDKIFVYIKSKYYRAWADYASSQTYSSSLVDTENNTAIIELETIPPQGTST
FT                   LTDSFKVGALNTSKDEPMYDFSFDLVAEGSQKLNPSDFKIKASSGNKTLTYRLKKSGGT
FT                   EVQIWVEYEDITVKPDYKEHWTGVDTFPNEKEVIVNFLNDSFVMEYTPPSSDGSNPDFS
FT                   WNKSSDISIPPDVVINDGNTSFTLNDLSQHYLKLITRNGTITFDITWPGNSNPVDFDES
FT                   SIVLGYDSMPGSITYLHVTKNELMADVY"
FT   gene            complement(470705..471475)
FT                   /locus_tag="Metev_0478"
FT   CDS_pept        complement(470705..471475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0478"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rci:RCIX343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73392"
FT                   /db_xref="GOA:D7E850"
FT                   /db_xref="UniProtKB/TrEMBL:D7E850"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73392.1"
FT                   /translation="MTLKTLKTSDHAVSEVVDFVILLGVMLLAVSVIGVAGFPLLDHMQ
FT                   EVEHTENIKQSYTVLAANINEIVFGNAPSQSIELQMRGGSLSITGNSLMNITLKRWNST
FT                   SNSYEYQVFERQMRIIENRFEGTSICYENTGTWAKYPTGESIAITQPRFSFNKDVLVMP
FT                   VTLVSGSSSQSGQGIVRVVSDGGHSNVYSYQNVSEVDVRITSKYYEGWGTYFDDTMNMD
FT                   VAVYDVNNTINAHKNYSDNIDVHIVYSPMSATIE"
FT   gene            complement(471511..471975)
FT                   /locus_tag="Metev_0479"
FT   CDS_pept        complement(471511..471975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0479"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73393"
FT                   /db_xref="GOA:D7E851"
FT                   /db_xref="UniProtKB/TrEMBL:D7E851"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73393.1"
FT                   /translation="MIKRFLKDDSAVSVSVGSILIFSISVLAFIMVMNSFFSMMDQTEE
FT                   TVTREEFETYGNDMALQLTNVDTIISNTGKSGVNSLKYEFTIPDKVAGEYYSVNFSNKS
FT                   NEITFESQNQVKVKVPYSVCNTQVETTTIYSSSTNHYFFYNSSKNLIEVH"
FT   sig_peptide     complement(471889..471975)
FT                   /locus_tag="Metev_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.933 at
FT                   residue 29"
FT   gene            complement(471984..472835)
FT                   /locus_tag="Metev_0480"
FT   CDS_pept        complement(471984..472835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0480"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpd:MCP_0262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73394"
FT                   /db_xref="GOA:D7E852"
FT                   /db_xref="UniProtKB/TrEMBL:D7E852"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73394.1"
FT                   /translation="MFNEDDSAQMILITGFAIGISIVFLTVMLNNVIYSSNMASESSID
FT                   TYRFDYSNAIKISSDAAEDAFINATDNQSFNSDIFNQYMSSYVQRISNLYAYSGLAVSV
FT                   KNSSVEDAYLTDNGIKNGNSNWTIVDNINTTDNFLLYLSNNTGAQGDQNNSFKISAINQ
FT                   SDTLIWSIELYNESGDINVTVTNRTDTITTDTKSDIYQMDIINNSIDGNSFSFNFDESI
FT                   NNDGYYLKINNGRYLIGQVVLSGKLINNQDFTVKRLKVTRLYINMSSNSKQVNATVPVT
FT                   LP"
FT   gene            complement(472848..473465)
FT                   /locus_tag="Metev_0481"
FT   CDS_pept        complement(472848..473465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpd:MCP_0261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73395"
FT                   /db_xref="GOA:D7E853"
FT                   /db_xref="UniProtKB/TrEMBL:D7E853"
FT                   /inference="similar to AA sequence:KEGG:MCP_0261"
FT                   /protein_id="ADI73395.1"
FT                   /translation="MDISRLQISLKNDDTGQMHTLEAVMAAIIMVSVVVFAVQATSLTP
FT                   LTSSTANTHIETQLQTMGYDIMDSLDHSEYGHESRLKTDLLNWSGNVYIWNGSSYVAKS
FT                   NQSKQLNSSTSKMLENVLVKRGIAHNIHFIYIEEDGERIRSPYIYNGEPSDNAVIVSRK
FT                   IVISNPDISDISKFSSKTGINDLNNSTDFYNIVDIQLTLWRI"
FT   gene            complement(473467..473937)
FT                   /locus_tag="Metev_0482"
FT   CDS_pept        complement(473467..473937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rci:RCIX336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73396"
FT                   /db_xref="GOA:D7E854"
FT                   /db_xref="UniProtKB/TrEMBL:D7E854"
FT                   /inference="similar to AA sequence:KEGG:RCIX336"
FT                   /protein_id="ADI73396.1"
FT                   /translation="MKTKNEFDDKGQLTLDYLIAITFFLFAVFFVFQYASGLFTPLQSN
FT                   SNEVTLIADRTATELVENTLSDNTESTNNFVDKDKIDDFFNNTSQYHNILGLNGSYFTY
FT                   RLNVTLENNTSIIRSTGDPVPSYKDIGQTKRIVIFRDEGNNLKSQILSVRIW"
FT   gene            complement(473969..477115)
FT                   /locus_tag="Metev_0483"
FT   CDS_pept        complement(473969..477115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0483"
FT                   /product="flagella protein"
FT                   /note="PFAM: flagella protein; KEGG: mbu:Mbur_1246 flagella
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73397"
FT                   /db_xref="GOA:D7E855"
FT                   /db_xref="InterPro:IPR006752"
FT                   /db_xref="UniProtKB/TrEMBL:D7E855"
FT                   /inference="protein motif:PFAM:PF04659"
FT                   /protein_id="ADI73397.1"
FT                   /translation="MGKEKNENDYGDNNHQTDEKESPPEPPSFDDVPDLSALASENNDD
FT                   NESEKSSGCNEQSSFGQAPDILQNAFSDEPMEEVEELESVEPEEEDEISESGTTEVPSF
FT                   DDVPDLTNLVSDNSESSAGDNSGSDVQSSFEQAPDILQNAFSDEPMEEVDVLEQGGSES
FT                   EASESKPFDDVPDLSTIASSDEVENTEQNISDSDEPPFETFNNENETKDNSSQDISLGE
FT                   IEQSFETDLKDSESETDNNQTVESDITYPEKTEETEPQSDKSDDSSSLKNKFKSITQRR
FT                   NLFDELEEAQSEDQPLAKPVNKSVDEEKPLEPFKDKFQNITHEGNLTESFDQLRKKVDE
FT                   FQTNIQNEEGSADNSSSIEPDEPESLSFNDNKESEYSETPRTEQSGSSESGNENVVETI
FT                   KTSFDGAKDSSFFKRSNESQPNLQTSDVSAIESEKSDSSERKNAEYAEKFNDLTASFKN
FT                   KFKNIRQKATGSTEQTKDSEKTETAVDDLTPPPLFEPYLPEDTEDSEDVSENVGDEELD
FT                   ESEEAKDISRFSKVKRLKPKFEKVLSPFKVLVKGSSGRRSLKNQMEQMKEEIEEEEQEE
FT                   SSPEFVPSFEQETEETEEEKTSKVGKISGFFKGITQRGRLRKRMKQFRENLTGSKQDDF
FT                   EFEPTTENVQMQGHYTGQPAGLNFEQVDRLVNKKLNDHQKQVKDVVDKKIDKVFNKEYM
FT                   DYIASRVATNQTGNLQELQSKVNGSVTRVEKVTDDLQNLSDTVDELDDRIKEIQRRNED
FT                   FESKIDNSYYSTSDRIDNLEYQLKNLQDSLGISNESDSKLNSIGTRVDELESALDSTQS
FT                   DNQEIKSELSNIQQSISDMYDSYKDLLSHLNEVNEDYESKFSDLYDKLSKIDTVESKLS
FT                   QIDKNTKERDEILSKVEEELPVIKNAIKRNHKENQVLANSLEELKSSSTVNRTEGKEDI
FT                   ETVSTGQNVQLGYIPKNSVSMRICMEWLKYLMNRVGGNNLDEVLTYYKELSWISDDVRQ
FT                   ELLRYSAGISHNGEKSDWKLTKTDHIKSIWFIQKLAGSNFDFNALQSIENDVNQIKESN
FT                   "
FT   gene            complement(477202..478032)
FT                   /locus_tag="Metev_0484"
FT   CDS_pept        complement(477202..478032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0484"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="TIGRFAM: diaminopimelate epimerase; KEGG:
FT                   mpd:MCP_0858 diaminopimelate epimerase; PFAM:
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73398"
FT                   /db_xref="GOA:D7E856"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="UniProtKB/TrEMBL:D7E856"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ADI73398.1"
FT                   /translation="MIEFTKLHGNGNDFIVIDEFENEIVPENQKADFAVKYCRRKFGIG
FT                   ADGILYISGSDKADMKMRLLQPDASEAEMCGNGIRCLVKYAYDNGYINLGESTVETIAD
FT                   VYNVKTRKDDGGFWVKVNMGKPLTKRSDIPAQGDSDDDFINVDLHDYPVSVVNTGVPHA
FT                   VIFVENLDFNIQNTAPKIRFDETFPNGANVNFVRIDSNDEITIRTYERGVEDETLSCGT
FT                   GSVASAYISNLLGKVNNPVLVHTKGGMLNIELDGKGFLYMEGPAETIYKGVTFK"
FT   gene            complement(478180..478476)
FT                   /locus_tag="Metev_0485"
FT   CDS_pept        complement(478180..478476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0485"
FT                   /product="acylphosphatase"
FT                   /note="PFAM: acylphosphatase; KEGG: mbu:Mbur_1323
FT                   acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73399"
FT                   /db_xref="GOA:D7E857"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:D7E857"
FT                   /inference="protein motif:PFAM:PF00708"
FT                   /protein_id="ADI73399.1"
FT                   /translation="MQEPESTPEVGAEIYVSGRVQGVFFRQFTNDAATHLGLTGYVQNL
FT                   PDGRVRVVAEGSQEKMNKLIDKLHSGPSLANVENVNVNWYEPTNEFRDFKVRN"
FT   gene            complement(478501..480414)
FT                   /locus_tag="Metev_0486"
FT   CDS_pept        complement(478501..480414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0486"
FT                   /product="threonyl-tRNA synthetase"
FT                   /note="KEGG: mba:Mbar_A2945 threonyl-tRNA synthetase;
FT                   TIGRFAM: threonyl-tRNA synthetase; PFAM: Threonyl-tRNA
FT                   synthetase editing domain protein; tRNA synthetase class II
FT                   (G H P and S); Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73400"
FT                   /db_xref="GOA:D7E858"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015011"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D7E858"
FT                   /inference="protein motif:TFAM:TIGR00418"
FT                   /protein_id="ADI73400.1"
FT                   /translation="MRLLLVHSDYIEYEVKKSTPVAEKVDESQKSGRLEEALTVFLAVE
FT                   KPDESDIDEIVKRTVDEIKNVMGQINTDRIMLYPYAHLSNELSSPDTAVKALKKIEKEL
FT                   SDKYEVKRAPFGWYKSFNINCKGHPLSELSRTIRLESTSTSATGESTGFESEEEEVVSE
FT                   ALKAEETAKSYWYVLTPDGELRDVDSFDFSDHSNLERFVNYEISESRVVDKTPPHVELM
FT                   KRLGIADYEQGSDSGNLRYYPRGRFIKSLLENYVLDEAIRSGAMEVETPIMYDMNHPTL
FT                   KKYLDRFPARQYSIESDKRRLFLRFAACFGQFLMSHDMTISYKNLPLKMVEMTRYSFRK
FT                   EQRGELVGMKRLRSFTMPDMHTFCEDMDQSISEFDDQYKMCINTLDNIGVDVDDYEVAI
FT                   RFTRDFYENNKDFITEMAKTVNKPVLVEMWDTRFFYFVLKFEFNFIDALGKASALSTVQ
FT                   IDVENAETYDISYIDRNGESKRPTMLHCSPSGAIERCIYALLEKNAMKIDNGEVPMLPV
FT                   WLSPTQVRIIPVHEHHFDFAEKIYEQLNCRVDIDDREDTVGKKIREAGREWIPYVVVIG
FT                   DREIESGKLNVTIRSESLPKKPKSSEMTVEELNNRVLSEIQGMPYREQPLAKYVTKRPK
FT                   FL"
FT   gene            complement(480565..481878)
FT                   /locus_tag="Metev_0487"
FT   CDS_pept        complement(480565..481878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0487"
FT                   /product="transposase IS605 OrfB"
FT                   /note="PFAM: transposase IS605 OrfB; putative transposase
FT                   IS891/IS1136/IS1341 family; KEGG: tpd:Teth39_2090 IS605
FT                   family transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73401"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D7E859"
FT                   /inference="protein motif:PFAM:PF07282"
FT                   /protein_id="ADI73401.1"
FT                   /translation="MIIMSFRNKDKFKNTVTFTLKQEIYFSGEDENILDGQSKICNWLY
FT                   NYLYDMVEYDYKYNGSRNKLINKYNLRNQVPRLKEEKPFLKTVYSSVLKNVAIRLAKSY
FT                   ENFFQIPEVGHPQHRSWKTKWFSLEYEEKIGWKIDGKTVIISLGKDKYSKQLKVVGTLN
FT                   EKPKLDGGEPRAFRLVKQRGKFYAILTVVKDKTPKKDVEKWIALDPNHKNLLTAYDYKG
FT                   NTIEFQNLDEIKYWDGVIDDLMSKRDNCKRKSQFIPISETRGYWEPSNNWKRYDKALEK
FT                   ALHTKREQTKLGMFTIANYLCRNYDKILIGDYTPSKEVSPHKKANRSILNQTLIAKLRG
FT                   TIEWVCDKSGKTFKKVDEKNTTKKCCICEDVEKKDPEVRTFTCKKCGQTLSRDINSAVN
FT                   IAKKEMHLSGTDYKANLKEPLYIAYWRYNNSKINMQTN"
FT   gene            complement(481877..482038)
FT                   /pseudo
FT                   /locus_tag="Metev_0488"
FT   gene            complement(482119..483204)
FT                   /locus_tag="Metev_0489"
FT   CDS_pept        complement(482119..483204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0489"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mma:MM_3303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73402"
FT                   /db_xref="GOA:D7E860"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D7E860"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ADI73402.1"
FT                   /translation="MNQEKKDGMVLLIEHKWKIIAAIAVALFFLAIIFILRPLADGIIL
FT                   GLVFAYISRPIYLKLNKNKRVGALVATICIVIPIIFILGMGILEIIQQITWIVQNQNEV
FT                   ISSLTGFINNVEIPDFLHTGIEQSIQDISQSIIPILREIGIVSYAKDLVIFLLNLVISI
FT                   IVCYFLLSDGNTLYQKVLDITPSNYQKTFQNYVTELDKILGGIFIGNAYAALFVSIMSA
FT                   IVFYVFGFSHILALSALIFIAAVVPLFAGYMVLLPLALLRYFNQGIEAALIFFLVASIV
FT                   IYLPPELFMRPYLASLKSKVHPLLIMLAFIGGAFVGGIAGFFAAPILLGALIAAYRVYV
FT                   SELRSYGYNLGQNTDKSENNG"
FT   gene            complement(483769..485310)
FT                   /locus_tag="Metev_0490"
FT   CDS_pept        complement(483769..485310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0490"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /note="KEGG: mbu:Mbur_1427 phenylalanyl-tRNA synthetase
FT                   subunit alpha; TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; PFAM: phenylalanyl-tRNA synthetase class IIc"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73403"
FT                   /db_xref="GOA:D7E861"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022917"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7E861"
FT                   /inference="protein motif:TFAM:TIGR00468"
FT                   /protein_id="ADI73403.1"
FT                   /translation="MSEQKQQHEASDYNLSINEKKVLIALGELESTTPETLAEKTSLKP
FT                   EAAMQSAFLLEEEGLAKVDEEVSVNYTITREGVEYADNGLPERQIIEYISEPVAIDDLK
FT                   NQLSPKMVGIAIGWLKKKGWADVKNSMIMPLVGSPEIGDDEKILSKFKQYAQEPDKSGI
FT                   AFTEEELLEKDSEKSALKDLLKRKLVIKNEEKYRYVSITNQGRELVSQGIEIGEEITQL
FT                   TSQLLKTGEWKKKNFRSYNIHTPPKPIYGAKIHPYQRLINQMRQIFIEMGFTEIKGEII
FT                   QSSFWNFDALFQPQDHPARDMQDTFHLESTSEIDEECKDNVCAMHEHGGDISSTGWGGR
FT                   WDENIARRNVLRTHTTAVTIKYLADNPEPPVKAFCIDRAYRRETIDPTHLPEFEQLEGV
FT                   VMDKNMSFANLLGCLAEFYHRMGFENVRFRPGYFPYTEPSVEPEVYIDGMGWIELGGAG
FT                   IFRKEVTDPLGIKHPVLAWGLGVSRVAMLKLGLRDLRELYQSDINWIRKSEVCRL"
FT   gene            complement(485360..486688)
FT                   /locus_tag="Metev_0491"
FT   CDS_pept        complement(485360..486688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0491"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="TIGRFAM: tryptophanyl-tRNA synthetase; KEGG:
FT                   mbu:Mbur_1426 tryptophanyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73404"
FT                   /db_xref="GOA:D7E862"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020653"
FT                   /db_xref="UniProtKB/TrEMBL:D7E862"
FT                   /inference="protein motif:TFAM:TIGR00233"
FT                   /protein_id="ADI73404.1"
FT                   /translation="MDMKMKIDPWGTLDIEDYSKLFDEFGISPIEDVYSDIPSPHKFMR
FT                   RNIVFGHRNYNLIVDAMNKGEPFSVISGFMPSGMVHLGGKMVMDEIIWHQQMGADAFVG
FT                   IADREAYAVRGLSWDKCRELGINEYILSLIALGFEPDGHIYFQSKCDNVKNMAFELGSK
FT                   TNYSELSAIYGFGGETNVSHMISTLTQSADILQPQLKEFDGPKPTVVPVGADQDPHIRL
FT                   TRGLAHKMNMLRIETREDNNGNQYFSIRNKSAPEYVLKQIKKHAPGKSKVFEGHVDIFG
FT                   TDDFEAILDIVRQVELEAGGYSFVPPVATYHRFMSGLQGGKMSSSDPDSYIALTEDPKE
FT                   GAKKVKRSKTGGCVSLEEQKKLGGNPKNCSVYELLMFHLIDDDKQLTEIYDECVSGTRM
FT                   CGSCKKYTAELMSEFLKDHQEKRELAKERLDEYGLGEYRKYVH"
FT   gene            complement(486859..488076)
FT                   /locus_tag="Metev_0492"
FT   CDS_pept        complement(486859..488076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0492"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: mbu:Mbur_1425 radical SAM family Fe-S protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73405"
FT                   /db_xref="GOA:D7E863"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D7E863"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADI73405.1"
FT                   /translation="MSSNTDIPKSLSTNSKENISLMSIPGLSIDLNHQDGFLQLEAKGT
FT                   LKSTCSPFLDKINSRLKKEKPATWNEESVIASTWLPPIPSGPFKRLLYAETKIAFGKYI
FT                   PETVSFEITRECKCNCEHCVVSGGEGDLDVDTIKRTIDEALDMGAFIITFTEGDPLLRE
FT                   EIFELIDYVDKDRAIVNIFTPGTELTPETAKRLKESGLHNLLISIYSTDSEKHDSVRRL
FT                   DGAHEMALNAIKNAVDAGLLVTMATHVSPNRMGELPRLYELASQLGVHELSLWESVPKK
FT                   PQDPILSDTERESILDMYHEINSNPQGPRVFSNTYFEGEMLGCMAGQRWMHVCVDGSVK
FT                   PCPYIPFEFGNIQNDSLKDIWNNIRNYSHFKGKRSRCLMHEPDFLNLVSKIPDTEEIPY
FT                   RFDKLQ"
FT   gene            complement(488227..488862)
FT                   /locus_tag="Metev_0493"
FT   CDS_pept        complement(488227..488862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0493"
FT                   /product="translation initiation factor aIF-2, beta
FT                   subunit"
FT                   /note="TIGRFAM: translation initiation factor aIF-2, beta
FT                   subunit; PFAM: Translation initiation factor IF2/IF5;
FT                   deoxyribonuclease/rho motif-related TRAM; KEGG: mac:MA0182
FT                   translation initiation factor IF-2 subunit beta; SMART:
FT                   Translation initiation factor IF2/IF5"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73406"
FT                   /db_xref="GOA:D7E864"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR004458"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:D7E864"
FT                   /inference="protein motif:TFAM:TIGR00311"
FT                   /protein_id="ADI73406.1"
FT                   /translation="MINIEVDYNDYDSLLDRAMEKMPEMETSDDRFTIPEPKVLQEGKT
FT                   TILDNFGNIVDVLNRDPEHVLKYLNRELGTAGKIEGSRAVFQGRFPKELIKSNLDSYLN
FT                   EYVLCTECGRPDTQLEKVDRVLVMKCLACGAHRPIKKKKASSGTTPTVAVEEGKVYDVQ
FT                   ITAVGSKGDGIAKLDKFTIFVPGAAKGQNVKVKINRISGNLAFAEKAE"
FT   gene            complement(488947..489465)
FT                   /locus_tag="Metev_0494"
FT   CDS_pept        complement(488947..489465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0494"
FT                   /product="ribosomal protein L10.e"
FT                   /note="KEGG: mbu:Mbur_1422 50S ribosomal protein L10e;
FT                   TIGRFAM: ribosomal protein L10.e; PFAM: Ribosomal protein
FT                   L10e/L16"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73407"
FT                   /db_xref="GOA:D7E865"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR018255"
FT                   /db_xref="InterPro:IPR022981"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D7E865"
FT                   /inference="protein motif:TFAM:TIGR00279"
FT                   /protein_id="ADI73407.1"
FT                   /translation="MARKPASMYRNVKKRSYTRREYMGGVPGSQVIHYDMGNKTAQFPV
FT                   KLSLIAEEDCHIRHTALESARVSANRKLMKAAGRAGYHLKVRVYPHEVLRENKQATGAG
FT                   ADRVSSGMRQAFGKNVGTAARVSAGQKVFTASVNKDDFGAAKDALWRAGQKIPTPFRIV
FT                   VDQGWKLVE"
FT   gene            complement(489629..490699)
FT                   /locus_tag="Metev_0495"
FT   CDS_pept        complement(489629..490699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0495"
FT                   /product="Domain of unknown function DUF1786 putative
FT                   pyruvate format-lyase activating enzyme"
FT                   /note="PFAM: Domain of unknown function DUF1786 putative
FT                   pyruvate format-lyase activating enzyme; KEGG:
FT                   mba:Mbar_A1370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73408"
FT                   /db_xref="InterPro:IPR014846"
FT                   /db_xref="UniProtKB/TrEMBL:D7E866"
FT                   /inference="protein motif:PFAM:PF08735"
FT                   /protein_id="ADI73408.1"
