(data stored in SCRATCH3701 zone)

EMBL: CP002077

ID   CP002077; SV 1; circular; genomic DNA; STD; PRO; 811088 BP.
XX
AC   CP002077;
XX
PR   Project:PRJNA49525;
XX
DT   30-JUL-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Mycoplasma pneumoniae FH, complete genome.
XX
KW   .
XX
OS   Mycoplasma pneumoniae FH
OC   Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
XX
RN   [1]
RP   1-811088
RX   DOI; 10.1128/AEM.00024-10.
RX   PUBMED; 20543037.
RA   Krishnakumar R., Assad-Garcia N., Benders G.A., Phan Q., Montague M.G.,
RA   Glass J.I.;
RT   "Targeted chromosomal knockouts in Mycoplasma pneumoniae";
RL   Appl. Environ. Microbiol. 76(15):5297-5299(2010).
XX
RN   [2]
RP   1-811088
RA   Montague M.G., Fedorova N.B., Durkin A.S., Assad-Garcia N., Glass J.I.;
RT   ;
RL   Submitted (10-JUN-2010) to the INSDC.
RL   The J. Craig Venter Institute, 9704 Medical Center Dr., Rockville, MD
RL   20874, USA
XX
DR   MD5; c78c5702a527addb098e3adac5dd72de.
DR   BioSample; SAMN02603455.
DR   EnsemblGenomes-Gn; EBG00001019243.
DR   EnsemblGenomes-Gn; EBG00001019245.
DR   EnsemblGenomes-Gn; EBG00001019247.
DR   EnsemblGenomes-Gn; EBG00001019249.
DR   EnsemblGenomes-Gn; EBG00001019251.
DR   EnsemblGenomes-Gn; EBG00001019253.
DR   EnsemblGenomes-Gn; EBG00001019255.
DR   EnsemblGenomes-Gn; EBG00001019256.
DR   EnsemblGenomes-Gn; EBG00001019258.
DR   EnsemblGenomes-Gn; EBG00001019262.
DR   EnsemblGenomes-Gn; EBG00001019264.
DR   EnsemblGenomes-Gn; EBG00001019266.
DR   EnsemblGenomes-Gn; EBG00001019268.
DR   EnsemblGenomes-Gn; EBG00001019270.
DR   EnsemblGenomes-Gn; EBG00001019273.
DR   EnsemblGenomes-Gn; EBG00001019274.
DR   EnsemblGenomes-Gn; EBG00001019276.
DR   EnsemblGenomes-Gn; EBG00001019278.
DR   EnsemblGenomes-Gn; EBG00001019280.
DR   EnsemblGenomes-Gn; EBG00001019281.
DR   EnsemblGenomes-Gn; EBG00001019284.
DR   EnsemblGenomes-Gn; EBG00001019285.
DR   EnsemblGenomes-Gn; EBG00001019286.
DR   EnsemblGenomes-Gn; EBG00001019287.
DR   EnsemblGenomes-Gn; EBG00001019288.
DR   EnsemblGenomes-Gn; EBG00001019289.
DR   EnsemblGenomes-Gn; EBG00001019290.
DR   EnsemblGenomes-Gn; EBG00001019291.
DR   EnsemblGenomes-Gn; EBG00001019292.
DR   EnsemblGenomes-Gn; EBG00001019293.
DR   EnsemblGenomes-Gn; EBG00001019294.
DR   EnsemblGenomes-Gn; EBG00001019295.
DR   EnsemblGenomes-Gn; EBG00001019296.
DR   EnsemblGenomes-Gn; EBG00001019297.
DR   EnsemblGenomes-Gn; EBG00001019298.
DR   EnsemblGenomes-Gn; EBG00001019299.
DR   EnsemblGenomes-Gn; EBG00001019300.
DR   EnsemblGenomes-Gn; EBG00001019301.
DR   EnsemblGenomes-Gn; EBG00001019302.
DR   EnsemblGenomes-Gn; EBG00001019303.
DR   EnsemblGenomes-Gn; EBG00001019304.
DR   EnsemblGenomes-Gn; EBG00001019305.
DR   EnsemblGenomes-Gn; EBG00001019306.
DR   EnsemblGenomes-Gn; EBG00001019307.
DR   EnsemblGenomes-Gn; MPNE_0019.
DR   EnsemblGenomes-Gn; MPNE_0020.
DR   EnsemblGenomes-Gn; MPNE_0087.
DR   EnsemblGenomes-Gn; MPNE_0108.
DR   EnsemblGenomes-Gn; MPNE_0109.
DR   EnsemblGenomes-Gn; MPNE_0110.
DR   EnsemblGenomes-Gn; MPNE_0139.
DR   EnsemblGenomes-Gn; MPNE_0346.