FT                   /translation="MQILSIDVGTGTQDILLYDTEKGMENSPVMIMPSPTVMVADKIRK
FT                   ATSQGIDIVLTGYIMGGGPSTKAVKDHLKKGLNVYATENAALTIHDNPDKIRSMGVKII
FT                   DEHELKSLPENLQRINLQDLTLDAIKNAYYQFGITAPSNFAVAVQDHGYSPESSNRVYR
FT                   FKHFENAIREGGGIEQFSYKNKDIPPYLTRLVDTSRIIGGTQSVFMDTGPAAIFGSLKD
FT                   SSSYQPSVVVNIGNGHTLGALVIDNKVVALFEHHTSQLTSYRLQDYIIRLSEGDLAFEE
FT                   IFNDKGHGCYINRKIGFDNIKSVMVTGPRREMIQNLDEYDKHPKLWDKLHFAAPFGNMM
FT                   LTGCFGLISAYCYHYG"
FT   gene            490843..491388
FT                   /locus_tag="Metev_0496"
FT   CDS_pept        490843..491388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0496"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="KEGG: mba:Mbar_A1367 molybdenum cofactor
FT                   biosynthesis protein B; TIGRFAM: molybdenum cofactor
FT                   synthesis domain protein; PFAM: molybdopterin binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73409"
FT                   /db_xref="GOA:D7E867"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D7E867"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADI73409.1"
FT                   /translation="MNTDSNSSQSHKSETVNTYNFSLITISSSRYYKYGDVTNPEEADD
FT                   TSGNTIKNILTTNGHKVIHYKLINDDFTAIQNTVNSAVYSNADIVITTGGTGLTSHDVT
FT                   IEAVQPLFDKEIPGFGELFRFKSLEDIGTSVILTRATAGVVRTKPVFCLPGSNNAVRLA
FT                   IREIIIPETDHIIKHTKD"
FT   gene            491541..491801
FT                   /locus_tag="Metev_0497"
FT   CDS_pept        491541..491801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0497"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   mma:MM_1485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73410"
FT                   /db_xref="GOA:D7E868"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:D7E868"
FT                   /inference="protein motif:PFAM:PF01985"
FT                   /protein_id="ADI73410.1"
FT                   /translation="MDKKQLYKLKSEASQLKPVIHIGKSGLTEPVIEELKKQIKANRLV
FT                   KVKILKSTFESEDTFQFSQKIADATNTTLVDVRGNNVVLYR"
FT   gene            complement(491820..492146)
FT                   /locus_tag="Metev_0498"
FT   CDS_pept        complement(491820..492146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0498"
FT                   /product="protein of unknown function DUF190"
FT                   /note="PFAM: protein of unknown function DUF190; KEGG:
FT                   mbu:Mbur_1418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73411"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D7E869"
FT                   /inference="protein motif:PFAM:PF02641"
FT                   /protein_id="ADI73411.1"
FT                   /translation="MNSVILRIYMNQSDTYKGKTSHDAVLEYLKDSGIAGATVIHGIEG
FT                   YGTHNEIHTANVLRLGVDLPVIVEVIDDEEKVRNVIPHLKEMLPGALMTLQDIEIVSDS
FT                   KNLH"
FT   gene            complement(492270..493469)
FT                   /locus_tag="Metev_0499"
FT   CDS_pept        complement(492270..493469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0499"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="KEGG: mac:MA4087 molybdenum cofactor biosynthesis
FT                   protein MoeA2; TIGRFAM: molybdenum cofactor synthesis
FT                   domain protein; PFAM: MoeA domain protein domain I and II;
FT                   molybdopterin binding domain; MoeA domain protein domain
FT                   IV"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73412"
FT                   /db_xref="GOA:D7E870"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D7E870"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADI73412.1"
FT                   /translation="MTGFFKERTPVNQARKIFLNAFNSIENTEQVSIDECSGRILSDSV
FT                   TANRNVPHYRRAAMDGYAVRSSDTVGASPDNPIMLQIDDEEVVEGTCVRVHTGSSIPDG
FT                   ADAVVMVEDTTPVGDMVEILTHVHPNKHVGIIGEDIEKNDTVFTDGHMLRPCDLAVLAS
FT                   LGINNVTVYKKPHVSVIPTGNEVVPRTSSSQLQPGKVVETNGLMTAKYVEKWGGLPEHC
FT                   DIVSDDPELIISAIQSQLESDIIILCGGTSVGERDHVPDVVKSLGNVLVHGVSMSPGKP
FT                   IALGMIDNVPVVCLPGYPVAAFIGLFMFARPALRKIGHIPDLPDATVKAELSDKIPSKE
FT                   GYMTFSRVVVDFGSSTAHPVMTSGAGVLSSVAKSNGLVIVPENIEGYEKGEKVDIFLIE
FT                   "
FT   gene            complement(493529..493813)
FT                   /locus_tag="Metev_0500"
FT   CDS_pept        complement(493529..493813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0500"
FT                   /product="MoaD family protein"
FT                   /note="KEGG: mma:MM_0831 molybdopterin converting factor
FT                   small subunit; TIGRFAM: MoaD family protein; PFAM:
FT                   thiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73413"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D7E871"
FT                   /inference="protein motif:TFAM:TIGR01687"
FT                   /protein_id="ADI73413.1"
FT                   /translation="MVDVKVKLFANLREYAGVSEVTISGDIVSDILNSLGQQYPQLKEL
FT                   IFENPEYEDELQGYINVLLNGENIQHLEGLSTQLKDYDEIAILPPVSGG"
FT   gene            complement(493884..493961)
FT                   /locus_tag="Metev_R0013"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(493884..493961)
FT                   /locus_tag="Metev_R0013"
FT                   /product="tRNA-Pro"
FT   gene            complement(494064..494621)
FT                   /locus_tag="Metev_0501"
FT   CDS_pept        complement(494064..494621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0501"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="KEGG: mac:MA0711 phenylacrylic acid decarboxylase;
FT                   TIGRFAM: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase;
FT                   PFAM: flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73414"
FT                   /db_xref="GOA:D7E872"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D7E872"
FT                   /inference="protein motif:TFAM:TIGR00421"
FT                   /protein_id="ADI73414.1"
FT                   /translation="MIEIAIGISGASGVHYGIRLVEILSGMDNVFTHLVITESAKKLIG
FT                   IESEYSVLEIEDMASRAYNEKDFTAPIASGSHRFAGMIVAPCSMKTLGSVANGITDNLL
FT                   TRSADVCMKERRSLVLMTRETPLNQIHIENMLKATQSGATILPACPGFYSNPQTIEDLL
FT                   NTMSGRALDLLGIENEVFARWK"
FT   gene            complement(494618..494977)
FT                   /locus_tag="Metev_0502"
FT   CDS_pept        complement(494618..494977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM_1872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73415"
FT                   /db_xref="UniProtKB/TrEMBL:D7E873"
FT                   /inference="similar to AA sequence:KEGG:MM_1872"
FT                   /protein_id="ADI73415.1"
FT                   /translation="MNTITETAGRAEIVLEWELMGEDYIVTLKGGREHIGAAAVGIYDD
FT                   NKGISTSSVISLPGHREEGIALEAARKISSCTHRTTVFMAGIHLDDITGEEINKIVEVS
FT                   DIIVDRFIKYLEENV"
FT   gene            complement(494990..496186)
FT                   /locus_tag="Metev_0503"
FT   CDS_pept        complement(494990..496186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0503"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="manually curated; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; KEGG: mbu:Mbur_1412
FT                   metal-dependent phosphohydrolase; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73416"
FT                   /db_xref="GOA:D7E874"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D7E874"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADI73416.1"
FT                   /translation="MKVIRDPVHGYIELDELSLKLIDTSLMQRLRRIKQLGLSSLVYPG
FT                   ANHTRFEHSLGVMHLATILMNQLDNISDNEKNGLKAAALLHDIGHGPYSHVTEGTVKYY
FT                   TRKKHDDVRDVLKKEEIANILREHDIDPETVAKHIKGETALGQILNSEIDVDRMDYLVR
FT                   DAHYTGVTFGLVDYERLIHEMEIFGNKLVVRWGGLKAAESLLLSRFLMYPSVYYHHVSR
FT                   IAETMYVRAIQNLIERGILSPFELNKMDDGSLFEIVRSDDGYAGELGKRIEERKLFKRA
FT                   LRVGFQSLGVDVLRYRDNVERVEKEIADIAGIDSRYVLIDIPNTPEIEEMKALIRTDSK
FT                   MQYLDDVSQVVATLEQAHRDNWKMGVYTPKEYRDVVGRVAREFFEVKRPMKQYRLTEY"
FT   gene            496255..497181
FT                   /locus_tag="Metev_0504"
FT   CDS_pept        496255..497181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0504"
FT                   /product="LPPG domain protein containing protein"
FT                   /note="KEGG: mma:MM_1874 LPPG:FO 2-phospho-L-lactate
FT                   transferase; TIGRFAM: LPPG domain protein containing
FT                   protein; PFAM: protein of unknown function UPF0052 and
FT                   CofD"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73417"
FT                   /db_xref="GOA:D7E875"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010115"
FT                   /db_xref="UniProtKB/TrEMBL:D7E875"
FT                   /inference="protein motif:TFAM:TIGR01819"
FT                   /protein_id="ADI73417.1"
FT                   /translation="MIVLSGGTGTPKLLNGLRNIIPEEDITVVVNTGEDIRISGNLISP
FT                   DVDTVLYLFSDKLDTDKWWGVANDTFTTHETMKTNGYDEGMMLGDIDRATHIMRSEYLR
FT                   NGDILTQATSKLANNFGIRANILPMSDDTATTIIKTPSGNLHFQDFWIKEKGELDVYDV
FT                   FIDGISNASISPAVLDAFENEDEVLIGPSNPITSIGPILSLPTMKEILKDKKVVAVSPI
FT                   IGHEPVSGPIAKLMHANDMEVSSIGVAKCYKEFLNAFIIDKTDHFKETDFKNEGIECYI
FT                   KYADTLMKSTDISINLAKQIRKIFDEI"
FT   gene            497282..497866
FT                   /locus_tag="Metev_0505"
FT   CDS_pept        497282..497866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0505"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="KEGG: mbu:Mbur_0463 CDP-alcohol
FT                   phosphatidyltransferase; manually curated; PFAM:
FT                   CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73418"
FT                   /db_xref="GOA:D7E876"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:D7E876"
FT                   /inference="protein motif:PFAM:PF01066"
FT                   /protein_id="ADI73418.1"
FT                   /translation="MLNHIKNKIRNSFKPIAKSLPFSPNLLTVIGLGISIIAAVMFGTG
FT                   RVFIGGILILLNGFFDILDGAVARENGWMTPFGGLLDSVCDRYADAIIFIGIIYGAIVG
FT                   SISDPVLLNIPLWLWCIIALISSYIVSYTRARAEAAGGKGMNIGIAERPERMIILTAGA
FT                   FVGLLAPAIAVIVILTHITIAQRLLHARNTL"
FT   gene            497871..498380
FT                   /locus_tag="Metev_0506"
FT   CDS_pept        497871..498380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0506"
FT                   /product="shikimate kinase"
FT                   /note="PFAM: shikimate kinase; KEGG: mac:MA3237 shikimate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73419"
FT                   /db_xref="GOA:D7E877"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D7E877"
FT                   /inference="protein motif:PFAM:PF01202"
FT                   /protein_id="ADI73419.1"
FT                   /translation="MNITIIGMAGAGKSTIGKSMAKKLGYRFIDIDKLVEKKSDKNLQE
FT                   LIDTHGDNALLELEEQTVLELRLNTEDECIISPGGSIVYSDSAMEFLDKYSTIVFLDVS
FT                   FDVITKRLSNSATRGMVGIKNKSLEDLFRERRKLYNKYANITVKLNKHNRVSETVNKII
FT                   KLCFNS"
FT   gene            498463..498711
FT                   /locus_tag="Metev_0507"
FT   CDS_pept        498463..498711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0507"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="KEGG: mbu:Mbur_0462
FT                   phosphoribosylformylglycinamidine synthase subunit PurS;
FT                   TIGRFAM: phosphoribosylformylglycinamidine synthase, purS;
FT                   PFAM: phosphoribosylformylglycinamidine synthetase PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73420"
FT                   /db_xref="GOA:D7E878"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:D7E878"
FT                   /inference="protein motif:TFAM:TIGR00302"
FT                   /protein_id="ADI73420.1"
FT                   /translation="MQYLADVTVELKSGMLDPEGNTIKRALGHLGYETNDVKTAKKFTI
FT                   DLDAESFDDARQNVDEMCQKLIANPIIHNYTIDLREA"
FT   gene            498711..499409
FT                   /locus_tag="Metev_0508"
FT   CDS_pept        498711..499409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0508"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: mac:MA1963 phosphoribosylformylglycinamidine
FT                   synthase I; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73421"
FT                   /db_xref="GOA:D7E879"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7E879"
FT                   /inference="protein motif:TFAM:TIGR01737"
FT                   /protein_id="ADI73421.1"
FT                   /translation="MRIAIIQFGGTNCDRDVLHVLKNVMNVDAELVWFKDKNLDRFDGA
FT                   VIPGGFSYGDYLRAGAIAARTPIMDSVRKMVSEGKPVIGICNGFQVLTESGLLDGALTT
FT                   NSYPKFLCEWTHLRVDNTDTPFTSRFEKGDVIQIPIAHKEGYFYADQSAISDLNKNNQV
FT                   VFRYVDEDGTSDDESNPNGSKENIAGITNSSKNVIGLMPHPERASEKVLGSEDGLKIFQ
FT                   SMVDYIQTLQ"
FT   gene            complement(499420..500076)
FT                   /locus_tag="Metev_0509"
FT   CDS_pept        complement(499420..500076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0509"
FT                   /product="ribonuclease HII"
FT                   /note="KEGG: mma:MM_2814 ribonuclease HII; TIGRFAM:
FT                   ribonuclease HII; PFAM: ribonuclease HII/HIII"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73422"
FT                   /db_xref="GOA:D7E880"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020787"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7E880"
FT                   /inference="protein motif:TFAM:TIGR00729"
FT                   /protein_id="ADI73422.1"
FT                   /translation="MKVAGIDEAGKGPVIGSMCIAGVVVDEAKINSLKNLGVTDSKKIS
FT                   PRKREELAHKIKKYVDNYFIFEITPSQIDELRNVMSMNDIMVLGFSRVVENLNPELVYV
FT                   DSADVKPERFAEKIRSEYSKSNKTASENIKIISEHEADVVYSVVSAASIIAKVRRDELV
FT                   NNLKEEFGVDFGSGYPSDPKTKQFLLDWVKRYGSLPDIVRHSWKTAQKLLDKNDG"
FT   gene            complement(500097..502349)
FT                   /locus_tag="Metev_0510"
FT   CDS_pept        complement(500097..502349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0510"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   mbu:Mbur_0449 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73423"
FT                   /db_xref="GOA:D7E881"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D7E881"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADI73423.1"
FT                   /translation="MDGTTENDEFLDEVDNDSVVSESDTQSQEFSDNTESPDTSEYEKR
FT                   LSFKNLKNRFQSNNHQDNERGLSDKISSRINNLDRQARLFLTIFKKIPFALLGEKMKEK
FT                   KKKYARLQLQLKQARIPTSYEMYISNAIFYSVVSGLTGAILGIFAAYMLIAVIGLPDNL
FT                   TNLTFGPSTAWLLNFKEIFLSLFIVVFTTITLGGMTYALFLVYPGFQASERKRNIDSHL
FT                   PYAVTFMYALSKGGMNIINVFDSLSRSSNTYGEASKEVETIIREMDYFGHDLRTAISNV
FT                   SEMTPSDRFQDLLHNLLTVIDSGGSISKYFQDKSDQYLKKAIDDQKGFLETLGLLAESY
FT                   VTAFVAGPLFIIIMGIMMTVMGSGSILMVYAVIYAVLPIGSVMFVVMISIMAPEDFGEP
FT                   AYLQTNEIFDHGIPEIPSYLEPEYDENGQLINETKEKVEKRQCYENFIKSKQRVKYKNF
FT                   LKNPLKPLFNNPLLSVAVTSPVAVILLLIFVATNMDTFTTMSETIDFLDDRLVIATYII
FT                   IVPLAIFHETKSKRQKKLDGNFPDFLKKLASTVETGMTLQDSIKLMVKTDNEGLSDETR
FT                   KIWKDISWGMELNDALVRFANRLKTQVVSRSMTLITKANESSGDIGEVLMVAARDASSE
FT                   EEMKRERSMNMMIYIVIIYISYMVFVGVIYVISTTFLTEMAEAGEQMTSSGAQQMGMLG
FT                   SFDLDKYTRIFKHSAVIQGLCSGLMAGVMGEGSVMSGLKHSIIMVTIGYFIFTLFI"
FT   gene            complement(502371..504449)
FT                   /locus_tag="Metev_0511"
FT   CDS_pept        complement(502371..504449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0511"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   mbu:Mbur_0448 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73424"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E882"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADI73424.1"
FT                   /translation="MMGDKNGPESQPDNTDKNKVYDSPVNSTNSSGTQVSGESGPKIFA
FT                   PEESDNTGSSDSDDANDENFDKEDYILTPSEDVENTSLWLSDKHESDEEHEENFDILTP
FT                   ESGFETNKEKSDESGIKENESEESDKSGKNLVKSLIHEKKSKKLRPGAEESSSKSDESF
FT                   EESASEELTFFDKVRNLFKQETFEIEAYNPDEHGPLSVFKGVEGYEEIDRYWVNEPYAF
FT                   VVILFNPEINDYLYYLVEPELSDFETTFLTEIKDRLRNALLVENIENKDDKEAVLDEKI
FT                   RIIIKDYAIDVTPLMLEKISYYIKRDFVRYGKIDPLMNDDYIEDISGNGHNIPLFLYHR
FT                   IYHNIATNIAFTEDELDSFIIRLAQKCGKHISLAEPMVDASMPDGSRVQMTLSTTITTH
FT                   GSTFTIRKFSEVPITPIDLIDWGTFSSEQMAYLWLCIENNKSLIYAGGTASGKTSSLNA
FT                   VSLFVPEKAKVVTLEDTREIKLPHTNWIPGVTRDSFTADERGAVDMYDLLRAALRQRPE
FT                   YLIVGEVRGKEALTLFQAMSTGHTTFSTMHADSVPSAIHRLENPPISVPRNMIQALDIM
FT                   TIQAQTYVSGKRARKNLKIVEIVDIDPNTRNLRTNDIFVWDSARDTFQRTGESQCIYEI
FT                   QRRRGWNAAQINEELQYREKILDYMVNNDIRDFKEISEIIKSYQATPEKLLQKIGLK"
FT   gene            504702..506324
FT                   /locus_tag="Metev_0512"
FT   CDS_pept        504702..506324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0512"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit;
FT                   KEGG: mma:MM_2812 phenylalanyl-tRNA synthetase subunit
FT                   beta; PFAM: tRNA synthetase B5; B3/4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73425"
FT                   /db_xref="GOA:D7E883"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR022918"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:D7E883"
FT                   /inference="protein motif:TFAM:TIGR00471"
FT                   /protein_id="ADI73425.1"
FT                   /translation="MPVITLNYEDLESLTSVDRDTIVEQIPMMGADIERIEDEYIDIEF
FT                   FPDRPDLYSVEGVARALRGFLNIETGLQDYRLDSSNIEIEKDEDIEHIRPYLACAVIRN
FT                   VNFNANSIKSLMDLQEDLHWGVGRDRKKVSIGVHDLSNITPPFRYMAADPDTKFIPLDF
FT                   TEPMSMNQILEKHPKGMKFAYILEGFNEYPIILDADDNVLSFPPIINSTRTQITENTTD
FT                   LFIDVTGLSESVYVALNVLVTALAERGGSVESVKIIDSDGNEKTLPDLEPLSCELEVSE
FT                   INSLIGTELSQDEILKQLQRMRYGADIKNNKSIEVKVPPYRADILHNYDIVEDIAIGYG
FT                   YDNIQPEFPESATFGSAHEVSVTSDNICEIMTGLGYSEVMSFTLSNERVHFDNMCRNRT
FT                   DDVTYVMHPISEDQTMVRTTILPNLMEILSMNQHRELPQSIFEFGDVVINNKIHRNLAA
FT                   VSIHPEVNFTDIREIVDAVMRERMVEYEVEESDDPAFIGGRRADILVNGKKVGVMGEIY
FT                   PQVITNFGLGEPVIGFEMEIMDY"
FT   gene            complement(506334..508698)
FT                   /pseudo
FT                   /locus_tag="Metev_0513"
FT   gene            complement(506640..507980)
FT                   /locus_tag="Metev_0514"
FT   CDS_pept        complement(506640..507980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0514"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: dhd:Dhaf_2012 transposase, IS605 OrfB family;
FT                   TIGRFAM: transposase, IS605 OrfB family; PFAM: putative
FT                   transposase IS891/IS1136/IS1341 family; transposase IS605
FT                   OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73426"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D7E884"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADI73426.1"
FT                   /translation="MVRKEGQNCRNLRFKIHITPEQEKKLDDTLEYCRLIWNHLLSIKV
FT                   ELYDRFGLSVSNSSLENHLKNLDYPIHSSVRLDVFQRLCFAYDKFFDDLKKGRLKNTKP
FT                   KKGKFVKRKDVPCGNNSSGFIKYGGILPKGHPKFKSKEDFSSFRYKQHGNGWKLEDNKL
FT                   YLSKITGKSKPIKIDIDRLPDGELKTCTLKKEGKQWFAYLTVELPDNPVPSTPTNAVGI
FT                   DIGLKSFITTSDDDFVEPPRFLRKAEKRLAKEQQKLAKMEFKSNNYNKQKQKVNRIHRK
FT                   VASARNHFSHCLSKLLVERYDLIVFEDLKIKNLVKNNRLAKSISDVGWNKLVQHVTYKA
FT                   AERGKIVDKVDPDNTTQVCSYCGTKKKEKLKLEDRTFHCSNCGLEIDRDLNASANILTK
FT                   SSYYNPTTHTVGLAGMNGCGDGTSTTGPGISSQVPSMNQQMLNLVKG"
FT   gene            complement(508795..508894)
FT                   /locus_tag="Metev_R0014"
FT                   /note="tRNA-Arg5"
FT   tRNA            complement(join(508795..508834,508854..508894))
FT                   /locus_tag="Metev_R0014"
FT                   /product="tRNA-Arg"
FT   gene            complement(508966..509724)
FT                   /locus_tag="Metev_0515"
FT   CDS_pept        complement(508966..509724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0515"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   mbu:Mbur_0246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73427"
FT                   /db_xref="GOA:D7E885"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D7E885"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADI73427.1"
FT                   /translation="MEPFLIAIIVFFLAILFSIIGTGGSTIYVPLLYWIGIDLHIVIPT
FT                   VLLINTFATGSATIFYTKKKMVDFKTAIPLILTSVAGAPIGAYFSKSTPQDLLILIFAV
FT                   LLLLIGIHMVFTSSRIGHLKCTGRGTRKNVIISLISGFMIGIVAGLLGLSGGVFIVPLL
FT                   VYLGYNIKTASATSLFIIVFTSISGFLGHIGTSTGSLDAGLLVYSSLAGFLGAQVGSYF
FT                   MIYRLKSKTINQMFGIVLWVVAIRLIIGFI"
FT   gene            509979..510581
FT                   /locus_tag="Metev_0516"
FT   CDS_pept        509979..510581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0516"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: mem:Memar_1356
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73428"
FT                   /db_xref="GOA:D7E886"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D7E886"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADI73428.1"
FT                   /translation="MAEENIEENPVIEAIKSRRSVRDYIDKQVSEDTVNQVIDAGIHAP
FT                   TALGLQPWNFVVISGKDIIKEISDHIKPMVQEHLKDSTEQLAKDLKEKMKNKDFNLFYD
FT                   APILVLVMHNRDDKLADYDCALCAENMMLAAHSLGLGSCWIGAGAFIQQSPELLDDLDI
FT                   PHDFEIVAPIILGYPRSTPSPIDRCEPMVSWIYKKKD"
FT   gene            510609..511202
FT                   /locus_tag="Metev_0517"
FT   CDS_pept        510609..511202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hut:Huta_0249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73429"
FT                   /db_xref="GOA:D7E887"
FT                   /db_xref="UniProtKB/TrEMBL:D7E887"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73429.1"
FT                   /translation="MRFRKIPIGIVIILIAAASIGIYEISISKKTLSEPREVVEDGEKH
FT                   LIFYDNSNKRILTISMLYHQGYNNKTGEIPLRVAASHSENTVIESMDLTVKYPRRGSWI
FT                   EKRGDVFLKTPDGFPFPEIHFERTENFNTRLEIPDMSPQGKGTVTLHFLLKPAWKIEDS
FT                   ANITVNVNTVLSENRLFGYKYHAQKQTTLKIPSD"
FT   gene            complement(511392..511742)
FT                   /locus_tag="Metev_0518"
FT   CDS_pept        complement(511392..511742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0518"
FT                   /product="iron dependent repressor"
FT                   /note="PFAM: iron dependent repressor; FeoA family protein;
FT                   KEGG: gem:GM21_2623 iron (metal) dependent repressor, DtxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73430"
FT                   /db_xref="GOA:D7E888"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D7E888"
FT                   /inference="protein motif:PFAM:PF02742"
FT                   /protein_id="ADI73430.1"
FT                   /translation="MHDGVDDKVCILLSHPRACPHGNPIPKGECCKKDDKEVSNIVRPL
FT                   SALKLNQKGKIAYFVIQDNGKLQKLMSMGILPGMPVTQLQSYPSYVFDLDQTRYAVDKE
FT                   MEDYVFVRVDNN"
FT   gene            512137..514896
FT                   /locus_tag="Metev_0519"
FT   CDS_pept        512137..514896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0519"
FT                   /product="protein of unknown function UPF0182"
FT                   /note="PFAM: protein of unknown function UPF0182; KEGG:
FT                   hor:Hore_10710 putative glutamate--cysteine ligase/putative
FT                   amino acid ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73431"
FT                   /db_xref="GOA:D7E889"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/TrEMBL:D7E889"
FT                   /inference="protein motif:PFAM:PF03699"
FT                   /protein_id="ADI73431.1"
FT                   /translation="MQSFKPIYLFIALLAIILGIGPLLGIYMDYLWFGMVDYTSVFTTI
FT                   LQWKIVTVIPGFILAFIFLYINIKFARNSIDKILTDKQIAYEKIDYRLFLIGTVFLSFL
FT                   FGLVFSGNWRTILLYLNSTPFGIQDPILLNDVGFYIFQLPFFHMLRGVLLGLVIITLII
FT                   AGALYVYRLQPVLLTQRDDTEEPYDINPEINIKNIMDKVPKRVLVHVSVLLAFIFALIA
FT                   VGFFLNRYEILFTQQGAVAGAGYTDVFVRLPIFTILTVLSALTAVALLANIKLKNIKVP
FT                   LIGIGLIVLFVLASAFVPSVYQQYAVEPTELQREEPFLEHSINFTREAYGLSDADVNQL
FT                   DVDTNITNRDIEENEDIISNIRIWDHRALRQSYRQLQQIRTYYTFNDVDIDRYRTDENY
FT                   QQYMLAVRELDIDGLPPQARNWVNERLIYTHGFGMVMNPVSTKTADGQPELALQDIPPR
FT                   GDFEIENPRVYYGESTNEYKIVNTLRQEFDYPRSEGGNVLTNYDGKGGVQMDSFFKRLA
FT                   YAFRFGEPKFILSEYITDDSRVMYHQHIEERTDKIAPFLEYDSDPYPVIHDGRIHWIID
FT                   AYTTASRYPYSDTYYGSEMSGINYLQNPVKVVIDSYDGSVDYYIIEEEPVVETYSKIFP
FT                   DLFKSYEQMPENLKQHIRYPVDYFEVQMELYRNYHMTDPVTFYNREDSWDIPEEQYRGT
FT                   STKMEPYYMITRLPGSDELEYILLQPFTPRERQNMISWIAARSDEPHYGEIKDYRMQKG
FT                   ELVYGPTQIEARIDQNPEISEQLTLWGQSGSNVIRGNLLVVPIGNSILYTEPIFISAEE
FT                   SEIPELRRVVASSGNRVVMSVELRQALEGLAEGRVDGIDPGTIPGEPVVPRTAQQLAQQ
FT                   ALEHYETAQEHLRAGNWSAYGEEIEQMRDVLNQLSQELEDVNTTETGQ"
FT   gene            complement(514912..515316)
FT                   /locus_tag="Metev_0520"
FT   CDS_pept        complement(514912..515316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0520"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="KEGG: mpd:MCP_2884 hypothetical protein; PFAM:
FT                   beta-Ig-H3/fasciclin; SMART: beta-Ig-H3/fasciclin"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73432"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:D7E890"
FT                   /inference="protein motif:PFAM:PF02469"
FT                   /protein_id="ADI73432.1"
FT                   /translation="MDDIIETARECGSFKTLLNALETAGLKDLLINKGPFTLYAPDDDA
FT                   FSTFSEKELDNLLADKEELKQILLYHITGGKAMLQDAVQLKSMRTLQGGDIIAEESGDD
FT                   VNVNNAKVVHSDIECTNGVIHSIDRLLNPE"
FT   gene            complement(515399..518233)
FT                   /locus_tag="Metev_0521"
FT   CDS_pept        complement(515399..518233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0521"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="KEGG: mbu:Mbur_0732 DEAD/DEAH box helicase-like
FT                   protein; PFAM: DEAD/H associated domain protein; DEAD/DEAH
FT                   box helicase domain protein; helicase domain protein;
FT                   SMART: DEAD-like helicase; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73433"
FT                   /db_xref="GOA:D7E891"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E891"
FT                   /inference="protein motif:PFAM:PF08494"
FT                   /protein_id="ADI73433.1"
FT                   /translation="MNFDNIFDSFHPKIQQALKEQGFVSPTEPQEKAFPVILKDNNTLL
FT                   IAPTGSGKTEASVLPVFNKILEKSDDERKGVSALYITPLRALNRDMLSRIKWWGEYLGI
FT                   RVMVRHGDTSKHERQKQSQNPPDMLITTPETLQAMFTGKRLRGNLEYVTHVIVDEIHEM
FT                   GTSKRGSQLTLGLERLVEISGNFKRIGLSATVGNPNLIASFLAGKDRSISVVEVPMLSL
FT                   MEFDILYPETTQKDIEISRKTGFDPEFASHLRSIQDIVEKHESTLIFVNTRQSAESLAS
FT                   GFNIIDAPISVHHGSLSFEARLEAEDSFKNGNLKGLICTSSMELGIDIGNIDHVIQYGS
FT                   PRQVSRLLQRVGRAGHKIHEVSRGTIISTGPDDNTESMAITKATLDGRIEDILPHYNPL
FT                   DVLANQICGIVLDFGEITVDKIHEIVTRAYPFKDLKIEVLNGVVSQLIGYRMLWSDKPG
FT                   IVSRRKKTWNYYYENLSMIPDEKKFEVYNIVTGKTVGMLDEAFVVNFASPGAVFITKGD
FT                   MWRIVEMNTDHNRIKVEPFNGTGEVPNWVGEEIPVPYEVAQDVGGIRERISSYIKQDCD
FT                   DSTISKNLRENYTINTNAVLNVIGLVREQLSNNYPLPDSRTVVIEEDVDEDAVIINSCF
FT                   GHTTNETFAKVLTSLLAARFGSSVGQEIDPYRIKLKLPKRVSADLVKDMILGIQPEHIE
FT                   PIIEMTLKNTTVMKWKMVHVAKKFGALSKDIDYDRISMKKLLDIYEETWMYDEVVREIF
FT                   HDMLNVDGAKDILTKLNSGEISILVSEPTPIGSAGFAVRKDLVAADKADRSIVMALKER
FT                   IMNDRVILFCVNCKKWTSRRKVKNVPEVIQCPVCESKMVAALKPWEEDEIKLVKKQDSV
FT                   TSREETKRIQRVYRNSSIVLTHGKKAVIALASRGIGPDTASRVIQKMRQDEEAFYRDIM
FT                   EAERKYARTKQFWG"
FT   gene            complement(518249..519079)
FT                   /locus_tag="Metev_0522"
FT   CDS_pept        complement(518249..519079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0522"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mma:MM_1914
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73434"
FT                   /db_xref="GOA:D7E892"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D7E892"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADI73434.1"
FT                   /translation="MSIDITPLIDRPALTVSNTEKVLVVADIHLGIEWDLYKSGITIPS
FT                   QTEKRLERLKGYAEQTDPDRIVLLGDVKHNVPRTSWQEKNEVPYFLDALTEHASVDILP
FT                   GNHDSGIESLLHENNDIKVHSSKGAVIDGVGYFHGHTWPAFELLQTEYVVTAHNHPTVR
FT                   FTDSLGHPTIEPSWIRSEFNFDELSRYQSLDYQSWNNPIVFVMPAFNELCGGIAFNESL
FT                   HEDLLGPVFSTKTFELDDSEVYLLDGMYLGVLKNIRKSSMTRKRTSRKVKTKKR"
FT   gene            519232..521193
FT                   /locus_tag="Metev_0523"
FT   CDS_pept        519232..521193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0523"
FT                   /product="acetate/CoA ligase"
FT                   /note="KEGG: mbu:Mbur_0999 acetyl-coenzyme A synthetase;
FT                   TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent synthetase
FT                   and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73435"
FT                   /db_xref="GOA:D7E893"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7E893"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ADI73435.1"
FT                   /translation="MGAWIMEETIESKLEEYELINPPEDFVKQANINDPEVYKRAEDNP
FT                   EKFWEELAEHIDWFEKWKRVLGWEPPHAKWFVGGKLNASYNCIDRHINKRGEKTAILWE
FT                   GEKGDIRKYTYNELLEATSRFANALKNQGVEKGDIVTIYMPMIPEAVIAMLACARIGAP
FT                   HSVVFAGFSADALADRINNAESKYVITTDGYYRRGKILEHKNKTDEGISKAETVEKVIV
FT                   VNHLDNEIEIKPGRDVWWHEIIESADSTCEPEKMDSEDMLFLMYTSGTTGSPKGIVHTT
FT                   GGYMVGTHVTANWVFDLKEDDIYWCSADVGWITGHSYIVYGPLSNGSTIFMYEGAPDYP
FT                   DKDRFWEMIEKHKITIFYTAPTAVRAFMKWGSEWPEKHDLSSLRLLGTVGEPINPDPWW
FT                   WYYKNIGYEKCPIVDTWWQTETGMILITPLPGITPMKPGSPTNPFPGIKASVLDDEGNK
FT                   IEPGHGGYLAIERPWPSMIRTVYGDEERFINTYWSKWGPDKYMTEDAARLDNDNYFWIL
FT                   GRVDDVINVAGHRLGTMELESALESHPDVVEAAVEGIKDEIKGEAVFGYVILSSGSKED
FT                   EKLKQELRDKIVKDIGPIAKPKGIVFTDDLPKTRSGKIMRRILKAITNNKDEGDTSTLQ
FT                   NPEIVDELKRKVKELDVN"
FT   gene            521232..522197
FT                   /locus_tag="Metev_0524"
FT   CDS_pept        521232..522197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0524"
FT                   /product="deoxyhypusine synthase"
FT                   /note="KEGG: mba:Mbar_A0061 putative deoxyhypusine
FT                   synthase; TIGRFAM: deoxyhypusine synthase; PFAM:
FT                   deoxyhypusine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73436"
FT                   /db_xref="GOA:D7E894"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="InterPro:IPR022899"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR036982"
FT                   /db_xref="UniProtKB/TrEMBL:D7E894"
FT                   /inference="protein motif:TFAM:TIGR00321"
FT                   /protein_id="ADI73436.1"
FT                   /translation="MHSKNDANTTCKKLDREIRQAEITSDMNVDELIKGISGCAFGAGR
FT                   LSEAVDIYCEMLTKDTTKFFGLAGAMVPAGMRKIVVDLIRDGYIDVLVTTGANMVHDLV
FT                   EALGLHHYKGSAHSNDTELKNEEINRIYDVYLPENHFTEFEEKMQSILEDVSEEPVSIR
FT                   QFLTHIGNHLEDDDSILKVAADMNVPIYCPAIQDSMIGLQAWLYKQTNKLNVDAFDDMK
FT                   ELIDICYDAEKSGAMLIGGGVPKNYIFQSMLVTPKELDYAIQLTMDTPETGGLSGASLD
FT                   EARSWGKVGEYAQSLTVHADATITLPIIVAAVRSRIENKK"
FT   gene            522209..522862
FT                   /locus_tag="Metev_0525"
FT   CDS_pept        522209..522862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0525"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /note="KEGG: mac:MA0969 orotidine 5'-phosphate
FT                   decarboxylase; TIGRFAM: orotidine 5'-phosphate
FT                   decarboxylase; PFAM: Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73437"
FT                   /db_xref="GOA:D7E895"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:D7E895"
FT                   /inference="protein motif:TFAM:TIGR01740"
FT                   /protein_id="ADI73437.1"
FT                   /translation="MEKNNQLILALDVTEKNKALDVAEKVYEYVDAVKIGYPLVLKTGI
FT                   GIIEDISSRVPVIADFKVADIPNTNRLICEQVFNSGADAVIVHGFTGRDSLDACVATAN
FT                   EYNRQVFVVADMSHPGATEFFQQVSEKIAKMSLDTGVSGVVAPATRTNSVENIRKIIGN
FT                   ELAIISPGVGAQGGSASDVINKGADWVITGRSIYQSDSPDTEAKKVVQEIKNRN"
FT   gene            523137..524876
FT                   /locus_tag="Metev_0526"
FT   CDS_pept        523137..524876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0526"
FT                   /product="oxaloacetate decarboxylase alpha subunit"
FT                   /note="KEGG: mma:MM_1827 pyruvate carboxylase subunit B;
FT                   TIGRFAM: oxaloacetate decarboxylase alpha subunit; PFAM:
FT                   Conserved carboxylase region; pyruvate carboxyltransferase;
FT                   biotin/lipoyl attachment domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73438"
FT                   /db_xref="GOA:D7E896"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7E896"
FT                   /inference="protein motif:TFAM:TIGR01108"
FT                   /protein_id="ADI73438.1"
FT                   /translation="MRVKLTDTILRDAHQSLLATRMRTRNMLPIVDKLDEVGYHSLEMW
FT                   GGATFDSCIRYLNEDPWERLRELKKHMHNTQAQMLLRGQNLVGYRHYPDDVVEKFVTKA
FT                   YENGIDIFRIFDAVNDVRNMETAINTANKLGAHVQGTICYTISPVHTTEKYVELAKELE
FT                   QRECDSLCIKDMAGLLSPHAAEELIKSIKKKVSLPISLHCHCTSGMAPMTYMAACEAGV
FT                   DVLDTALSPFSGGSSQPPTESMVAALQGTPYDTGLDLEAFTEIAEYFKQVKEEYRSIMD
FT                   PISEQVDTNVLIYQVPGGMLSNLVSQLKEQNALGKYKDVLAEIPKVRAELGYPPLVTPT
FT                   SQIVGTQAVLNVVMGERYKMVPKEVKDYVRGFYGQPPQPISSEMIAKIIENEEPFTGRP
FT                   ADLLEPEYEEKKKEAEDLGLVRNEEDVLTYILYPSIAPKFLRGEAEEEQLAPVETEKPP
FT                   QKSSSPDTGIPTEFKVTIDQEVYNVKVEPVGGSVVSVTEEDTSHTPDPENVEGAVTSSM
FT                   QGTVLSVHMNVGDTVNEGDPVCVIEAMKMESTITASHGGVVKEIYVSEGDAISSGDLLA
FT                   SIV"
FT   gene            524907..526388
FT                   /locus_tag="Metev_0527"
FT   CDS_pept        524907..526388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0527"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="KEGG: mbu:Mbur_2426 pyruvate carboxylase subunit A;
FT                   TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase; PFAM:
FT                   Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73439"
FT                   /db_xref="GOA:D7E897"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D7E897"
FT                   /inference="protein motif:TFAM:TIGR00514"
FT                   /protein_id="ADI73439.1"
FT                   /translation="MFKKILVANRGEIAIRIMRACRELDIPTVAVYSEADKNALFAKYA
FT                   DESYPIGPAPSSKSYLDINKILDVAEESGADGIHPGYGFLSENPEFARECEKRGITFIG
FT                   PSSDVIEKMGSKISARNIMIDAGVPVVPGTEEPIEDVNTAIDIAESIGFPVIIKASAGG
FT                   GGIGMKIVHSREDFEKALNSIQSIASSAFGDSTVFIEKYVEEPRHIEIQILSDKYGNTI
FT                   YISDRECSIQRRHQKLIEEAPSPIMTPELRKEMGEAAVKAAKAIGYENAGTVEFLYSKG
FT                   EFYFLEVNTRLQVEHTITEMINGIDIVKDQLYIACGEKLPYKQEDMDIRGSAIECRINA
FT                   EDPLNDFAPSPGKIRRYRSAGGPGVRVDSGVHMGYTISPYYDSMISKLCVWGKNRDEAI
FT                   NRMKRALFEYVVVGVTTNIPFHKAILENDAFRRGELTTHFIDTHDILEDVEKIVDKEAK
FT                   RNMTLASALDNQNQKVAAVTSAVNAYLDGYKKQNQ"
FT   gene            526470..527447
FT                   /locus_tag="Metev_0528"
FT   CDS_pept        526470..527447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0528"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="TIGRFAM: biotin/acetyl-CoA-carboxylase ligase; KEGG:
FT                   mba:Mbar_A1588 biotin--(acetyl-CoA-carboxylase) synthetase;
FT                   PFAM: biotin/lipoate A/B protein ligase; Helix-turn-helix
FT                   type 11 domain protein; biotin protein ligase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73440"
FT                   /db_xref="GOA:D7E898"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7E898"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ADI73440.1"
FT                   /translation="MSDRKEDILNILKNSDQKPVSGEELGEQLGISRTMVWKYIKSLKD
FT                   DGYNITSSTKTGYILNSSPDMLYSEEILSGLKTSIIGNKIYHFDELESTNEEAKRLAPD
FT                   EDEGTVIISETQKSGRGRMGRDWTSPRGGIYMSVILKPTIPASHAYHLTLVAGIAVANA
FT                   IRNLGINACIKWPNDILINNRKVCGILTEINAEIEKIDYIVLGMGINANVDTGMFSSEL
FT                   KEGSTSLKSELGKPVERVSFVQNLLYEFEQEYIKFKSKPFNDIVDEWISLSDTIGKEVS
FT                   IMTPSKMVEGKAIGVTKNGALIVKKDDGEKEEIIAGRCIYTRTS"
FT   gene            527455..528033
FT                   /locus_tag="Metev_0529"
FT   CDS_pept        527455..528033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0529"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A1589 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73441"
FT                   /db_xref="GOA:D7E899"
FT                   /db_xref="InterPro:IPR006457"
FT                   /db_xref="UniProtKB/TrEMBL:D7E899"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73441.1"
FT                   /translation="MRQNTKLKTFVSLLIILMILHSGVTVVSSQSEEDDSVPVVLINGT
FT                   KIFIKSDESHSFYQGYKLQIKGVNQEDERLWLELSLNGRSVKSDVVHEGEHFTYKRDST
FT                   VILNATVDKIYSNPENELVTFKSVYQYLDPQLETPKLNNSENPANSSNDTNSTNNSKGG
FT                   DGYLQTAITIAGTISIGVIVVYILYKNTT"
FT   sig_peptide     527455..527550
FT                   /locus_tag="Metev_0529"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.491 at
FT                   residue 32"
FT   gene            complement(528040..528960)
FT                   /locus_tag="Metev_0530"
FT   CDS_pept        complement(528040..528960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0530"
FT                   /product="phosphoserine phosphatase"
FT                   /note="KEGG: mbu:Mbur_2429 phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73442"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8A0"
FT                   /inference="similar to AA sequence:KEGG:Mbur_2429"
FT                   /protein_id="ADI73442.1"
FT                   /translation="MEATENSDISNMSERELKDKINQLRTQISQKEKNLNTIFKDLKLY
FT                   RNNIDELKEKRNELNTKVKDLVSQAQDFKSKRDENNKKITELKSKRDEIQKQNKSKANE
FT                   IAQLKKKRNELNDISKGTEETLSKAYSQELNKFLNEDIPLNHEIDLFERLENLKKRLEA
FT                   AQEANNIHHKIQEIYNTSFDDNINELNDQIQQLADESQQYHLQMVEYFNKADEVRAEAD
FT                   SYHEDIKNKYSLMSPLKSKIDPLKTEISQLREELDRYLKQLDDIQLQKDEKNQDEKYTE
FT                   AKEKLDKSGRLSLEDLKILMERGDL"
FT   gene            complement(528973..529620)
FT                   /locus_tag="Metev_0531"