DR   EnsemblGenomes-Gn; MPNE_0347.
DR   EnsemblGenomes-Gn; MPNE_0348.
DR   EnsemblGenomes-Gn; MPNE_0349.
DR   EnsemblGenomes-Gn; MPNE_0350.
DR   EnsemblGenomes-Gn; MPNE_0351.
DR   EnsemblGenomes-Gn; MPNE_0352.
DR   EnsemblGenomes-Gn; MPNE_0353.
DR   EnsemblGenomes-Gn; MPNE_0365.
DR   EnsemblGenomes-Gn; MPNE_0414.
DR   EnsemblGenomes-Gn; MPNE_0416.
DR   EnsemblGenomes-Gn; MPNE_0417.
DR   EnsemblGenomes-Gn; MPNE_0438.
DR   EnsemblGenomes-Gn; MPNE_0448.
DR   EnsemblGenomes-Gn; MPNE_0464.
DR   EnsemblGenomes-Gn; MPNE_0465.
DR   EnsemblGenomes-Gn; MPNE_0466.
DR   EnsemblGenomes-Gn; MPNE_0467.
DR   EnsemblGenomes-Gn; MPNE_0468.
DR   EnsemblGenomes-Gn; MPNE_0476.
DR   EnsemblGenomes-Gn; MPNE_0529.
DR   EnsemblGenomes-Gn; MPNE_0530.
DR   EnsemblGenomes-Gn; MPNE_0532.
DR   EnsemblGenomes-Gn; MPNE_0533.
DR   EnsemblGenomes-Gn; MPNE_0534.
DR   EnsemblGenomes-Gn; MPNE_0535.
DR   EnsemblGenomes-Gn; MPNE_0536.
DR   EnsemblGenomes-Gn; MPNE_0537.
DR   EnsemblGenomes-Gn; MPNE_0538.
DR   EnsemblGenomes-Gn; MPNE_0547.
DR   EnsemblGenomes-Gn; MPNE_0549.
DR   EnsemblGenomes-Gn; MPNE_0614.
DR   EnsemblGenomes-Gn; MPNE_0616.
DR   EnsemblGenomes-Gn; MPNE_0622.
DR   EnsemblGenomes-Gn; MPNE_0659.
DR   EnsemblGenomes-Tr; EBT00001622723.
DR   EnsemblGenomes-Tr; EBT00001622726.
DR   EnsemblGenomes-Tr; EBT00001622728.
DR   EnsemblGenomes-Tr; EBT00001622730.
DR   EnsemblGenomes-Tr; EBT00001622732.
DR   EnsemblGenomes-Tr; EBT00001622734.
DR   EnsemblGenomes-Tr; EBT00001622737.
DR   EnsemblGenomes-Tr; EBT00001622739.
DR   EnsemblGenomes-Tr; EBT00001622741.
DR   EnsemblGenomes-Tr; EBT00001622743.
DR   EnsemblGenomes-Tr; EBT00001622745.
DR   EnsemblGenomes-Tr; EBT00001622748.
DR   EnsemblGenomes-Tr; EBT00001622750.
DR   EnsemblGenomes-Tr; EBT00001622752.
DR   EnsemblGenomes-Tr; EBT00001622754.
DR   EnsemblGenomes-Tr; EBT00001622756.
DR   EnsemblGenomes-Tr; EBT00001622758.
DR   EnsemblGenomes-Tr; EBT00001622761.
DR   EnsemblGenomes-Tr; EBT00001622763.
DR   EnsemblGenomes-Tr; EBT00001622765.
DR   EnsemblGenomes-Tr; EBT00001622767.
DR   EnsemblGenomes-Tr; EBT00001622769.
DR   EnsemblGenomes-Tr; EBT00001622771.
DR   EnsemblGenomes-Tr; EBT00001622773.
DR   EnsemblGenomes-Tr; EBT00001622775.
DR   EnsemblGenomes-Tr; EBT00001622777.
DR   EnsemblGenomes-Tr; EBT00001622779.
DR   EnsemblGenomes-Tr; EBT00001622781.
DR   EnsemblGenomes-Tr; EBT00001622784.
DR   EnsemblGenomes-Tr; EBT00001622788.
DR   EnsemblGenomes-Tr; EBT00001622790.
DR   EnsemblGenomes-Tr; EBT00001622792.
DR   EnsemblGenomes-Tr; EBT00001622794.
DR   EnsemblGenomes-Tr; EBT00001622797.
DR   EnsemblGenomes-Tr; EBT00001622799.
DR   EnsemblGenomes-Tr; EBT00001622801.
DR   EnsemblGenomes-Tr; EBT00001622803.
DR   EnsemblGenomes-Tr; EBT00001622805.