FT   CDS_pept        complement(528973..529620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_2430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73443"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8A1"
FT                   /inference="similar to AA sequence:KEGG:Mbur_2430"
FT                   /protein_id="ADI73443.1"
FT                   /translation="MDTETSTTGNDNTSVTIMDKSELVSGVIEKHQNFLNKYRQEFEQL
FT                   NERIESINEQMESAKKNKEYVVGRRDVLREKRQQILYQAQKTLNELQSSIKDSEHKEIL
FT                   SSVDEKISKLKTSISSDEEKQIVDEINDSISEISLNDETANRKLSDIKSKIDSVIETSN
FT                   EIESIKGSDKQYEKEYDKLKKELNDLNPRYKWLEKRISSHEESIEYWKNVEQ"
FT   gene            complement(529676..529966)
FT                   /locus_tag="Metev_0532"
FT   CDS_pept        complement(529676..529966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0532"
FT                   /product="Protein of unknown function DUF424"
FT                   /note="PFAM: Protein of unknown function DUF424; KEGG:
FT                   mma:MM_1835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73444"
FT                   /db_xref="InterPro:IPR007355"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8A2"
FT                   /inference="protein motif:PFAM:PF04242"
FT                   /protein_id="ADI73444.1"
FT                   /translation="MYLKIHQSSRYYVVAVCDEDILGKTLKEGNLTVEISEQFYKGKTA
FT                   SENEVIEALSVATTANIFGEESVACAIKCSAVDPENVIRINDVPHAQIFRV"
FT   gene            complement(529980..533150)
FT                   /locus_tag="Metev_0533"
FT   CDS_pept        complement(529980..533150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0533"
FT                   /product="MCM family protein"
FT                   /note="KEGG: mpl:Mpal_2104 MCM family protein; PFAM: MCM
FT                   family protein; SMART: MCM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73445"
FT                   /db_xref="GOA:D7E8A3"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8A3"
FT                   /inference="protein motif:PFAM:PF00493"
FT                   /protein_id="ADI73445.1"
FT                   /translation="MAEEGWKERFGTFFRRYYWDEILHLANEYPEQRSLTVNYYDIENF
FT                   DQELADELIVNPDEIIPAAEEVLREGEELVLPVDKSLEEVHLRIINNPNKITIRNLRSK
FT                   HLMQSVAVEGMIRKATEVRPKITNAAFYCMRCEHVTYIPQTSQKFTEPHECENETCGRK
FT                   GPFKTLVDKSTFVDAQKLQIQESPENLRGGEQPQSLDIDVDDDLAGIVTPGDRVIINGV
FT                   LRSHQRTLRDGKSPFYDLVLHANSIEYVNKEFEELEITPEDEEEILELSKDPQIYEKVA
FT                   KSISPSIYGYENIKEALALQLFSGVTKALPDSSRVRGDIHILIVGDPGIAKSQMLRYME
FT                   KLAPRGVFTSGKSASSSGLTASAVRDELGDGRWTLEAGALVMADMGVAAVDELDKMSSE
FT                   DKSSLHEAMEQQCYDDQTEILTENGWKFFKDVIEGERVASLTPDGKLEYVVPGMYVASD
FT                   YEGDMYYLKSRQVDLAVTPNHNMYVDINKRANEWTGFDLHRMDSLPLHKRMRFKKNAYW
FT                   DGERIETFEIPSIVKYVNQNCSGIETESITVKMNDWLEFLGYYLPEGSVKYMNGIPYSV
FT                   QITQKTSGKIQKIQNSLDRLGFKWSYDGHSFSIHSKQLAKYLSMFGKCHEKFVPEYVKK
FT                   LCPGQIKIFVDAMVLGDGYIRCETGQMAYITSSKRLADDMQELALKMGYSANNYVVVNK
FT                   GEIIQVPEGRSSVISNDIYEVSFIREGGNHPSINTNGNYHIEKKPYKGKIYCVEVPNHV
FT                   LYVRRNGKPVWCGNTVSVAKAGIIATLKSRCALLGAANPKYGRFDRYEGIATQINMPPA
FT                   LISRFDLIFVLLDVPDDDKDRRIANHILKAHYAGEMMEQRSNNPVSEVSQQQIDSQMDV
FT                   ISPPIDVEKLRKYVAYARRNVYPILEDDARNHLIEFYMNLRKMGEDKDAPVPVTARQLE
FT                   ALVRLTESSARVRLSSVATLEDAKRTTNLVYTCLKQVGVDPDTGAFDVDVIETGTSKSQ
FT                   RDKIKVIREIIQSLADEHSDKKGAPVEEVYSRAEEEQIDREHAEELVTRMRRQGDLLSP
FT                   DKDHIRLV"
FT   gene            complement(533212..533910)
FT                   /locus_tag="Metev_0534"
FT   CDS_pept        complement(533212..533910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0534"
FT                   /product="RNA methyltransferase, TrmH family, group 1"
FT                   /note="KEGG: mma:MM_1837 RNA methylase; TIGRFAM: RNA
FT                   methyltransferase, TrmH family, group 1; PFAM: tRNA/rRNA
FT                   methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73446"
FT                   /db_xref="GOA:D7E8A4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8A4"
FT                   /inference="protein motif:TFAM:TIGR00050"
FT                   /protein_id="ADI73446.1"
FT                   /translation="MVLQIKIVLVEPLYQGNVGSIARVMKNFGLCELVLVNPCKLKGEA
FT                   RAMSSHARDILENAKVTNTFKEAVKDASLVVGTTGMTSSKDDEHIRNPSYTPKELKNRL
FT                   EGMDGKVAILFGREDNGFTNDELRLCDMIVHIPANEEYPIMNISHSAAVIFYELSNIQS
FT                   GEKPFADPFDLKLLHNHLNELLKQLEYPSHKKDKTLLMFRRVFGRAQLTNREVQTLRGV
FT                   LRIIQRRIKN"
FT   gene            complement(533944..534141)
FT                   /locus_tag="Metev_0535"
FT   CDS_pept        complement(533944..534141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0535"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mma:MM_1838 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73447"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8A5"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADI73447.1"
FT                   /translation="MEITIDKNKCTGCGACRKACLKGPKIFLLKDRNGKKVAEVGNPSY
FT                   CLGCRMCVSVCKPGAITLKN"
FT   gene            534382..535044
FT                   /locus_tag="Metev_0536"
FT   CDS_pept        534382..535044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0536"
FT                   /product="nitrite and sulphite reductase 4Fe-4S region"
FT                   /note="PFAM: nitrite and sulphite reductase 4Fe-4S region;
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; KEGG: mbu:Mbur_1482 nitrite and
FT                   sulphite reductase, 4Fe-4S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73448"
FT                   /db_xref="GOA:D7E8A6"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR017220"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8A6"
FT                   /inference="protein motif:PFAM:PF01077"
FT                   /protein_id="ADI73448.1"
FT                   /translation="MAEKDLLEKGAILQRDKETYAIAPHIPGGIVSADMLKKIADVAEK
FT                   YDAQALKVTSSQRIAIVGLNEEDLDDVWSELEMQPGAAIGVCVRSVKFCPGTTFCKRGQ
FT                   QDSVALGLKLDEKYHGMELPGKMKMGVAGCMNSCSEPAVKDIGIMGTSKGYTLMLGGSA
FT                   GLKPRIANTVATELSEEEVIQYVDRIIEFYKSQTSKKRLGQVIDNMGIEKFKEEVGL"
FT   gene            535234..537831
FT                   /locus_tag="Metev_0537"
FT   CDS_pept        535234..537831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0537"
FT                   /product="S-layer-related duplication domain protein"
FT                   /note="PFAM: S-layer-related duplication domain; KEGG:
FT                   mbu:Mbur_0268 S-layer-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73449"
FT                   /db_xref="GOA:D7E8A7"
FT                   /db_xref="InterPro:IPR006457"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8A7"
FT                   /inference="protein motif:PFAM:PF07752"
FT                   /protein_id="ADI73449.1"
FT                   /translation="MKLHSKLILTVLFIFGLIATAGISTAADNSTGNRIWDANENVSRD
FT                   YTWTAMSYSGFYYDLDTNESSETLTINLDSDSRNVNDGDLEYTTKPIETEFEYNEFGSY
FT                   EVIGFMAERYFAGYTDNTTFTDEDVSLMSDGQLAKVLTDTDDRESFFAGSELELEEGYS
FT                   IHIIEVDINGDSVFVELRKDGDQIDSGIVSGGDVYTYEKDLGSADDVPIIAVNFDNIFR
FT                   GTETNAVFVEGIFQISEDYTEVDDGDNYGKMEVDSVTSNEITMSNDDSITLGQGDDINI
FT                   MGRLNFIVADDSTLRFGPYVDISESGTYELRGTVTENENFEWTPLNFEGFYYDIDEGLK
FT                   TESIEVTRDKRNIDDGDLLYTTEPAEVEFEFGDFGSYEVIGFMAEKYFAGYTEDNTTFS
FT                   DEDVSLMSDGQLSKVLIDDDETKSTFSGSSLVLEEGYRLRIVEVDLEGDSVFVELHKDG
FT                   EQIDSGVVSGGDVYTYEKDVGSADDVPIIAVNFEDIFRGSETNAVFVEGIFQISEDYTE
FT                   VDDGDNYGKMEVDSVSSNEISMSNDDSITLGQDDTISIMGNINFKVADDSDTVRYYPFV
FT                   EVTTGPGDMLTIDLPDTITQDSTVTITIESRGAAVQNAVVMVDDENIGTTTREGTIEYT
FT                   PEDTGTFTVTAEKQGFVSASKEIEVIGQQENRMSVDISPDEIFAGDIITITVTEAIGNE
FT                   PIENAEVTYDDESIGDTSADGTINYTTNDPGVHKVTASKDGYQDGEENIEILESGAQFS
FT                   ISDLNISPSEVEAGNPVSITVNATNIGNMGGDYTIELMVNGTMEDSEQINLDAGNSTTV
FT                   EFTHTENEPGNYSVEVDGQTGTYTVTPSGVPGIGVFGLIAVLTIAYLFRKRQK"
FT   sig_peptide     535234..535314
FT                   /locus_tag="Metev_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.905 at
FT                   residue 27"
FT   gene            complement(537867..538508)
FT                   /locus_tag="Metev_0538"
FT   CDS_pept        complement(537867..538508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0538"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="KEGG: mma:MM_0696 beta-phosphoglucomutase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73450"
FT                   /db_xref="GOA:D7E8A8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8A8"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ADI73450.1"
FT                   /translation="MLKALMFDMDGVLVNSMPYHVEAMKVAFDNIGVQINKQDIYEHEG
FT                   SRTIDIVRDLLIKDNKNPDSFNLDGIIQQYEQEFNKIVKLEPFEGLKDLLDALKNKYIL
FT                   CVVSGAEDSIVKDILEKLYPDVFDVIITANDVENGKPVPEPYLRAVEKSGVEKGECIVF
FT                   ENAMLGVESAKRAGLYCVAIPTYIDRNKLENADVIVENHDCLKQYLIDLE"
FT   gene            538652..539380
FT                   /locus_tag="Metev_0539"
FT   CDS_pept        538652..539380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0539"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   aae:aq_926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73451"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8A9"
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /protein_id="ADI73451.1"
FT                   /translation="MADKYFIGTSGWQYDHWRNVLYPEKLGKKKWLSYYAERFNTVEVN
FT                   STFYNPIKPKTFSRWYNETPSNFKFTIKGYRVITHFKKLHDVEDDIKAFYERAAPLQHK
FT                   LGCVLWQLPSNLHKNMELLEEFCKNLDKRKNNVIEFRHVSWFTEDVQSLLQKYKIGYCI
FT                   ISSPELPEIITVTSNILYMRFHGINNWYTEKYGKEKLKDYASKIKKTDAKKVYCYFNND
FT                   ENGYAVHDAYNLRELLTQDY"
FT   gene            complement(539632..540330)
FT                   /pseudo
FT                   /locus_tag="Metev_0540"
FT   gene            540661..541440
FT                   /locus_tag="Metev_0541"
FT   CDS_pept        540661..541440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0541"
FT                   /product="CoB--CoM heterodisulfide reductase"
FT                   /EC_number="1.8.98.1"
FT                   /note="KEGG: mbu:Mbur_2436 CoB-CoM heterodisulfide
FT                   reductase, subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73452"
FT                   /db_xref="GOA:D7E8B0"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8B0"
FT                   /inference="protein motif:PRIAM:1.8.98.1"
FT                   /protein_id="ADI73452.1"
FT                   /translation="MSMEYFSGISDAMRITFVQVMILSVIAIGIFLYGMYLNIKKWGLG
FT                   TTGYAQEPGGGGITVFPKTFASQVAKKGDWKIILKTLVLDIILQRRIIRISKFRWFMHI
FT                   SIFVGWMTLFLLSLLMFLIELLSLSGVNIHPEAIRQMLQPWNDLFSYILLLGIGIAIFR
FT                   RLFVKRARESTISYDAVLLAGLTFIVITGFVAQGIRIGDFWAFGIDWGINAAPQMALFH
FT                   AVVSLLFCIAYIPFSKYIHMIATPLTILANIEAEEGE"
FT   gene            541446..542684
FT                   /locus_tag="Metev_0542"
FT   CDS_pept        541446..542684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0542"
FT                   /product="CoB--CoM heterodisulfide reductase"
FT                   /EC_number="1.8.98.1"
FT                   /note="KEGG: mac:MA0688 heterodisulfide reductase, subunit
FT                   D; PFAM: protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73453"
FT                   /db_xref="GOA:D7E8B1"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8B1"
FT                   /inference="protein motif:PRIAM:1.8.98.1"
FT                   /protein_id="ADI73453.1"
FT                   /translation="MAKKQPSIDTKGITAVQLMELDSCTRCGECVQWCPTYSASGQEPG
FT                   LAPRDKILRWRDYMNKSYGLRAKLFGPKEISEEELDEFSSDLYQCTTCGICETVCESGI
FT                   DTINLWEGIRANLVKRGQGPYGKQKYFFKLVSEYGNPYMEPAENRTAWMPEDIEVKETA
FT                   DIVYYGGCTAEYKQTKLAVATARVLNKLGIDFAMLGEDELCCGSPLLRTGQSELENIAR
FT                   DCTIKNVENIKAKGASKVLYACAGCYRTSIVDWPKLYGKPLPFEIVHITEFLADLIKQG
FT                   KIKWEKSINKTVTYHDPCHMGRHVGTYDAPRYVLENIPGIKLIEMDRIKDYSRCCGAGG
FT                   GMKAGIPDLALKVGEERIEDALETDADILSSACPFCKRNLADARDSVDAKDMEVEDVIV
FT                   LVAEALGLEVEGE"
FT   gene            complement(542710..542955)
FT                   /locus_tag="Metev_0543"
FT   CDS_pept        complement(542710..542955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0543"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hdu:HD0283 fimbrial outer membrane usher
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73454"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8B2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73454.1"
FT                   /translation="MLVSLDHKKVIVENTTTRERHLKIPRKYLDYKGIELGPESTILNE
FT                   VRDAYLLLDSNINGVWIPKEIVIDELKLYLSEYENV"
FT   gene            complement(543200..543631)
FT                   /locus_tag="Metev_0544"
FT   CDS_pept        complement(543200..543631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC2801 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73455"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8B3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73455.1"
FT                   /translation="MDKGDIIEKFVLALLIAFLSAVSFSGCIGGPESTPEETLDDYISY
FT                   YNSSEFNNIYDELLSSDVKDDYTRDEFHNLNRISEATFRINGYEITGSSDENGSVILTV
FT                   DVIWNVNAFDIQRTKTHTIEFVVEDNRWKMNDILRPIEI"
FT   gene            543718..544365
FT                   /locus_tag="Metev_0545"
FT   CDS_pept        543718..544365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0545"
FT                   /product="protein of unknown function DUF116"
FT                   /note="PFAM: protein of unknown function DUF116; KEGG:
FT                   mma:MM_1845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73456"
FT                   /db_xref="GOA:D7E8B4"
FT                   /db_xref="InterPro:IPR002829"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8B4"
FT                   /inference="protein motif:PFAM:PF01976"
FT                   /protein_id="ADI73456.1"
FT                   /translation="MYIPYALLGRVFVYLVVAVIILTLISLLIGIYSYKKNKSLFPNFI
FT                   FFMLYFFYSPAKLICRTCSIKESIVDDIIIEVGNAVMLERFKQVNGKCAVILPQCLRHP
FT                   NCKARCDPITGYECEKCGLCDIGTICEAAEKYNFKVFVVPGDSFVRKIIKSYRPHACIG
FT                   VACHMELTESMQEVSKYMPVQGVWLLKDGCYNTEVDVDEVIRKMEMCNNNAL"
FT   gene            544355..545053
FT                   /locus_tag="Metev_0546"
FT   CDS_pept        544355..545053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0546"
FT                   /product="protein of unknown function DUF116"
FT                   /note="PFAM: protein of unknown function DUF116; KEGG:
FT                   mba:Mbar_A1601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73457"
FT                   /db_xref="GOA:D7E8B5"
FT                   /db_xref="InterPro:IPR002829"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8B5"
FT                   /inference="protein motif:PFAM:PF01976"
FT                   /protein_id="ADI73457.1"
FT                   /translation="MLYNLIGIALFFFIIVSIILTTTALLVGRINLNRNVWLAGFFVNI
FT                   LDFFYLPIKILFQKFSDSSKLDKLMVSLRNTANKSSFKKTRNRLILAPHCMRSLDCPAS
FT                   STRFGIKCISCNKCILASIKKDAENYNYKLYIVAGSSYIRHIVKKEPVDGALLLACYYE
FT                   LNKVMRYLKQKNIVTYGVPLLEDGCYNTTIDYNNLKKTLNDLKMSEESKLPSVTAKVPH
FT                   HVDDAERLIK"
FT   gene            complement(544971..545323)
FT                   /gene="rnpB"
FT                   /locus_tag="Metev_R0015"
FT   ncRNA           complement(544971..545323)
FT                   /gene="rnpB"
FT                   /locus_tag="Metev_R0015"
FT                   /product="RNA component of RNaseP"
FT                   /note="Bacterial RNase P class A as predicted by Rfam
FT                   (RF00010), score 53.35"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            545484..546629
FT                   /locus_tag="Metev_0547"
FT   CDS_pept        545484..546629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0547"
FT                   /product="methanogenesis marker protein 9"
FT                   /note="KEGG: mbu:Mbur_0212 hypothetical protein; TIGRFAM:
FT                   methanogenesis marker protein 9; PFAM: dihydrouridine
FT                   synthase DuS"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73458"
FT                   /db_xref="GOA:D7E8B6"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017671"
FT                   /db_xref="InterPro:IPR037347"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8B6"
FT                   /inference="protein motif:TFAM:TIGR03277"
FT                   /protein_id="ADI73458.1"
FT                   /translation="MNNELFNLQVDNISLKNPIALGPMAGVTDSNFANKYAKNAGLVIL
FT                   GGFNLDDKTNEAASRMAERGREEFITDNPLQFLKEEINNVDTGSVVAVNVRSATPEPLI
FT                   EAAQIAKESDAILELDAHCRQEEMVNIGVGEALMHDTSRLADWIQKIKETGVVLSVKIR
FT                   ANVVDDVELSRQIESAGADILHIDATLEGKNTADLKAIRKIRDSVRMTLIGNNSITEFS
FT                   DAKDIFSRGADLVSVSRGVMDNPYLIDELVESVNDFQNKTGWYNAPKHICAGEGDLRGL
FT                   TFCCPPIKPCAVQKKLNKLGISPEEFKNLKMEFSKGSKLEFGDSTCFGSLAWCCKLTKF
FT                   CPIRDGVLYMLDMSGPEYMRLKKELADYILDNANIPVNETE"
FT   gene            546626..547573
FT                   /locus_tag="Metev_0548"
FT   CDS_pept        546626..547573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0548"
FT                   /product="triphosphoribosyl-dephospho-CoA protein"
FT                   /note="PFAM: triphosphoribosyl-dephospho-CoA protein; KEGG:
FT                   mba:Mbar_A1606 putative triphosphoribosyl-dephospho-CoA
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73459"
FT                   /db_xref="GOA:D7E8B7"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8B7"
FT                   /inference="protein motif:PFAM:PF01874"
FT                   /protein_id="ADI73459.1"
FT                   /translation="MNIKTYLPEDEYSGDKIASYITRCAQLSMVLEVSAFPKPGNVDRD
FT                   HNYIDTYYEHFMASAIGVYPVIEDASKSSHGIGKLIKRSVSESVNWQKGGNTHFGAFIL
FT                   LIPLTMAAGKIMAHKSQFSLNELINCAHDLVKNTDVLDAVDFYESFRLAGVRVNNVDDF
FT                   DLQDENSIDSLYEQNITLYDLMEIAKNYDIVANEWSEGFNRCSQCAEIIIEKMKNNYNN
FT                   INNTIVYAFLKILSENKDTFIETKFDTETAVYVSTKASEIISALEEQNTDFESMIPDIQ
FT                   KFDRELLDKKINPGSTADITIAGLYIALLGGIRF"
FT   gene            547570..548169
FT                   /locus_tag="Metev_0549"
FT   CDS_pept        547570..548169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0549"
FT                   /product="protein of unknown function DUF447"
FT                   /note="PFAM: protein of unknown function DUF447; KEGG:
FT                   mma:MM_1853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73460"
FT                   /db_xref="GOA:D7E8B8"
FT                   /db_xref="InterPro:IPR007386"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR016733"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8B8"
FT                   /inference="protein motif:PFAM:PF04289"
FT                   /protein_id="ADI73460.1"
FT                   /translation="MNQNNINLKEYGIYDGISETIITTGTDSPNAAPMGLIRKDDRIQI
FT                   RLFKGSQTYENVVNEKCLVANVVIDPVVFARSTFTNLCDEEFDTVSVNNRKHPFLKNAL
FT                   SYVIFECSDIRYTKNTLVADVLPLYACINRNVIKAPNRGFNAVLDALIHATRYRVFDDE
FT                   KYLNMVYELNNTVKKCGGSKEKRAMKILYDYLNIEH"
FT   gene            complement(548172..548843)
FT                   /locus_tag="Metev_0550"
FT   CDS_pept        complement(548172..548843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0550"
FT                   /product="PHP domain protein"
FT                   /note="KEGG: mba:Mbar_A0352 isoleucyl-tRNA synthetase;
FT                   PFAM: PHP domain protein; SMART: phosphoesterase PHP domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73461"
FT                   /db_xref="GOA:D7E8B9"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8B9"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ADI73461.1"
FT                   /translation="MRLLIDVHVHSCFSKDSNSKLESIISFAEKNGLDAVAICDHDTVE
FT                   GGIEGLKVAKKLGSKITVIPGIEVTSTKGHILVLGVDKNIEPHLTPEETIKAARKSGGV
FT                   VIVPHPFKISSQGIGFVDGIDIDAVEVLNSRCFTDKPNDEARRAAQLHNIPEAGGSDSH
FT                   IPDTVGQTYTIVEVSENTPEAIISAIKNGTISAGGKKVPVSVVFKHTLSTIKRKVLQRL
FT                   R"
FT   gene            complement(549059..550315)
FT                   /locus_tag="Metev_0551"
FT   CDS_pept        complement(549059..550315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0551"
FT                   /product="GTP-binding protein HflX"
FT                   /note="KEGG: mbu:Mbur_2411 small GTP-binding protein;
FT                   TIGRFAM: GTP-binding proten HflX; small GTP-binding
FT                   protein; PFAM: GTP-binding protein HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73462"
FT                   /db_xref="GOA:D7E8C0"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8C0"
FT                   /inference="protein motif:TFAM:TIGR03156"
FT                   /protein_id="ADI73462.1"
FT                   /translation="MKSVILVQRNEPRSNESENSDKLFELEELAKSAGYCIVGEITQSK
FT                   NPDRRYQVGRGKVDELASLVNEYNAEKVIFYNQLSTIQIYNVSETCKCEVIDKFHLILE
FT                   IFATRATTKRAKLQVELAQLEYELPKAKNIVSLLKQEERPGFMSLGEYEDSYEQDIKNR
FT                   ISRIKNELKTAKKDRESLRKFRHDKGFSLVALAGYTNAGKSTLFNTIVDEDVRVEDMLF
FT                   TTLSPVTRSLNLGGRHVLLTDTVGFIEDLPHWMIDAFRSTLDEIFLTDVILLVVDVAED
FT                   AEKIRKKLATSHEILWNKSEGAPIITVLNKVDAIKSDELNKKLDKIEYLAPNPVFISAK
FT                   SGYGLDNLKKQINQQVPGWKRTSVSLPMSDDGMAAVSWLFEEGVVHNIDYGDYIEVDLE
FT                   ARDEIIHKAQIYEREIFVD"
FT   gene            complement(550344..550736)
FT                   /locus_tag="Metev_0552"
FT   CDS_pept        complement(550344..550736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mac:MA3623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73463"
FT                   /db_xref="InterPro:IPR014514"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8C1"
FT                   /inference="protein motif:PFAM:PF09974"
FT                   /protein_id="ADI73463.1"
FT                   /translation="MWDIIAVDISGRHKIKNGYYMVCAAVSVVSSADHVEKVNQVKIKP
FT                   FWMDSAPQVTDVVRIIEDTVKEIKYDGTIVAEKGDMYNKPEWVATSMFSKNFKYQESLS
FT                   ERLAIEMAHHISLSARNLLIQELDIS"
FT   gene            complement(550746..551801)
FT                   /locus_tag="Metev_0553"
FT   CDS_pept        complement(550746..551801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0553"
FT                   /product="tRNA intron endonuclease"
FT                   /note="KEGG: mbu:Mbur_1040 tRNA splicing endonuclease;
FT                   TIGRFAM: tRNA intron endonuclease; PFAM: tRNA intron
FT                   endonuclease, catalytic domain protein; tRNA intron
FT                   endonuclease domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73464"
FT                   /db_xref="GOA:D7E8C2"
FT                   /db_xref="InterPro:IPR006676"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR006678"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR023516"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="InterPro:IPR036740"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8C2"
FT                   /inference="protein motif:TFAM:TIGR00324"
FT                   /protein_id="ADI73464.1"
FT                   /translation="MIGELTNDRVLVDEKGIDELYKSGYFGRPKGNKLELSLVEAAYLL
FT                   YRNKIKAQENEKGLDFTDFFKKASLRQQYFELKYIVYKDIRERGLYIQPGVTDFRVYPR
FT                   GGHPGKSQPRSYIHVHSERIPLSLKDLQKLLETADNVHKQLILAIVDEESDITFYEAKK
FT                   VNIKGDMKKLYPDLTTSASLMEDRVLIWDGESSNTIHENGFYGKLLDPEHLQLSLVESG
FT                   YLLENNIIQVNDRKNGNHLNFSEFSKRASFIESEFPRKCRVYSDLRNRGLVPKTGFKFG
FT                   THFRVYKQVESSNNIPHSEYLVHALPNDYEFILPVMSRAIRLANSVKKRMLFAVEKEKG
FT                   FEYIDIGRVKM"
FT   gene            complement(551828..553303)
FT                   /locus_tag="Metev_0554"
FT   CDS_pept        complement(551828..553303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0554"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="KEGG: mbu:Mbur_1039 hydrogenobyrinic acid
FT                   a,c-diamide synthase (glutamine-hydrolysing) / cobyrinate
FT                   a,c-diamide synthase; TIGRFAM: cobyrinic acid a,c-diamide
FT                   synthase; PFAM: Cobyrinic acid ac-diamide synthase;
FT                   CobB/CobQ domain protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73465"
FT                   /db_xref="GOA:D7E8C3"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8C3"
FT                   /inference="protein motif:TFAM:TIGR00379"
FT                   /protein_id="ADI73465.1"
FT                   /translation="MSQQKNDKNRIKIPMPRVLLAADRSSSGKTTITSGLLAALTFQGY
FT                   RPQPFKVGLDYIDPSYHSEITGIKARNLDGYLMDDDKILDVFTHAFESEKADLAVIEGV
FT                   RGLFEGLESFSDTGSTAQIAKTLDCPVVLIINARSITRSAAAIVNGYVNFDPDVNIAGV
FT                   ILNNIGGGRHAKKAKDAIEYYTGVPVLGIIPRDDSMQISMRHLGLVPAIEGRQKDSEFR
FT                   KRIYSIESIIKENVDIEKIIEISHNASPVEKPEYTLFKPNQINYKPTIGIALDEAFNFY
FT                   YHNNIELLELEGARIKYFSPIHDAHLPKVDGLYIGGGYPELFGDELESNESIRNDIKEA
FT                   SGQGLPIYAECGGLMYLTEKMTTGVQNKHKGKYHMAEMQESTYNMVGALPGHTLMGHTR
FT                   VVSYNIGMFKCDSVIGKAGNSFRGHEFHHSEITNLPSNSNFAIKLSRGTGIVSGWDGLT
FT                   VNNTMGSYAHLEAVSYEAFASSFVDCIFRSDNF"
FT   gene            complement(553270..554151)
FT                   /locus_tag="Metev_0555"
FT   CDS_pept        complement(553270..554151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0555"
FT                   /product="Nitrogenase"
FT                   /EC_number="1.18.6.1"
FT                   /note="KEGG: mbu:Mbur_1038 nitrogenase iron protein subunit
FT                   NifH; PFAM: NifH/frxC-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73466"
FT                   /db_xref="GOA:D7E8C4"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8C4"
FT                   /inference="protein motif:PRIAM:1.18.6.1"
FT                   /protein_id="ADI73466.1"
FT                   /translation="MNNKTNDNNQKQKRIALYGKGGIGKSSTASNVAAACADEGYKVMI
FT                   IGCDPKSDSSITLLGGKRIPTILDLLRDGEGLNEEDVVFEGYNGVKCVEVGGPEPGIGC
FT                   AGRGIIVAINQLKRISDSMKEMDLIIYDVPGDIVCGGFVAPVRKGMVNESYIITSGEYM
FT                   PMYAANNICSGLSKINTPLNGIVCNSRDVTNEKEIVEEFAHEIGSELLSFIPKEQIVQD
FT                   CEREGYSVMDIAPDSKIAQVYRELAQKIMSKTEPDSVLPNSMDDEQLRELARKQSKQET
FT                   KSCHNKKTIRTE"
FT   gene            complement(554166..555287)
FT                   /locus_tag="Metev_0556"
FT   CDS_pept        complement(554166..555287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0556"
FT                   /product="methanogenesis marker 13 metalloprotein"
FT                   /note="KEGG: mma:MM_0515 hypothetical protein; TIGRFAM:
FT                   methanogenesis marker 13 metalloprotein; PFAM:
FT                   oxidoreductase/nitrogenase component 1"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73467"
FT                   /db_xref="GOA:D7E8C5"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR017675"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8C5"
FT                   /inference="protein motif:TFAM:TIGR03282"
FT                   /protein_id="ADI73467.1"
FT                   /translation="MSTNPKTKELSIIHPRPSSIVAALYTLRDLNVDVAILHGPPGCSF
FT                   KHARLLEEDGIHVLTTALDENCFVFGGHDELVNVINKAVDLFNPGLIGIVGTCASMIIG
FT                   EDLHEPVLDANLDIPVIEVEVHAGYSDNTKGVLFALESALDAGIIDRTEFERQKYLLEE
FT                   ATSVEKRYGAASKQYLEPSRGDVKYRVGKRIIELLKEGKRGITIMNAKKETGYMFADIT
FT                   LAVNQVASKLGKESNIVNMANTNDNVGLPRVRQHAQNIMDDFNENDVDVHELIGGMDEY
FT                   PITGDEINRLIEEKYSDYDFAVISGVPHAIPMDNLSDMEIVSVTNGPRQVFPLKDMGHD
FT                   HVIVEVDLHPKTLGVDYIVESEFGATLREIINE"
FT   gene            complement(555306..556697)
FT                   /locus_tag="Metev_0557"
FT   CDS_pept        complement(555306..556697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0557"
FT                   /product="Mur ligase middle domain protein"
FT                   /note="PFAM: Mur ligase middle domain protein; KEGG:
FT                   mbu:Mbur_1036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73468"
FT                   /db_xref="GOA:D7E8C6"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8C6"
FT                   /inference="protein motif:PFAM:PF08245"
FT                   /protein_id="ADI73468.1"
FT                   /translation="MISGACKYKNIAVLDLTHGGAIIARKLSELGYNVHAVDVYNTEDD
FT                   DTLSNLKINNISTYKKPFPVDYLDLLITPIHLDPEYPMLKQAIAKNVDIATHHWIVGKI
FT                   LSDDKRLEDKTIIEVTGTRAKTSTSSLLADILSRKLDVVLHSSRGVEYWKEGLPETIYD
FT                   GLSITPGNILQVMDRSFSEKLNPDAYIFEVSLGGTGIADFNIITTLEQDYKIAKENRWA
FT                   SSAKTQMINYAKSGSKLLINTDTKGLINHSAKKFNSIFEFNDGKYPDSQGDLNLILDNN
FT                   DIIIRLPNETISINTGYSYDIESYTTAIAAAVSTAYNIGVELSVIKKTLVEFSGLQGRM
FT                   REQTFNNCILIDNSNSGTDVTSADKSLDYALDKKCSGKVVMVMGEESAQVCEGLSLKKT
FT                   YDFVNLRSSDIDQLILVGDRLHNIKLKDAYHTSTLDEGLKVAFEIVNSSHVSDNLIISN
FT                   VKCFR"
FT   gene            complement(556718..557122)
FT                   /locus_tag="Metev_0558"
FT   CDS_pept        complement(556718..557122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0558"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein; KEGG: mma:MM_0517 sirohydrochlorin
FT                   cobaltochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73469"
FT                   /db_xref="GOA:D7E8C7"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="InterPro:IPR023652"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8C7"
FT                   /inference="protein motif:PFAM:PF01903"
FT                   /protein_id="ADI73469.1"
FT                   /translation="MSENSKLGILAIGHGSKLPYNKQVVTDIANRIADKHEDVVVRAGF
FT                   MEKNEPTVEEALQSFEGTGISKIAAVPVFLASGVHITQDIPEILGIDPDSKEGSIKLNG
FT                   TEIPIVYGNPLGSDDLLAELVYNRAQEALD"
FT   gene            557192..558463
FT                   /locus_tag="Metev_0559"
FT   CDS_pept        557192..558463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0559"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mma:MM_0587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73470"
FT                   /db_xref="GOA:D7E8C8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8C8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADI73470.1"
FT                   /translation="MDIHSGNILSRFKNRELINICQITICIIGGVIVKEGKYRIGMFSW
FT                   ESLHAVKVGGIAPHVTELSEALAEKGHEVHIVTRNDGNHDAHDIINGVHYHRIVYDPSG
FT                   DVIHQMNKMCDAMYSTFLEVRDEYGEFDVLHGHDWHPVTVLCRLKHELGLPFVLTYHST
FT                   EWGRNGNRHNPDPIAQEITQREWLGGYESSEVIVTSQVLYDEVVYLYQIPDYKISIVPN
FT                   GTHINKIRRNIDPGSVKKKYGIHPLAPIVLFIGRMNYQKGPDLLVESVPMILNHRQDVQ
FT                   FVFIGEGDMRSHCEYLAETLGVSDSCHFLGYASDEAAIDWYNACNVVCMPSRNEPFGIV
FT                   VLEAWDAGKPVVASDAVKLVDNFKNGVVVYKYPESIAWGVNYVVDGLGDDSMGNFGREL
FT                   VETKYNWTTIAVGTLEVYNRVIQV"
FT   gene            complement(558460..559098)
FT                   /locus_tag="Metev_0560"
FT   CDS_pept        complement(558460..559098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mac:MA3684 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73471"
FT                   /db_xref="InterPro:IPR014518"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8C9"
FT                   /inference="protein motif:PFAM:PF09920"
FT                   /protein_id="ADI73471.1"
FT                   /translation="MPNSSAQKEHVNNEFYTQKRWNNWINKVKESGFEFKESDEETEKE
FT                   SAIFVYMQDDVILACLKVIAQYERNILSKEDTLDIISQIREIVLEEIDSISEDIDLMIE
FT                   SLQTSLMAAIAACEVYIMDEYDKEAKIDELIKAAVDAEDSEDLQVAMQFIAETGARVIG
FT                   GEQLPENIFDELPYGLVAEWLDGIDSIAAAMVGADSYKEDDGSGDFEPI"
FT   gene            complement(559191..559640)
FT                   /locus_tag="Metev_0561"
FT   CDS_pept        complement(559191..559640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0561"
FT                   /product="Protein of unknown function UPF0179"
FT                   /note="PFAM: Protein of unknown function UPF0179; KEGG:
FT                   mba:Mbar_A0292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73472"
FT                   /db_xref="InterPro:IPR005369"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8D0"
FT                   /inference="protein motif:PFAM:PF03684"
FT                   /protein_id="ADI73472.1"
FT                   /translation="MVNNESTKVTLVGCRLAKEGQEFIYWGESPDCSGCKIKGTCNNLE
FT                   AGRKYRVEKIRNGTVHGCYLHDQGVMVVEVSRTPVVATIESKKAVPGAKINFEPIKCSE
FT                   INCEFYGYCYPKGLKSGDKCTIVNVMDDVDECLRGKSLKKVELSL"
FT   gene            complement(559677..560747)
FT                   /locus_tag="Metev_0562"
FT   CDS_pept        complement(559677..560747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0562"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG: mbu:Mbur_1032
FT                   NAD(P)-dependent glycerol-1-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73473"
FT                   /db_xref="GOA:D7E8D1"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR023002"
FT                   /db_xref="InterPro:IPR032837"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8D1"
FT                   /inference="protein motif:PFAM:PF01761"
FT                   /protein_id="ADI73473.1"
FT                   /translation="MIQDKHGETKWMQLPRDVVVGTGVINDITDVCNDLKLGDNALIVT
FT                   GDSTRKIAGDIVHDELEDKGRSVEMYTSSSATMDEVRRVEDEAMKYGSNYLLGVGSGNS
FT                   IDIAKLAATELDIPFLSVPTAASHDGIVSSRASIIHDSKTTSIQSNAPMAVVADTEIIA
FT                   NAPYRLLAAGCGDIVSNYTAVLDWELASRLKNESFSEYAASLSRMTAKILIDSADSIKP
FT                   ELESSARLVVKALVSSGVAMSIAGSSRPASGSEHMFSHALDSIAPGSALHGEQCGVGTI
FT                   MMMYLHGGDWQMIRDGLKKIRAPTTAEELGVEDKYIIEALLISHTIRQERYTILGTSGL
FT                   TRDAAEAVAKTTKVIS"
FT   gene            560867..561718
FT                   /locus_tag="Metev_0563"
FT   CDS_pept        560867..561718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0563"
FT                   /product="Protein of unknown function DUF63"
FT                   /note="PFAM: Protein of unknown function DUF63; KEGG:
FT                   mac:MA3687 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73474"
FT                   /db_xref="GOA:D7E8D2"
FT                   /db_xref="InterPro:IPR002749"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8D2"
FT                   /inference="protein motif:PFAM:PF01889"
FT                   /protein_id="ADI73474.1"
FT                   /translation="MNSFIDNIWEFIQNYYIDPIIFDTGYNPVNTITWAIFLGIFLFGV
FT                   IKLFKRLNISVDDRFILSIIPFILAGSSLRVVEDAGIFNAPVNYLLITPIIYFLVFAIV
FT                   ILTLVVSKWLYNKEFIKDYHILVASIGSLWFIFNVSILLYFENVVNLYVPYFVIGAATL
FT                   LVFIVYKILKYSGLDILSTNLNFAIMWAHLLDASSTIVGIDLLGYHEKHVVPSYLIELT
FT                   NTATVMYPLKILIFIPVLYILDSYFNEDRESRNLKTFVKIVILILGLAPACRNTIRMTL
FT                   GI"
FT   gene            561724..562332
FT                   /locus_tag="Metev_0564"
FT   CDS_pept        561724..562332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0564"
FT                   /product="protein of unknown function DUF95 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF95
FT                   transmembrane; KEGG: mbu:Mbur_1030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73475"
FT                   /db_xref="GOA:D7E8D3"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8D3"
FT                   /inference="protein motif:PFAM:PF01944"
FT                   /protein_id="ADI73475.1"
FT                   /translation="MNALSKRIRIDYAKSYLNSISFYLLIIVALFISSIIIGAVYSSMN
FT                   PEIAQQSMEEFRNMIDFIKSLPPYAIMLFIFVNNTVKTLIALLLGIGFGIIPFAFIAYN
FT                   GYIIGIFGFITAMEKGLFYLVTALLPHGIIELPMVFISAAIGLKLGHEMFNSVTGRKAN
FT                   IKEELSRGIRFYFYWIVPLLFVAAAVETFITPTLIQLIL"
FT   gene            562404..563555
FT                   /locus_tag="Metev_0565"
FT   CDS_pept        562404..563555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0565"
FT                   /product="IMP biosynthesis enzyme PurP domain protein"
FT                   /note="PFAM: IMP biosynthesis enzyme PurP domain protein;
FT                   IMP biosynthesis enzyme PurP; KEGG: mbu:Mbur_1029
FT                   5-formaminoimidazole-4-carboxamide-1-(beta)-D-
FT                   ribofuranosyl 5'-monophosphate synthetase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73476"
FT                   /db_xref="GOA:D7E8D4"
FT                   /db_xref="InterPro:IPR009720"
FT                   /db_xref="InterPro:IPR010672"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023656"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8D4"
FT                   /inference="protein motif:PFAM:PF06973"
FT                   /protein_id="ADI73476.1"
FT                   /translation="MIDRKQIMDIVNDYDADNIKVGTVGSHSALDVFDGAVEEGFNTFA
FT                   ACKSGREKTYNQYFKAKRDSEGNVIRGIVDEASVFSRFDDILNHQQKLVDDNVLFVPNR
FT                   SFTTYCGIENVENNFKVPLVGSRNLLRSEERGMDYDYYWILDKAGLPYPERVNKPEDID
FT                   ELVMVKLPHAVKTLERGFFTAASYEEYLDKANNLLDRGIITQDALDNAVIEKYIIGPVF
FT                   NFDMFYSPIEDEMNKLELLGIDWRFETSLDGHVRLPAPQQMTLSEHQMNPEYTVCGHNS
FT                   STLRESLLDKIFELSEKYVEATQKYYDPGIIGPFCLQTCIDKDLNFHIYDVAPRIGGGT
FT                   NVHMSVGHSYGNTLWRKPMSTGRRVAFEIKRAIETEQLDKIVT"
FT   gene            563792..565024
FT                   /locus_tag="Metev_0566"
FT   CDS_pept        563792..565024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0566"
FT                   /product="protein synthesis factor GTP-binding protein"
FT                   /note="PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; Initiation factor
FT                   eIF2 gamma domain protein; KEGG: mbu:Mbur_2278 translation
FT                   initiation factor IF-2 subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73477"
FT                   /db_xref="GOA:D7E8D5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR022424"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8D5"
FT                   /inference="protein motif:PFAM:PF00009"
FT                   /protein_id="ADI73477.1"
FT                   /translation="MSQPCVNIGLVGHVDHGKTTLVRALSGIWTDRHSEEMKRGISIRL
FT                   GYADATLRECSDCPVPNCYTVENTCPECDSETTELRKISFVDSPGHETLMATMLSGAAI
FT                   MDGAVLVIAANEKCPQPQTKEHLMALNIIGIKNIIIVQNKIDLVTRDKMVEHYHQIKDF
FT                   VAGTVAEDAPVIPISAQQNINIDVLIKAMEDIIPTPVYKLDKPARMFIARSFDINKPGY
FT                   SIDKISGGVIGGTLKDGKLNSGDELEIRPGRKVESEGSVKWEPITTNVSMLLAGTERLE
FT                   EVTPGGLIAVGTTLDPSLTKSDSLTGQVAGEPGNLPPTHHSLKLELHLFDKIVGVTEET
FT                   NADIGNIKTSEPLMLNVGTATTVGIVTSARSDVAEVKLKRPVCAEAGSMVAISRRIGSR
FT                   WRLIGAGAIKP"
FT   gene            565021..565389
FT                   /locus_tag="Metev_0567"