DR   EnsemblGenomes-Tr; EBT00001622808.
DR   EnsemblGenomes-Tr; EBT00001622809.
DR   EnsemblGenomes-Tr; EBT00001622814.
DR   EnsemblGenomes-Tr; EBT00001622818.
DR   EnsemblGenomes-Tr; EBT00001622820.
DR   EnsemblGenomes-Tr; EBT00001622822.
DR   EnsemblGenomes-Tr; MPNE_0019-1.
DR   EnsemblGenomes-Tr; MPNE_0020-1.
DR   EnsemblGenomes-Tr; MPNE_0087-1.
DR   EnsemblGenomes-Tr; MPNE_0108-1.
DR   EnsemblGenomes-Tr; MPNE_0109-1.
DR   EnsemblGenomes-Tr; MPNE_0110-1.
DR   EnsemblGenomes-Tr; MPNE_0139-1.
DR   EnsemblGenomes-Tr; MPNE_0346-1.
DR   EnsemblGenomes-Tr; MPNE_0347-1.
DR   EnsemblGenomes-Tr; MPNE_0348-1.
DR   EnsemblGenomes-Tr; MPNE_0349-1.
DR   EnsemblGenomes-Tr; MPNE_0350-1.
DR   EnsemblGenomes-Tr; MPNE_0351-1.
DR   EnsemblGenomes-Tr; MPNE_0352-1.
DR   EnsemblGenomes-Tr; MPNE_0353-1.
DR   EnsemblGenomes-Tr; MPNE_0365-1.
DR   EnsemblGenomes-Tr; MPNE_0414-1.
DR   EnsemblGenomes-Tr; MPNE_0416-1.
DR   EnsemblGenomes-Tr; MPNE_0417-1.
DR   EnsemblGenomes-Tr; MPNE_0438-1.
DR   EnsemblGenomes-Tr; MPNE_0448-1.
DR   EnsemblGenomes-Tr; MPNE_0464-1.
DR   EnsemblGenomes-Tr; MPNE_0465-1.
DR   EnsemblGenomes-Tr; MPNE_0466-1.
DR   EnsemblGenomes-Tr; MPNE_0467-1.
DR   EnsemblGenomes-Tr; MPNE_0468-1.
DR   EnsemblGenomes-Tr; MPNE_0476-1.
DR   EnsemblGenomes-Tr; MPNE_0529-1.
DR   EnsemblGenomes-Tr; MPNE_0530-1.
DR   EnsemblGenomes-Tr; MPNE_0532-1.
DR   EnsemblGenomes-Tr; MPNE_0533-1.
DR   EnsemblGenomes-Tr; MPNE_0534-1.
DR   EnsemblGenomes-Tr; MPNE_0535-1.
DR   EnsemblGenomes-Tr; MPNE_0536-1.
DR   EnsemblGenomes-Tr; MPNE_0537-1.
DR   EnsemblGenomes-Tr; MPNE_0538-1.
DR   EnsemblGenomes-Tr; MPNE_0547-1.
DR   EnsemblGenomes-Tr; MPNE_0549-1.
DR   EnsemblGenomes-Tr; MPNE_0614-1.
DR   EnsemblGenomes-Tr; MPNE_0616-1.
DR   EnsemblGenomes-Tr; MPNE_0622-1.
DR   EnsemblGenomes-Tr; MPNE_0659-1.
DR   EuropePMC; PMC2916464; 20543037.
DR   EuropePMC; PMC3232873; 21949077.
DR   EuropePMC; PMC3294768; 22328753.
DR   EuropePMC; PMC3472980; 23091634.
DR   EuropePMC; PMC4335877; 25451048.
DR   EuropePMC; PMC4559472; 26335586.
DR   EuropePMC; PMC4625007; 26509651.
DR   EuropePMC; PMC5527024; 28743917.
DR   EuropePMC; PMC6084921; 30104808.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002077.
DR   SILVA-SSU; CP002077.
DR   StrainInfo; 139789; 1.