FT   CDS_pept        565021..565389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0567"
FT                   /product="Nucleotide binding protein PINc"
FT                   /note="SMART: Nucleotide binding protein PINc; KEGG:
FT                   mbu:Mbur_2279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73478"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8D6"
FT                   /inference="protein motif:SMART:SM00670"
FT                   /protein_id="ADI73478.1"
FT                   /translation="MKVIIDTNALMIPVQFNVDIFQELKRLGYNKFLVPKAVLNELDTL
FT                   VKKSKGSDKAAAKVACSLGNKCEIINQTGIADEVIIKLANELDSAVLTNDIELKKRLID
FT                   KNIPVIYLRQKNRLEKTP"
FT   gene            565476..566042
FT                   /locus_tag="Metev_0568"
FT   CDS_pept        565476..566042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0568"
FT                   /product="DNA-directed RNA polymerase"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase; KEGG:
FT                   mbu:Mbur_2280 DNA-directed RNA polymerase subunit E'; PFAM:
FT                   RNA polymerase Rpb7 domain protein; RNA binding S1 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73479"
FT                   /db_xref="GOA:D7E8D7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004519"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8D7"
FT                   /inference="protein motif:TFAM:TIGR00448"
FT                   /protein_id="ADI73479.1"
FT                   /translation="MYKKMKLVDTVRISPDRLGDDETLSVKDALKNKLEGRIDKKNGSI
FT                   VAITDIESIGEGHIIMGDGAVYYDVTFKAIVFMPMMQEVIEGKVVEIVDFGAFISFGAM
FT                   DGLLHVSQITDDFMSYDGKNARLISKNSNRALAEGDYLRARIVAVSINERDPRESKIGL
FT                   TMRQVGLGQFQWLEEERQATAKAVE"
FT   gene            566065..566250
FT                   /locus_tag="Metev_0569"
FT   CDS_pept        566065..566250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0569"
FT                   /product="DNA-directed RNA polymerase subunit E, RpoE2"
FT                   /note="PFAM: DNA-directed RNA polymerase subunit E, RpoE2;
FT                   KEGG: mbu:Mbur_2281 DNA-directed RNA polymerase, subunit
FT                   E''"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73480"
FT                   /db_xref="GOA:D7E8D8"
FT                   /db_xref="InterPro:IPR007178"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="InterPro:IPR038589"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8D8"
FT                   /inference="protein motif:PFAM:PF04035"
FT                   /protein_id="ADI73480.1"
FT                   /translation="MSEQVCRECHRITLNQVCPVCGSSNLSTDWSGLVIIIDPKKSKIA
FT                   EKIGIEMPDKYALKVR"
FT   gene            566253..566834
FT                   /locus_tag="Metev_0570"
FT   CDS_pept        566253..566834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0570"
FT                   /product="Protein of unknown function DUF359"
FT                   /note="PFAM: Protein of unknown function DUF359; KEGG:
FT                   mbu:Mbur_2282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73481"
FT                   /db_xref="InterPro:IPR007164"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8D9"
FT                   /inference="protein motif:PFAM:PF04019"
FT                   /protein_id="ADI73481.1"
FT                   /translation="MGSQIILPEKFRPTLRKYFGELFLGTGNDTIKKMEQQLKNSTKLI
FT                   SVGDVTTFHLIESGIIPDVYLIDNRTNRKPTPDRVDKNHRFTQVTVDNPSGTITEDLVN
FT                   NIENAVLSDKNVRIFVNGEEDLAALPAILLAPINSIVLYGQPGEGVVLVEITESKKEEI
FT                   RDLMNNIIEFQNTNNSLNKLRRKLNGNKNK"
FT   gene            566815..567114
FT                   /locus_tag="Metev_0571"
FT   CDS_pept        566815..567114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0571"
FT                   /product="Ribosomal protein S24e"
FT                   /note="PFAM: Ribosomal protein S24e; KEGG: mma:MM_0599 30S
FT                   ribosomal protein S24e"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73482"
FT                   /db_xref="GOA:D7E8E0"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018098"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8E0"
FT                   /inference="protein motif:PFAM:PF01282"
FT                   /protein_id="ADI73482.1"
FT                   /translation="MEIKINEDTHNPLLNRRKIDFTIKFDGATPSRNEIKNKLAAMMDI
FT                   SSELIVVQDIDNQYGKKEARGYAKIYDDANTLKSVECDYIIERNKPPEETESEA"
FT   gene            567126..567278
FT                   /locus_tag="Metev_0572"
FT   CDS_pept        567126..567278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0572"
FT                   /product="Ribosomal protein S27a"
FT                   /note="PFAM: Ribosomal protein S27a; KEGG: mbu:Mbur_2284
FT                   30S ribosomal protein S27ae"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73483"
FT                   /db_xref="GOA:D7E8E1"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR022845"
FT                   /db_xref="InterPro:IPR038582"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8E1"
FT                   /inference="protein motif:PFAM:PF01599"
FT                   /protein_id="ADI73483.1"
FT                   /translation="MANVYEYYKVDGDNIERTHQFCPRCGVGVFLAEHKDRLSCGKCGY
FT                   TEFKK"
FT   gene            complement(567332..567817)
FT                   /locus_tag="Metev_0573"
FT   CDS_pept        complement(567332..567817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_0129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73484"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8E2"
FT                   /inference="similar to AA sequence:KEGG:Mbur_0129"
FT                   /protein_id="ADI73484.1"
FT                   /translation="MTGIKSKNGLIDQIKKNYWIEADMEQLVIWETRIKLKGDEKESLD
FT                   TLAYESEEHKFLLEKWIEIMNLSIPETRPRGIPEENFDFSNLDSSQMFDVIQNYEIILR
FT                   DSYTDLRDIDEPLLKKLVPDESYIDDFRSDMDELVSEEQNHINICQSHIGGFKSIYG"
FT   gene            567904..568203
FT                   /locus_tag="Metev_0574"
FT   CDS_pept        567904..568203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0574"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: mac:MA3429 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73485"
FT                   /db_xref="GOA:D7E8E3"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8E3"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ADI73485.1"
FT                   /translation="MKNYWLWGESVLSEIPIDLERIKQGDVNKETLRAAIIAELDAVNL
FT                   YEEMANLTENEDLKTILLDIAKEEKVHVAMFQSVLIEADDEFLKIMADYSLGKY"
FT   gene            complement(568245..568448)
FT                   /locus_tag="Metev_0575"
FT   CDS_pept        complement(568245..568448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0575"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpl:Mpal_2779 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73486"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8E4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73486.1"
FT                   /translation="MKENPDDEFRICPNCGYKKGFHLCFKKTENSRFRIGLICPSCGQS
FT                   YNIDWITSDIPELDVKWEDNYG"
FT   gene            complement(568483..569313)
FT                   /locus_tag="Metev_0576"
FT   CDS_pept        complement(568483..569313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0576"
FT                   /product="protein of unknown function DUF114"
FT                   /note="PFAM: protein of unknown function DUF114; KEGG:
FT                   mac:MA2409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73487"
FT                   /db_xref="GOA:D7E8E5"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8E5"
FT                   /inference="protein motif:PFAM:PF01972"
FT                   /protein_id="ADI73487.1"
FT                   /translation="MVFEDVGTWDILTVLAIVFVLYALVYPQYQMKKVKTQRLSMIKKM
FT                   EQEWGTKVLTLIHRKEAVSMFGLPVYQYIDIEDAESILRGIRNTANNRPIDIIAHTPGG
FT                   QVHPSIQIARALKNHNGHTRVMIPHYSMSGGTIIALAADEIIMDDDAVIGPIDPQLGDL
FT                   IRGTYPAPSWINAVSQKGANAADTTIVLSDISEKTMKLMRKVANELLEGKIEDEEKRNY
FT                   VVEKLVSGEMVHITPISASEAADIGLPVSTNLPDKVHEFMKFYRSVKSSVEYIE"
FT   gene            569433..571626
FT                   /pseudo
FT                   /locus_tag="Metev_0577"
FT   gene            complement(569678..571009)
FT                   /pseudo
FT                   /locus_tag="Metev_0578"
FT   gene            571686..572597
FT                   /locus_tag="Metev_0579"
FT   CDS_pept        571686..572597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0579"
FT                   /product="methanogenesis marker protein 11"
FT                   /note="KEGG: mbu:Mbur_0536 hypothetical protein; TIGRFAM:
FT                   methanogenesis marker protein 11; PFAM: domain of unknown
FT                   function DUF1743"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73488"
FT                   /db_xref="InterPro:IPR013696"
FT                   /db_xref="InterPro:IPR017674"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8E6"
FT                   /inference="protein motif:TFAM:TIGR03280"
FT                   /protein_id="ADI73488.1"
FT                   /translation="MRDIELEQPYTISYKGIYVVCDRNNRYAEIIEHPRCYGGASWARY
FT                   HYSNSPLILQVNTIGDMTRYYTKIGTSNLELKPSAFAAGIESVTVKNDKVEITYAGLGG
FT                   GGVGATKCRAYADGVISYDITESGGGRSAKGKIIVPRRERLIIGIDDTDTKEKGATWTL
FT                   THNIADALNCSESVYLSHSIVQLYPVSSKTQNCVSTVLEFGCVDENAKNKILQEIKSAL
FT                   LKYSVSDKTGMVAFSGFDAVDIYNYSKMCRSGEVSKDFAMQYAREHGVEIWLDGEGVIG
FT                   ALAALPWFAKPDESIKLDTGLQ"
FT   gene            572594..574150
FT                   /locus_tag="Metev_0580"
FT   CDS_pept        572594..574150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0580"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.8"
FT                   /note="KEGG: mbu:Mbur_0537 thiamine pyrophosphate
FT                   enzyme-like TPP-binding; PFAM: thiamine pyrophosphate
FT                   protein domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73489"
FT                   /db_xref="GOA:D7E8E7"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8E7"
FT                   /inference="protein motif:PRIAM:1.2.7.8"
FT                   /protein_id="ADI73489.1"
FT                   /translation="MTTDNSYNNTNTVFTGLDALFSAVVDSGVKTINGVAGFPVTEIMQ
FT                   KFLDNQNGRYNARWVTNEKTGLEIVLGSSISGHRSLMITKHVGMNVLSDPLITSTTHSI
FT                   GSGVVIITGDDPEALASQNEQDSRWYGIIAEVPVYDPSTPENAYLSIRKAFETSEKIKA
FT                   PAIVRITDRLNKSKGSKEFIKNKRQFQPEPRQSVFDRSIWELTMHGRHQKYHLEKFPVL
FT                   TKETENTDLNTSTINDSDVGIISSGTPSNLVYKILDKTGFNKFSHFSLNMVYPLPKKKL
FT                   NEFIKNHDRVLVIEESEPFIENQINIFGNVYGKTTGHVPYGKINAEHIELALDYINKDS
FT                   LEEYTRIQTLENRGYRGFCEGCFYIPLYQILRKLDVKVAADMGCSILGAPEPMKAVDGD
FT                   FALGSAIGTACGFNNKGIAVIGDFGLAHSGLMSLINAVYGGFDVLVIVLQNEVAAMTGG
FT                   QDTPELTDVVKSIVDDVSIYNINDKAEEDIKKSMSKLINDKLNNSGVSVILAKGKCVKY
FT                   Q"
FT   gene            complement(574167..574322)
FT                   /locus_tag="Metev_0581"
FT   CDS_pept        complement(574167..574322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM_0709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73490"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8E8"
FT                   /inference="similar to AA sequence:KEGG:MM_0709"
FT                   /protein_id="ADI73490.1"
FT                   /translation="MYRKHNQKLCKLCRSPIERELIGSYMVYYCQNCGFTTYEQKIGSE
FT                   KTIKAK"
FT   gene            complement(574340..574477)
FT                   /locus_tag="Metev_0582"
FT   CDS_pept        complement(574340..574477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73491"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8E9"
FT                   /inference="similar to AA sequence:KEGG:Mbur_1321"
FT                   /protein_id="ADI73491.1"
FT                   /translation="MKSLEICPVCKSQLINREYKIQICNVCGYWTIKGTARLDPAMIFT
FT                   "
FT   gene            complement(574707..575381)
FT                   /locus_tag="Metev_0583"
FT   CDS_pept        complement(574707..575381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0583"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="KEGG: mba:Mbar_A0713 hypothetical protein; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73492"
FT                   /db_xref="GOA:D7E8F0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8F0"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ADI73492.1"
FT                   /translation="MFKRGKVKGIIFDCYKTLIDIETDEDSLETYDIVSKWLLYYGVQI
FT                   SPEKLKGEYKKKISKSFELSEQDYPEVKVEDIFSEICQENAIWDIDEEILGIETARLFR
FT                   AASIQNIGTYSESLELLEIFEDYPKCIVSNAQRVFSELELKYLGLYKYFDFVIFSSDFG
FT                   YKKPDERLFKIAQKRLDINPEEILSIGDTTENDVEPPQKLGMRGVHIEEAWKLTTAFKH
FT                   LF"
FT   gene            complement(575360..576304)
FT                   /locus_tag="Metev_0584"
FT   CDS_pept        complement(575360..576304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0584"
FT                   /product="Mn2+dependent serine/threonine protein kinase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   mac:MA2344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73493"
FT                   /db_xref="GOA:D7E8F1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8F1"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADI73493.1"
FT                   /translation="MSREHFVNTITRGHKFRDWLIEVLDDRVQNKECAVNVYKFNISSH
FT                   TVCRYELVDEGFSVVAKFLGEPKGETREYNPCDVMENEFENLKKVNEIINTSKPIARNK
FT                   DFNCVIVIEYVSGKSLMWYMEHEKHLDSRLSEIAELLRKLHDNTKMNFYDKKKEFDDFQ
FT                   WNLDYLHLDAHTRNKFDELLGKWWNSPQVNEECSYLIHRDVTPLNYIFQNDKVYAIDFE
FT                   SSGYRNRIHDLGVLCAEIKNHFALKGSGQRAEPYIRHFLWEYSKDEEEFYKITVTLPFY
FT                   MAYGWLRIARLGWHPDYYNYLLKEAKSCLNAVK"
FT   gene            complement(576406..579048)
FT                   /locus_tag="Metev_0585"
FT   CDS_pept        complement(576406..579048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0585"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="TIGRFAM: ATP-dependent chaperone ClpB; PFAM: ATPase
FT                   AAA-2 domain protein; Clp domain protein; AAA ATPase
FT                   central domain protein; Clp ATPase-like; KEGG:
FT                   mbu:Mbur_2199 ATPase AAA-2; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73494"
FT                   /db_xref="GOA:D7E8F2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8F2"
FT                   /inference="protein motif:TFAM:TIGR03346"
FT                   /protein_id="ADI73494.1"
FT                   /translation="MNGENFTQKTYEALQNSTTIAARYRHQQIDCEHLLLALLEQKDGL
FT                   IPRILQKMDISPETIIKKVEKALSESPSVSGPGSEQVYMSQRLKRVLDTAGKEAEQMGD
FT                   EYVSVEHLLFGLLKESDSSSGKILSNAGVTREYLQQVLKEIRGDKKVTTENPEETYEAL
FT                   EKYGIDFTELAKQGKLDPVIGRDREIRHTVKILSRRRKNNPVLIGEAGVGKTAIVEGLA
FT                   QRVANGDVPEDMANKRIIALDMGALIAGAKYRGEFEDRLKSVLKEVSESEGQIILFIDE
FT                   LHTVVGAGAAEGSMDASNLLKPMLARGELHCIGATTLDEYRKNIEKDAALERRFMPVMV
FT                   GEPDVEDTISILRGLKERYEVHHGVRIKDSALVEAAVLSDRYISERFLPDKAIDLVDEA
FT                   AANVRTQIDSKPTQLDEVDRKITQLEIEREALKKETDPASKERLESLEKELSNIREQSK
FT                   TLREQWQKEKEIISELRSFKEQIEDTKTQLERAENDNDFELASRLKYGTLIPLQRQYEE
FT                   KEEELHQMQDEMLLREEVDEEDIAEVVSEWTSIPVTKLMEGEREKLTHLEDRLHNRVVG
FT                   QDEAVKAVSDAVVRAHAGIKDPDKPIGSFIFLGPTGVGKTELAKALAADLFDNENNMVR
FT                   LDMSEYMEKHTVSRMIGAPPGYVGYEEGGQLTEAIRRRPYSVILFDEIEKAHHDVFNIM
FT                   LQILDDGRLTDAQGRTVDFKNTIIIMTSNIFVDYVHEQLENGADYSKMKSMAQNELSKH
FT                   FRPEFLNRIDEVAIFRPLTKEQLVEIVDIKVQDLAERLIHQRLKLEITDKAKQYLAEEG
FT                   YSETYGARPLQRVIQNEVETEVAKSIISGYVPERSTVKVDSDENGIVINIEKTQSTEEK
FT                   ESEESTGQQ"
FT   gene            579255..579623
FT                   /locus_tag="Metev_0586"
FT   CDS_pept        579255..579623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0586"
FT                   /product="membrane-bound metal-dependent hydrolase"
FT                   /note="PFAM: membrane-bound metal-dependent hydrolase;
FT                   KEGG: mac:MA2196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73495"
FT                   /db_xref="GOA:D7E8F3"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8F3"
FT                   /inference="protein motif:PFAM:PF04307"
FT                   /protein_id="ADI73495.1"
FT                   /translation="MPRYKTHITAGAISGLIVLLILGKIHSITISPLLSIIAILFSVMG
FT                   STLPDKIEPAKNSKHRKFFHSKIILIATSYLLYEIFNTGTTAYFNENILSLYTGFILAG
FT                   YLSHLILDATTPSGLPLF"
FT   gene            579698..580159
FT                   /pseudo
FT                   /locus_tag="Metev_0587"
FT   gene            complement(580163..581152)
FT                   /locus_tag="Metev_0588"
FT   CDS_pept        complement(580163..581152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:580379..580381,aa:Pyl)
FT                   /locus_tag="Metev_0588"
FT                   /product="methanogenesis marker protein 12"
FT                   /note="KEGG: mbu:Mbur_0210 hypothetical protein; manually
FT                   curated; TIGRFAM: methanogenesis marker protein 12"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73496"
FT                   /db_xref="InterPro:IPR016735"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8F4"
FT                   /inference="protein motif:TFAM:TIGR03281"
FT                   /protein_id="ADI73496.1"
FT                   /translation="MFIGIDHGTNAIRFASITEDEDTDSYRFELPRDNAASMNESDIID
FT                   YIMDSFDVSKENVELMAVTYSMGDDINSIENIKNVDSRGVRSIEGAGKKTGGGAKIFDA
FT                   IKNSDIPAVVIPGIHTGSNTDQRMNIFSHSTSPEKVGIAYHARCLNHDDDFIVSDISSN
FT                   TVTLGVSNKKIAGAIDACIFAPGLQHGPMDLQAIRDVDSGLYSANEAFMNAGVLKRTLY
FT                   TDLQTLLDAVDKNNPEAVLALDTISLFAAMEIKSIOVLLSDLKPELEGNIYLAGSVGEV
FT                   EYVVDKIHYHLGIKPYVLGRWSAAIGCAEIARDIVSGATEILGLDVNY"
FT   gene            complement(581167..581526)
FT                   /locus_tag="Metev_0589"
FT   CDS_pept        complement(581167..581526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0589"
FT                   /product="Protein of unknown function DUF2103,
FT                   metal-binding protein"
FT                   /note="PFAM: Protein of unknown function DUF2103,
FT                   metal-binding; KEGG: mba:Mbar_A0209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73497"
FT                   /db_xref="InterPro:IPR018664"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8F5"
FT                   /inference="protein motif:PFAM:PF09876"
FT                   /protein_id="ADI73497.1"
FT                   /translation="MRDEQKKNVTSADESPYDKLGGSHSTIIGGRQGRRIIHIIGSHPE
FT                   VKKIIPAVIQVKAKKGVPGGAFSAKALRCDKRGNLRLVVSQGTSTQELRIITTVGDTVE
FT                   GKRVMDELNEMLQDK"
FT   gene            complement(581548..581991)
FT                   /locus_tag="Metev_0590"
FT   CDS_pept        complement(581548..581991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0590"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   mbu:Mbur_0208 amino acid-binding (ACT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73498"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8F6"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /protein_id="ADI73498.1"
FT                   /translation="MDTEDNILKQISIFAENKPGRLADIADKLKNADVNIRAFNIAEAG
FT                   EFGIIRMVVDNPDKAYESLHNTGFTVSETNVLGIEMEDVPGSLSNIANSLGKRGINIDY
FT                   SYAFVTKTEKALLIVRVDDIKGAISVLDDASFKLVDMEEIKHL"
FT   gene            complement(582036..583337)
FT                   /locus_tag="Metev_0591"
FT   CDS_pept        complement(582036..583337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0591"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: mbu:Mbur_0207 phenylacetate-CoA ligase; PFAM:
FT                   AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73499"
FT                   /db_xref="GOA:D7E8F7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8F7"
FT                   /inference="protein motif:PRIAM:6.2.1.30"
FT                   /protein_id="ADI73499.1"
FT                   /translation="MEYWDPHIERMPIDELRQLQEHKLKQLLNYVYNHSPFYKKRLDDA
FT                   GIKPEDINSLEDVKKIPFTYKQDLRDNYPTGMFCVPNTQLVRFHASSGTSGKPTVVGYT
FT                   RNDINGWANSLARALTSIGIGRGDNMQVSYGYGLFTGGLGLHYGAEEVSASVLPTSAGN
FT                   TGRQIELMQDLGTSVIACTPSYMLYMNEAAKKMNINIKKDTDLKIGILGAEPWSEEMRK
FT                   RIEDTTGIKAYDIFGTSELSGPLFTECKYQDGIHIWADQFLVEIIDPDTGKALPDGERG
FT                   ELVITTLSKEALPLIRYRVGDLTALNSEPCECGRTHPRITRITGRVDDMLVVRGVNVFP
FT                   GQIEAVLMNIPEVGEHFQIIVDRVNEMDMMNVQIEMTDTAFSDKVNDIISLEKKVESAL
FT                   KSVLNVSVKVELVEQGSLPRTVGKSKKVIDNRNL"
FT   gene            complement(583401..584369)
FT                   /locus_tag="Metev_0592"
FT   CDS_pept        complement(583401..584369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0592"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: mac:MA3851 phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73500"
FT                   /db_xref="GOA:D7E8F8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8F8"
FT                   /inference="protein motif:PFAM:PF01368"
FT                   /protein_id="ADI73500.1"
FT                   /translation="MQVDETEFYSRLLDYHNILFLCHRNADPDAVSSAFALSEAVGGTV
FT                   GLVEGCNRLAALLVDRLNIEVVDEPDPQSYEFVVVVDTSTSSQLNDIELPNYCVIDHHS
FT                   TTALTEKADFYLHTRATSTAEIVFKVLKSMGAPITRRTAIGLISGIITDTGHFKHANSS
FT                   TFRNLAEIIEASGVEYAEVLEMMAAAPQDISLRIAMLKSAQRLEIDRVNEWLVVTSNVS
FT                   SFGGAASSMLINIGADVAFVATTCDGSIRVSARARRDAVNSGVNLGKIMEDISENYCGT
FT                   GGGHPGAAGIDVVTDVNQILSECKMRVLETLKKETVKNENH"
FT   gene            complement(584450..584818)
FT                   /locus_tag="Metev_0593"
FT   CDS_pept        complement(584450..584818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0593"
FT                   /product="prefoldin, beta subunit"
FT                   /note="KEGG: mbu:Mbur_0205 prefoldin, beta subunit;
FT                   TIGRFAM: prefoldin, beta subunit; PFAM: Prefoldin beta-
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73501"
FT                   /db_xref="GOA:D7E8F9"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR012713"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8F9"
FT                   /inference="protein motif:TFAM:TIGR02338"
FT                   /protein_id="ADI73501.1"
FT                   /translation="MSQELPPQAQNQMSQLQQLQQQAQSLAVQKNQVESSQKETEKALE
FT                   ELNKLPEDATVYRMVGNVQVKTTRDDAIEKLEEQKENLSLRLQSINRQEERISKRFKQL
FT                   QEQLQQSMGKQQQGGQAQ"
FT   gene            complement(584892..585167)
FT                   /locus_tag="Metev_0594"
FT   CDS_pept        complement(584892..585167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0594"
FT                   /product="Protein of unknown function DUF2144"
FT                   /note="PFAM: Protein of unknown function DUF2144; KEGG:
FT                   mbu:Mbur_0204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73502"
FT                   /db_xref="InterPro:IPR015419"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8G0"
FT                   /inference="protein motif:PFAM:PF09915"
FT                   /protein_id="ADI73502.1"
FT                   /translation="MMVFDMRVTAESIFEIDDAENIYRAVLPESESNDFERSVVDISVT
FT                   DTGLLLNITANDSVSMRSALNTWLRLVQIAYEIGEVSQPFFNEEYR"
FT   gene            complement(585154..585627)
FT                   /locus_tag="Metev_0595"
FT   CDS_pept        complement(585154..585627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0595"
FT                   /product="Brix domain protein"
FT                   /note="PFAM: Brix domain protein; KEGG: mbu:Mbur_0203 Imp4
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73503"
FT                   /db_xref="GOA:D7E8G1"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="InterPro:IPR023548"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8G1"
FT                   /inference="protein motif:PFAM:PF04427"
FT                   /protein_id="ADI73503.1"
FT                   /translation="MILSTSRKPSSRTRTLCKHLSRFLNCDYVNRGKSSFEDIFGIYPC
FT                   VPVLLIGESHGNPGSFDIFDQFGNYKLSVYMNVDYPQNFKSVNRKKEVPAVSGDNNIAK
FT                   TIAKTLSFEYIENSGQCNTRCISVDKDSIDFMDSGELIFSFRIKSYRVLNDGV"
FT   gene            complement(585697..585834)
FT                   /locus_tag="Metev_0596"
FT   CDS_pept        complement(585697..585834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0596"
FT                   /product="RNA polymerase Rbp10"
FT                   /note="KEGG: mma:MM_2626 DNA-directed RNA polymerase
FT                   subunit P; manually curated; SMART: RNA polymerase Rbp10"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73504"
FT                   /db_xref="GOA:D7E8G2"
FT                   /db_xref="InterPro:IPR006591"
FT                   /db_xref="InterPro:IPR023464"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8G2"
FT                   /inference="protein motif:SMART:SM00659"
FT                   /protein_id="ADI73504.1"
FT                   /translation="MGYKCTRCKKVVEIDYHYTGIRCPYCGHRILVKERPTTIKRIKAE
FT                   "
FT   gene            complement(585840..586130)
FT                   /locus_tag="Metev_0597"
FT   CDS_pept        complement(585840..586130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0597"
FT                   /product="ribosomal protein L37a"
FT                   /note="KEGG: mbu:Mbur_0201 50S ribosomal protein L37Ae;
FT                   TIGRFAM: ribosomal protein L37a; PFAM: Ribosomal L37ae
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73505"
FT                   /db_xref="GOA:D7E8G3"
FT                   /db_xref="InterPro:IPR002674"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8G3"
FT                   /inference="protein motif:TFAM:TIGR00280"
FT                   /protein_id="ADI73505.1"
FT                   /translation="MAKGYRTKGRVTRSAGRFGTRYGRKDRKLIANIEEQMHKKHRCSN
FT                   CARVSVRRTGTGIWECTKCGHTFAGGTYTPQTSVGKTVPRAIRKAIEEEVE"
FT   gene            complement(586186..586968)
FT                   /locus_tag="Metev_0598"
FT   CDS_pept        complement(586186..586968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0598"
FT                   /product="3' exoribonuclease"
FT                   /note="PFAM: 3' exoribonuclease; Exoribonuclease,
FT                   phosphorolytic domain 2; KEGG: mbu:Mbur_0200 exosome
FT                   complex RNA-binding protein Rrp42"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73506"
FT                   /db_xref="GOA:D7E8G4"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020869"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8G4"
FT                   /inference="protein motif:PFAM:PF01138"
FT                   /protein_id="ADI73506.1"
FT                   /translation="MTSEVMSKLKKDYVYHLMLKEKREDNRAFDEIRDISIETDIIGNA
FT                   EGSAKVYWGDTQLIVGVKLQVGEPFPDTPDKGIIITSLELNPIASPDFEAGPPKEDAIE
FT                   IARVVDRGIRESGAIDLNKLCITEGEEVWTVFIDVNVLNDDGNIMDAASIGAIAALMTT
FT                   NIPAESEGYGEDMMMPVRDIPVGISLVDISGELMVDPTYNEESVCDTKITVVSNQDGSI
FT                   SAMQKSGTGSLTEEKVLQAANIARTRASEIREKYLSNI"
FT   gene            complement(586958..587959)
FT                   /locus_tag="Metev_0599"
FT   CDS_pept        complement(586958..587959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0599"
FT                   /product="exosome complex exonuclease 1"
FT                   /note="KEGG: mbu:Mbur_0199 exosome complex exonuclease
FT                   Rrp41; TIGRFAM: exosome complex exonuclease 1; PFAM: 3'
FT                   exoribonuclease; Exoribonuclease, phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73507"
FT                   /db_xref="GOA:D7E8G5"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR011807"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8G5"
FT                   /inference="protein motif:TFAM:TIGR02065"
FT                   /protein_id="ADI73507.1"
FT                   /translation="MNNEPTKFIDENGLRVDGRRTDEIRPMKVDIGVLSRADGSCYLEW
FT                   GNNKIISAVYGPRELHPRRMQRPDAAVIRYKYNMASFSVEDRQRPGPSRRSSEISKVSS
FT                   EAFEPVVMTQFYPNTVIDVFSEVLEADAGTRTAAINAATLALIDAGIPLKSLVSACAVG
FT                   KVDGQLVLDLNKKEDNEGEADLPVAITQDGEITLLQMDGHLTEDEIKQAMELVKNGCQQ
FT                   IQQIQREALLKKFGQYEGADTEIQSVPLTETSSKQETESVDTESSELISSNILSDESSE
FT                   NQEESGEEQEPDTLDILEDETEQSEDNEDDSDEEDFFVEIVRNNTEGESDDQ"
FT   gene            complement(588077..588873)
FT                   /pseudo
FT                   /locus_tag="Metev_0600"
FT   gene            complement(588887..589579)
FT                   /locus_tag="Metev_0601"
FT   CDS_pept        complement(588887..589579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0601"
FT                   /product="Ribosome maturation protein SBDS-like protein"
FT                   /note="PFAM: Ribosome maturation protein SBDS-like; KEGG:
FT                   mbu:Mbur_0197 putative RNA-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73508"
FT                   /db_xref="GOA:D7E8G6"
FT                   /db_xref="InterPro:IPR002140"
FT                   /db_xref="InterPro:IPR018978"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036786"
FT                   /db_xref="InterPro:IPR037188"
FT                   /db_xref="InterPro:IPR039100"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8G6"
FT                   /inference="protein motif:PFAM:PF01172"
FT                   /protein_id="ADI73508.1"
FT                   /translation="MISLDDSVIARYKKGGKQFEVFVDPDGALDIKRGEDINIEDIIAV
FT                   ESVFEDANKGNLASESDIQEIFGTDEVYEIIYNIIKHGDIQLTKEQRKRMLDEKRKQVV
FT                   NIIAQNAINPQTKTPHPPSRIESAMEEAKVNIDLLKSVDEQVNTALKAIRPIIPIRFEE
FT                   VQVAVKIPASYAAKSYGEISRFGTVEKEEWQNDGSWVAVVRIPAGLQNDFYSLINRLTK
FT                   GEAESKLL"
FT   gene            complement(589622..590389)
FT                   /locus_tag="Metev_0602"
FT   CDS_pept        complement(589622..590389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0602"
FT                   /product="proteasome endopeptidase complex, alpha subunit"
FT                   /EC_number="3.4.25.1"
FT                   /note="TIGRFAM: proteasome endopeptidase complex, alpha
FT                   subunit; KEGG: mac:MA1779 proteasome subunit alpha; PFAM:
FT                   20S proteasome A and B subunits; Proteasome alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73509"
FT                   /db_xref="GOA:D7E8G7"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR019982"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8G7"
FT                   /inference="protein motif:TFAM:TIGR03633"
FT                   /protein_id="ADI73509.1"
FT                   /translation="MQMSAPQMGYDRAITVFSPDGRLFQVEYAREAVKRGTTAAGIKAK
FT                   DGVVLLVDKRITSRLIEAESIEKIFQIDAHIGVATSGLVADARTLVDRARVEAQVNRVS
FT                   FDEPIGVEVIAKKICDHKQTYTQFGGVRPYGTAVLIAGIDDNKPRLFETDPSGALLEYR
FT                   ATAIGAGRNSFMETFEANYSDDMDIDSAIMLGMDALYNVTEGKLDASTLEVGIITTDTK
FT                   QFRKFSNEEVENYVNKELEKHKGEEPEESSGEE"
FT   gene            complement(590435..590818)
FT                   /locus_tag="Metev_0603"
FT   CDS_pept        complement(590435..590818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0603"
FT                   /product="Ribonuclease P-related protein"
FT                   /note="PFAM: Ribonuclease P-related; KEGG: mbu:Mbur_0195
FT                   ribonuclease P-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73510"
FT                   /db_xref="GOA:D7E8G8"
FT                   /db_xref="InterPro:IPR002759"
FT                   /db_xref="InterPro:IPR016434"
FT                   /db_xref="InterPro:IPR038085"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8G8"
FT                   /inference="protein motif:PFAM:PF01900"
FT                   /protein_id="ADI73510.1"
FT                   /translation="MKILPPTLRNRKRYLAFELISEKEVSRDDLIKEVFSCASSLIGDL
FT                   GSSECNIRLLSFENSKGIIRCNHNTTDKTRAVLATVSNISGTQAVIHILGISGTVKGAT
FT                   KKYLEEFEVFNPKEQSYLKEYKS"
FT   gene            complement(590821..591546)
FT                   /locus_tag="Metev_0604"
FT   CDS_pept        complement(590821..591546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0604"
FT                   /product="Ribonuclease P"
FT                   /EC_number="3.1.26.5"
FT                   /note="KEGG: mbu:Mbur_0194 ribonuclease P protein component
FT                   3; PFAM: RNase P subunit p30; PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73511"
FT                   /db_xref="GOA:D7E8G9"
FT                   /db_xref="InterPro:IPR002738"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023539"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8G9"
FT                   /inference="protein motif:PRIAM:3.1.26.5"
FT                   /protein_id="ADI73511.1"
FT                   /translation="MGNTRFYDFNVHTVPDGKDTVKDVMAFAKHLGFGGFAITNHSNVE
FT                   ESYPEGSMQDGIDVYKAVEIVVSNPSKLNGLVGKYRKNVDVVAVHGGNEEINRAAVETP
FT                   AVDILAHPQTSKNGGINHVLAKSASHNNVAIEFNLDSIIKGRGGKRVHTLSFFSKNLEL
FT                   ARKYNVPTILTSNAFNCFDLRAPEEMIALSKLFGMGREEAITSLSDIPESIITKNRNSG
FT                   IVQEGVEIVNEEIVSSDGE"
FT   gene            complement(591539..591985)
FT                   /locus_tag="Metev_0605"
FT   CDS_pept        complement(591539..591985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0605"
FT                   /product="Protein of unknown function DUF54"
FT                   /note="PFAM: Protein of unknown function DUF54; KEGG:
FT                   mbu:Mbur_0193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73512"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8H0"
FT                   /inference="protein motif:PFAM:PF01877"
FT                   /protein_id="ADI73512.1"
FT                   /translation="MIHYITLRATSHATEEKSRVKTSLDLFLLNSASNANTDEIVEVLD
FT                   VEGHYGNLISLCSAELTRKSECKRLVEFIKENLSSQDLATVYKEIPDRLDDEQVFHLRF
FT                   NKQEAYLGRLLLSTSSDAIIIKIKIATYPKNWEQAKKNVEDLFG"
FT   gene            complement(592005..592562)
FT                   /locus_tag="Metev_0606"
FT   CDS_pept        complement(592005..592562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0606"
FT                   /product="Ribosomal protein L15e"
FT                   /note="PFAM: Ribosomal protein L15e; KEGG: mbu:Mbur_0192
FT                   50S ribosomal protein L15e"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73513"
FT                   /db_xref="GOA:D7E8H1"
FT                   /db_xref="InterPro:IPR000439"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR020926"
FT                   /db_xref="InterPro:IPR024794"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8H1"
FT                   /inference="protein motif:PFAM:PF00827"
FT                   /protein_id="ADI73513.1"
FT                   /translation="MSKPFYNYIREAWRKPEETYVNNLRWQRLQEWRRQGSITKINRPT
FT                   RLDRARTLGYKAKQGIIVVRAKVRRGGMRKSRYNAGRRTKRMGKNKITTGKSIQRIAEE
FT                   RAYRKYPNMEVLNSYWVAEDGKSKWYEIILVDPNHPVIKSDKDLNWVCSNKQKGRAHRG
FT                   KTSASRKGRGIRKSGKGTEKTK"
FT   gene            592973..593878
FT                   /locus_tag="Metev_0607"
FT   CDS_pept        592973..593878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0607"
FT                   /product="conserved hypothetical protein"
FT                   /note="manually curated; KEGG: mbu:Mbur_0992 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73514"
FT                   /db_xref="GOA:D7E8H2"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8H2"
FT                   /inference="similar to AA sequence:KEGG:Mbur_0992"
FT                   /protein_id="ADI73514.1"
FT                   /translation="MTEEIGSILSRGFNTFTRNLNITVPFILNLVLSGIIFILGLTAFT
FT                   AMFVMPALPSGDLGPANVNVEQVMNIFSSVFIENLWIVIAGILILTLLITFVQSYFTAG
FT                   AIGMSKNATENGNTDIGKMFRYGRENVVNMFFLKILLGLITFAGIIFLIPGFLSVEDLD
FT                   LLISNPQMATGSAVLLFAGFLVWMLYIAAISIVLAFTEYALIVDKLDPVSSIEEGFNKF
FT                   MENKLDVFLLWLVILAISILMGIIGEFVGIIEITAIAWGFINLILSIIIIPVLETIWWT
FT                   RLYMDKTGKDIYKPEELINY"
FT   gene            complement(593883..594314)
FT                   /pseudo
FT                   /locus_tag="Metev_0608"
FT   gene            594420..595592
FT                   /locus_tag="Metev_0609"
FT   CDS_pept        594420..595592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0609"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mac:MA3794
FT                   integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73515"
FT                   /db_xref="GOA:D7E8H3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR036443"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8H3"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADI73515.1"
FT                   /translation="MVFVDYDKQLEQTEQLIKDADYPEENKQILFDYENHMFMNGLKKS
FT                   TIRNHLYGMHYISGIINKPFPQVQKRDIESYIGYLERNIDSESSKSTKKTQLKKFFKWY
FT                   HGSETELTSWIKTNKKSNRKLPDQLITTEEVKQMIEAADYVRDKALIAVLYDTGARVSE
FT                   IGNLKIKDLNFDQYGGVIKVDGKTGMRRIRIIFSVPYINMWLNTHPLRDNQDSYLWVTL
FT                   SRRAKCSQLRYHSINDNLKIIAKRAGINKKIYNHLFRHSRATELANHLTQAQMEEHLGW
FT                   IHGSNMPQTYIHMSGKEVDDAILKMHGFKKDEETQPELTARQCPRCDEMNGPTSKFCSR
FT                   CGAALDTQIAMELDEKKSSIMQRFMDMVQNDPELLSMIQQNAVEDEDKNK"
FT   gene            596046..596648
FT                   /locus_tag="Metev_0610"
FT   CDS_pept        596046..596648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0610"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pyo:PY06814 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73516"
FT                   /db_xref="GOA:D7E8H4"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8H4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73516.1"
FT                   /translation="MRISKQQKFNIRLVVGILVAITFVSLVLLFADLNIIESMFFVAAV
FT                   AGIITMVLNDARKLTDREKNLIASKLEPYNKLKHANVQTVTYPEDLLKKTNPPYTSYFI
FT                   CKNCKKPIGINIYGHKRYINFIQNKMTNILLVLTFFVYMVFTPLIPHYINSAVFFVLVM
FT                   TFITINASNRYAHRFYDNRSLNSVFDNRPLRWFYEHV"
FT   sig_peptide     596046..596141
FT                   /locus_tag="Metev_0610"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.930 at
FT                   residue 32"
FT   gene            596635..598464
FT                   /locus_tag="Metev_0611"
FT   CDS_pept        596635..598464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0611"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpe:MYPE6470 DNA topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73517"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8H5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73517.1"
FT                   /translation="MNMSKNTFLRTIILISAALVLLAGSASATNESITISSPSNGTTFE
FT                   HGETVTVYAQTTDPDMTKPMLQTSNNLGTWDPMDQIDNNLFVKTWNTSSLENKNESYII
FT                   SVKSSLSEQEYFDSIDIEIEESDITHESGSDTKNLTVDGLKDGNTYNINGSIWVQVVDE
FT                   DTTNPVSNPNIKIQNPSILNTYEGTESGLVKLDWMNLDGEQLDPGKYMVSITAEGYNKE
FT                   EYLVNLEEPEEEEPEEPELDVMGLDNRVLVNSKTDIWVMDSETGEPVEDATIKMVDKES
FT                   NTVIRSEKTTDYGEVYWHWDIAGYFTVVVSKPGYDKETTSVRVVHESDIGTHPDFDDSE
FT                   STSSDDSSGSDNGNDGSDTDTQDKDEDLTLREVQQYLDENHKINGESYQIMSPNEVERI
FT                   EKRSYQRGYQNGTAAAKEEEGPIAGLILSNPAIAVLIAVALGGLSFAGGAKVGNVRDLN
FT                   LNPSSLIPDRNPHDEDEDDLIMNNEDVPDIQIPYTSKPEQSSTDDNNEEDQSTGKEQEE
FT                   TQQHSSDTDEKTEERLMELLTPKQKKELLKSIESEDQSNQEVSDSGPDIPEEPSPEELA
FT                   GEQKQKSKPKPVQPFDTSEYDELAEKMQNKGGW"
FT   sig_peptide     596635..596721
FT                   /locus_tag="Metev_0611"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.906 at
FT                   residue 29"
FT   gene            598468..598788
FT                   /locus_tag="Metev_0612"
FT   CDS_pept        598468..598788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0612"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afv:AFLA_039990 liver carboxylesterase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73518"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8H6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73518.1"
FT                   /translation="MSETLHPTTFRLPQSFLDHCDRIADALNKSNLGDRQYCRNDIAYM
FT                   IFNHHIKKVYGNPISNEIFEMIFNNLDDPDIIDAHTVRGIAKKISDKDVDQDFFEKIAG
FT                   CL"
FT   gene            598788..599579
FT                   /locus_tag="Metev_0613"
FT   CDS_pept        598788..599579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0613"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0003548 urease subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73519"
FT                   /db_xref="GOA:D7E8H7"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8H7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73519.1"
FT                   /translation="MKMPNPSVTMFVVLFFLAAAFGTPESSKHLVEGLNVISNGVLEIP
FT                   PTIEVPVIGQYLLLIIGFVTLVNGLDLHFKENYSPKILGSGFEHPYAYNGDYMVHSGFC
FT                   MAGAEGCASPVPRPGTHIIIAPGTHVHRIAGNHLIVTANVMENTPLDETPVELKQKLRS
FT                   MKGMVFGPKSSAIGFLSTRELEKYKKFEVTNPNTNKKEYVNVNTFIQEELMGFNKSYDV
FT                   IFQVANNETKGVSKFLGMITSIGKESARNRNDGFLKRHLLR"
FT   sig_peptide     598788..598856
FT                   /locus_tag="Metev_0613"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.582 at
FT                   residue 23"
FT   gene            599584..600411
FT                   /locus_tag="Metev_0614"
FT   CDS_pept        599584..600411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0614"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cff:CFF8240_0077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73520"
FT                   /db_xref="GOA:D7E8H8"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8H8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73520.1"
FT                   /translation="MKLSKKLIFFLIFLAVIVVAIFWLDMLGSEPVPVMVVAFGTYAFM
FT                   FILKLNADGYFSYYSEKVAFLDEDPKEKKDNAKSYKPLNNPIPRYYQIHKEPADHPKVK
FT                   HWVWTYNGYNRGFQTKPGNKLFFGPKSMVHMAGNTLIFLGRKRRISHKAFFEYIGRDKQ
FT                   IFDQAVLGQYMKIYVPEPLKSEEYDNMKSVINGHDFKDDKFNEVIYWLVDMIPLKNKSL
FT                   DNLKKAINSKIEFSEDVTGGMKRTAFNIDTTLGYKRTEFKRSENYDDDNKEDI"
FT   gene            600411..601376
FT                   /locus_tag="Metev_0615"
FT   CDS_pept        600411..601376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0615"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpi:Rpic_1399 zonular occludens toxin"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73521"
FT                   /db_xref="InterPro:IPR008900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8H9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73521.1"
FT                   /translation="MHFTGTQQKKTPSPRQKGKNWYRKWLFQLHKEHLIRYLDERWEPE
FT                   EHSTIISDFYEDPYLGYLVITDYLSNLEDPTKNFWKMINVIRKPGQDVILISGSKGSGK
FT                   TYEGWRLLHALRKEYKVYWVGPPINLPEWAGYVATLDHLPQNAVGLVDESAIFMNSRRS
FT                   MSKDNVESTELLAVARHQGRKVIFITQNTSRSDNSLTIWADVHIIKPYTSLYGKQTERE
FT                   IVFDKRDQYFEPKNREWSYVKSTDLKYCTYKGYELDFYDEKIGTPFSVFENEDMAMQYA
FT                   EAMAEQGYGAKSIQKVMRMKGMDKGQDFWQDIIDQINPGQ"
FT   gene            complement(601360..601824)
FT                   /locus_tag="Metev_0616"
FT   CDS_pept        complement(601360..601824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0616"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00571970 Leucine Rich Repeat family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73522"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8I0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73522.1"
FT                   /translation="MAYHIHNALKYRILGEVIKIEEERKKDPFADKADLNTLHKRLDVS
FT                   KNSLVKTLNKMANYGYLIRKKYITPRNNCKNYYVLGEVGKKVFPKLHEKMKNGESLNLR
FT                   NPKEEKISSYIRTSEEYIKKRIQILEDKKKEIDDQIEKLNQEKALITVQD"
FT   gene            complement(601923..602789)
FT                   /locus_tag="Metev_0617"
FT   CDS_pept        complement(601923..602789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0617"
FT                   /product="Protein of unknown function DUF1628"
FT                   /note="PFAM: Protein of unknown function DUF1628; KEGG:
FT                   mbu:Mbur_1976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73523"
FT                   /db_xref="GOA:D7E8I1"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8I1"
FT                   /inference="protein motif:PFAM:PF07790"
FT                   /protein_id="ADI73523.1"
FT                   /translation="MRSLSDLVSDDEAVSSIIGEILMTGIAVLIFAIIAVSVFSMLDPV
FT                   EEPHIDVDGWPNNYTDKIHIRHEGGEKLSTEDLKLIVEVNDTRKSYTGNEIKDDFHNKD
FT                   TWQIADTISVDISEEFGQEVTYDKDIEFTLIHTKSSTVIENGVLTSSKVGTGDGSGDGD
FT                   DGGDGNGNGNGNGDGTVNASERVKYVDDSVNKNGANFNFSFSVNEGEVTIDNIELYLVN
FT                   EDGPVGYNNIKINEREFTNENINVPEGINHFLIISDEIAKGGPGKEDISVKFIFGDGSE
FT                   KLFDEWQ"
FT   gene            complement(602834..603130)
FT                   /locus_tag="Metev_0618"
FT   CDS_pept        complement(602834..603130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0618"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yen:YE4102 putative cellobiose-specific
FT                   phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73524"
FT                   /db_xref="GOA:D7E8I2"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8I2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73524.1"
FT                   /translation="MISRYRLPLIIISVLGFSHFVMMLLNKEVILSGLGWFGLPLWTLF
FT                   QTISSIWFVLIPAAVMLMFYDRTMTIQYMVPLLILIIIMLKAAEVAFTGLPDV"
FT   gene            complement(603132..603749)
FT                   /locus_tag="Metev_0619"
FT   CDS_pept        complement(603132..603749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0619"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lel:LELG_02662 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73525"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8I3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73525.1"
FT                   /translation="MDNRLKQTLAMLLIISFAASPISVADQESISAGFFGGVEDFVGGV
FT                   AERAENMFGEAVNNSSPQGDPQFNRSTDRDKDRVNRSESELDEDGETLEEVEDRVGNRE
FT                   NIDKISDFMDEHDVKAASIRVVDTDEKFYLVKNQGFVESHNGEVDVKAQVTTDDIEFVL
FT                   ERTEDGELGFRERVEVSNRLKDRIINRDTGMESLKFSIFGGI"
FT   sig_peptide     complement(603672..603749)
FT                   /locus_tag="Metev_0619"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.956 at
FT                   residue 26"
FT   gene            complement(603755..603940)
FT                   /locus_tag="Metev_0620"
FT   CDS_pept        complement(603755..603940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0620"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mno:Mnod_1742 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73526"
FT                   /db_xref="GOA:D7E8I4"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8I4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73526.1"
FT                   /translation="MSLIPAGTGVQKVVFAMIATWVAGGFLQEGLRSFGVYNMWNPYWN
FT                   LMIAVGILLLLVRYVR"
FT   gene            complement(603937..605250)
FT                   /locus_tag="Metev_0621"
FT   CDS_pept        complement(603937..605250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0621"
FT                   /product="PEGA domain protein"
FT                   /note="KEGG: tva:TVAG_189160 chitinase; PFAM: PEGA domain
FT                   protein; PKD domain containing protein; SMART: PKD domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73527"
FT                   /db_xref="GOA:D7E8I5"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR026371"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8I5"
FT                   /inference="protein motif:PFAM:PF08308"
FT                   /protein_id="ADI73527.1"
FT                   /translation="MKLGSKFKKWTAIMLVVLISFTTFGCISEQTYLPSSDNAVVKYPE
FT                   VTGYMYAPENPYQMDSPSDEYGRFQNSVRGTVTYENSNSFDTSMKNENFRVAIGYTPEG
FT                   SDVTVNVDIGGSSQTVTLSDPDAFYNDYQNVVVNTGLNLEHVDDGDGQVEVTIKHSSSE
FT                   KSVKIHEVAFIADQTSSTTSDDGGTTGGGTGDTGGTTSPSTGTVEFYTDPVGAAVYVDG
FT                   DYKGQTSSYSYGVLTMELYEGSHSYTVSANDYETETGTFSVTAGETNAVTASLEESTSD
FT                   GGGDDDGGDDGGDTEPSNTAPSAQISASQTSETNIVFTSESSDPDGQITKQEWFLNGEP
FT                   VSTGDQYQMETSNMNSGTYVVELDVTDDQGATSTAKYKVTIDETKKVVESEEKSGDSGT
FT                   DSEGDSRPRPVLQIPGFEAVFALAGLVIVVLLARRGER"
FT   sig_peptide     complement(605173..605250)
FT                   /locus_tag="Metev_0621"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.926) with cleavage site probability 0.716 at
FT                   residue 26"
FT   gene            complement(605256..607085)
FT                   /locus_tag="Metev_0622"
FT   CDS_pept        complement(605256..607085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0622"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vex:VEA_003407 putative calcium-binding outer
FT                   membrane-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73528"
FT                   /db_xref="GOA:D7E8I6"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8I6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73528.1"
FT                   /translation="MINAKSIITLIILLAAAVSLSGCLDLSTTGISEPMPVRSVDYTED
FT                   NPGNIDNNYWRISTTVDGTGEEYVLEVDEEQLKDGDTQAQNSLRLYFRPTQPYWDANCY
FT                   EPSNKLQYAYWNKNLWGTFKDLRTEDAKYWRVSGVDQTIHAGYEAVIEADGEEVASGTV
FT                   TNFATDDTESGTLTMEAEGPDGRDHTIYITLNNLEMKGVLTPKGELAIVSDGTDANSDS
FT                   SYDLVNYITLKETLEEEREFAKTGYDNLDPTQEDPDIWNWQDAYDWMRNNGLRSEIPSQ
FT                   SVSGYDIRGVESFSSNPQGIEVYYSKGTFSTSVTAYIPEELADTIVEEKAAPSPDINKL
FT                   DSVTTVEGESVNFKVTVDNKGTGGDVELTAVSDALKNIGTIGDQKRYIPSGESESFMFT
FT                   ADVADDITDYGEESFDVKVQADGGVSGQFGTTDTQTFELVVKSSDTAQKGTLKINAVYE
FT                   STGEEFENAPIYVGYGSDARKGTGSAEVEVMGDIEYAVYSNDTSGYKSQYTQEEPYLVT
FT                   VEPGGMEEVTIKFAEDRPGSDDEEWGWLWYYIGILAGILLIGFVVWYSGLIEYLIQNPI
FT                   LIAALIIATVVIWSILTVQDMLQSAADAITFWS"
FT   gene            complement(607082..607243)
FT                   /locus_tag="Metev_0623"
FT   CDS_pept        complement(607082..607243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0623"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cal:CaO19.2072 one of 4 genes similar to S.
FT                   cerevisiae HNM1 (YGL077C) choline and nitrogen mustard
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73529"
FT                   /db_xref="GOA:D7E8I7"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8I7"
FT                   /inference="similar to AA sequence:KEGG:CaO19.2072"
FT                   /protein_id="ADI73529.1"
FT                   /translation="MMNQIINIGLVLIAVLAFVYLLLPDFFPVTNMDEFMISGILFAIL
FT                   EKFGVKII"
FT   gene            complement(607259..607978)
FT                   /locus_tag="Metev_0624"
FT   CDS_pept        complement(607259..607978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0624"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_3320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73530"
FT                   /db_xref="GOA:D7E8I8"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8I8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73530.1"
FT                   /translation="MATKVSRVDDRIKGISALGLFAAVVQLLRTNADFLFPNIADTLTN
FT                   TIDFYLPMTLLFLVVLLYKTRLTGRQLPPMPKAYKLVRNYAFWFIVFWIGTFLLFFLTR
FT                   YALVGFGFPELQTQYTGAGSFILNFVIAAMENLALVMVAPALFAFNLGGSGVVSKIIEY
FT                   VPAGVVAALSHVSVYWTQTQLQIQKTGGDPVTNLAISLGFAYIAFTVFYLVYRYWGFAA
FT                   SVALHQTFNMNNSWLGG"
FT   gene            complement(608034..609212)
FT                   /locus_tag="Metev_0625"
FT   CDS_pept        complement(608034..609212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0625"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gfo:GFO_0054 cadherin domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73531"
FT                   /db_xref="GOA:D7E8I9"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8I9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73531.1"
FT                   /translation="MLGITWLSFNLILAIAGIMYVLDYFGMLRKIPLLNILSGRVPKNG
FT                   VVLIVSFVLIGIGFGWISIGGLVDTDDGGGITAPEAEAAQTYSGDIKLMISQGDGTDFT
FT                   DTSYDFYILDYSEYADKDKYEILQTVIDDGVSQLKAPGGGTPTASSTTDGAIERASMNA
FT                   QVGQRFLLFGYNSETPASGEFEVIKESFSVDNYNENLGEFTVTPNRFQIYEYSSMQTVN
FT                   FAGSNVSGYTETETSYTTDKTITFDAQPQNNYRIGDRMGLYVELPEDLKGNIDTITVSK
FT                   EDGTSQDFTSFQKVDNLDTSDPIYESAPSAQNSANDMYWIGELPDVKRTSDSNKDPLEI
FT                   KITYTHPGSGTNEAHFYGMQLVDAGRNLEIPFSQEPAFTLNATDSGSDGWDT"
FT   gene            complement(609460..610788)
FT                   /locus_tag="Metev_0626"
FT   CDS_pept        complement(609460..610788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0626"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: FG-GAP repeat protein; KEGG:
FT                   mbr:MONBRDRAFT_31371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73532"
FT                   /db_xref="GOA:D7E8J0"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8J0"
FT                   /inference="protein motif:PFAM:PF01839"
FT                   /protein_id="ADI73532.1"
FT                   /translation="MLGITWLSFNVILAIAGIFYVLDYFGFLRTIPLVNTLSGKMPRNP
FT                   VFLMGAIVLVAVGMGWVSVGSVSDTVDNESPGPEVTTDIKDQQTVNLEEKSGGGGWSEK
FT                   TLIFTNAHEIHSYNNDTKSMKVADMNNDGHLDVIAGNNGQIDCWYENNSDGTFTAHEIN
FT                   INSEWANSIAIYDLNNDGYLDIICGTGGVNSWYENNGDGTFTPHDIHSHEKDTQAIKVA
FT                   DMNKDGHPDIIVGNAFEYKNYWYENNSDGTFTAHEIHNNAKNTYAIELADLNNDGYLDY
FT                   IAGNGNENYWYENSGDNTKFTAHEIHTNPDWTKSVDVADMNGDNRIDILIGNSGYKNCW
FT                   YENSGDDTFHEHEIHSKSEYTRSLKVNDINNDGHLDVITGVNNDSNYFYENNGNNTFTA
FT                   HKMHSNKKRTYSIEVIDFNNDGIKDIIVGNWDTNNWYEADFVH"
FT   gene            611022..611615
FT                   /locus_tag="Metev_0627"
FT   CDS_pept        611022..611615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0627"
FT                   /product="Protein of unknown function DUF1628"
FT                   /note="PFAM: Protein of unknown function DUF1628; KEGG:
FT                   mba:Mbar_A1390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73533"
FT                   /db_xref="GOA:D7E8J1"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8J1"
FT                   /inference="protein motif:PFAM:PF07790"
FT                   /protein_id="ADI73533.1"
FT                   /translation="MGKYNSSLLREDDKGVSPVIGVILMVAITVILAAVIGSIVYDTDT
FT                   KYLEKPSQAAFETSTVNGIHRDTEEMTVPVIKINKVAGDTLSQEYEEGVHSGIKLNKVY
FT                   LFDPDGNKYEVNNSDTMEGSIIETGESFYIFHFEHDDGNYWMTNNKKRVKKADWEFEGQ
FT                   PRGSGVEPFKSGKWRLLIVDDKRDLILVDTKIEL"
FT   gene            complement(611943..612437)
FT                   /locus_tag="Metev_0628"
FT   CDS_pept        complement(611943..612437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0628"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73534"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8J2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73534.1"
FT                   /translation="MNKKTITIIIILLVLMGIGCTSSPDENDSDDTTNQTDDNQEQSDG
FT                   IPKQAPQLSIVGGSESINGNKIIKLEHRGGDKVTFVKGETTVEVNDKEVVYNLNEDDKF
FT                   REGDTYYIYYDSHSGDLVMINPNKKDVESISDELASIPGMVSVRIIDDASHQIIADMTI
FT                   R"
FT   sig_peptide     complement(612354..612437)
FT                   /locus_tag="Metev_0628"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.870) with cleavage site probability 0.420 at
FT                   residue 28"
FT   gene            complement(612470..612730)
FT                   /locus_tag="Metev_0629"
FT   CDS_pept        complement(612470..612730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0629"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kla:KLLA0F25762g hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73535"
FT                   /db_xref="GOA:D7E8J3"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8J3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73535.1"
FT                   /translation="MDAGAIIIGSAILVASLLLNMYVSDQIDEMNQYGVFDEIVREIDD
FT                   ESKEEYQTMKIIKYGSTAGIVIGGIILLVGFVKSGTDKKKK"
FT   gene            complement(613041..613709)
FT                   /locus_tag="Metev_0630"
FT   CDS_pept        complement(613041..613709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0630"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A1917 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73536"
FT                   /db_xref="GOA:D7E8J4"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8J4"
FT                   /inference="similar to AA sequence:KEGG:Mbar_A1917"
FT                   /protein_id="ADI73536.1"
FT                   /translation="MGFLSDFSRYYTPIQPLILRKSLNINKTMGQVGGIKISEDILVKG
FT                   TKIIGPFEYDALSEQIPKDYLRTIFEILFWSGMRYVELQRLYQYPDWWWPRKKAIHLPE
FT                   FAQKKSKRKQPERYIYPLPPQFDMVMRYFFKGPNPPRLDVWGENMKRWAEKADMDPKGF
FT                   SAKTTRKSIESWMVTSGMPLTSICLRQGHDNLTSMRHYQGLPFTDAEKAEIKKRLAWVH
FT                   "
FT   gene            complement(613958..614377)
FT                   /locus_tag="Metev_0631"
FT   CDS_pept        complement(613958..614377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0631"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tva:TVAG_122820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73537"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8J5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI73537.1"
FT                   /translation="MKPLNDILGKEDNIVAKSHVKTFEDINFCILKGYKNSKFSKTTNF
FT                   YITADELSKCFANDREIIRASKLEHFNFKPESNLVIIEQLDKKLDENVLYEQEKAIVQL
FT                   VQSARQQGRTYIFLTIHPVSEKLSELCDLYIVKNE"
FT   gene            complement(614517..614654)
FT                   /locus_tag="Metev_0632"
FT   CDS_pept        complement(614517..614654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Metev_0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Metev_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADI73538"
FT                   /db_xref="UniProtKB/TrEMBL:D7E8J6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI7353