XX
CC   The genome was sequenced using Roche 454 Titanium technology and
CC   closed by direct genomic sequencing and sequencing of PCR products
CC   using Sanger technology. Assembly of the 49711 non-paired-end 454
CC   Titanium reads was done by the de-novo assembled with Newbler
CC   version is v2.3.00.0.  Sanger sequencing of purified PCR products
CC   was used to join all contigs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..811088
FT                   /organism="Mycoplasma pneumoniae FH"
FT                   /strain="FH"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:722438"
FT   gene            691..1833
FT                   /gene="dnaN"
FT                   /locus_tag="MPNE_0001"
FT   CDS_pept        691..1833
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dnaN"
FT                   /locus_tag="MPNE_0001"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02768; match to protein
FT                   family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87144"
FT                   /db_xref="GOA:A0A0H3DPN0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPN0"
FT                   /protein_id="ADK87144.1"
FT                   /translation="MKVLINKNELNKILKKLNNVIVSNNKMKPYHSYLLIEATEKEINF
FT                   YANNEYFSAKCTLAENIDVLEEGEVIVKGKIFSELINGIKEDIIIIQEKDQTLLVKTKK
FT                   TNINLNTIDKKEFPRIRFNQNVDLKEFDELKIQHSLLTKGLKKIAHAVSTFRESTRKFN
FT                   GVNFNGSNGKQIFLEASDSYKLSVYEIKQKTDPFNFIVETNLLSFINSFNPEGGDLISI
FT                   FFRKEHKDDLSTELLIKLDNFLINYTSINESFPRVMQLFDFEPETKVTIQKNELKDALQ
FT                   RILTLAQNERFFLCDMQVTNSHLKINSNVQNIGASLEEVTCLKFEGHKLNIAVNALSLL
FT                   EHIDSFDTDEIELYFQGSNKYFLISSNNEPELKEILVPSK"
FT   gene            1837..2766
FT                   /gene="dnaJ"
FT                   /locus_tag="MPNE_0002"
FT   CDS_pept        1837..2766
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dnaJ"
FT                   /locus_tag="MPNE_0002"
FT                   /product="DnaJ domain protein"
FT                   /note="identified by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87105"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL41"
FT                   /protein_id="ADK87105.1"
FT                   /translation="MTLYDLLELPQTATLQEIKTAYKRLAKRYHPDINKQGADTFVKIN
FT                   NAYAVLSDTTQKAEYDAMLRFSEFEDRVKRLDFSIKWHEQFMEELQFHHNWDFDFIRNR
FT                   EYTQPTPTNNKYSSFLDKDVSLAFYQLYSKGKLDFDLEDTLLRRHSIKQAFLKGKKLND
FT                   VLKEQYNYLGWLEAKRYFNIDVEIELTPKEVREGGVVNLPLKIKVISNNYPGQMWYELN
FT                   KNYSFRLLWDIKNGEVAEFFGKGNRALGWRGDLIVRMRIVDKIKKRLRIFSSHFEQDKT
FT                   KLWFLVPQDKQDNPNKWVFDYKTHEFIV"
FT   gene            2853..4058
FT                   /pseudo
FT                   /locus_tag="MPNE_0003"
FT                   /note="putative DNA gyrase, B subunit; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00204; match to
FT                   protein family HMM PF02518"
FT   gene            4261..4806
FT                   /pseudo
FT                   /locus_tag="MPNE_0004"
FT                   /note="DNA gyrase, B subunit, C-terminal domain protein;
FT                   this gene contains a frame shift which may be the result of
FT                   a sequencing error; identified by match to protein family
FT                   HMM PF00986"
FT   gene            4806..7325
FT                   /gene="gyrA"
FT                   /locus_tag="MPNE_0005"
FT   CDS_pept        4806..7325
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gyrA"
FT                   /locus_tag="MPNE_0005"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86940"
FT                   /db_xref="GOA:A0A0H3DME4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DME4"
FT                   /protein_id="ADK86940.1"
FT                   /translation="MAKQQDQIDKIRQELAQSAIKNISLSSELERSFMEYAMSVIVARA
FT                   LPDARDGLKPVHRRVLYGAYTGGMHHDRPFKKSARIVGDVMSKFHPHGDMAIYDTMSRM
FT                   AQDFSLRYLLIDGHGNFGSIDGDRPAAQRYTEARLSKLAGELLRDIDKDTVDFVANYDG
FT                   EEQEPTVLPAAFPNLLANGSSGIAVGMSTSIPSHNLSELIQGLILLIDNPDCTINDLLG
FT                   VIKGPDFPTGANIIYTKGIESYFETGKGNVVIRSKVSIEQLPTRAALVVTEIPYMVNKT
FT                   SLIEKIVELVKAEEITGIADIRDESSREGIRLVIEVKRDTVPEVLLNQLFKSTRLQVRF
FT                   PVNMLALVKGAPKLLNMKQALTVYLEHQLDVLIRKTQFNLKKYQERFHILSGLLIAALN
FT                   IDEVIAIIKKSANNQVAMEALHERFGLDEIQARAVLDMRLRSLSVLEVNKLQTEQQELK
FT                   ALIEFCQQVLADKQLQLKLIKEQLTKINEQFGDPRRSEILYGISEDIDDEDLITQENVV
FT                   ITMSTNGYLKRIGVDSYNLQHRGGVGVKGLTTYTDDSISQLLVCSTHSDLLFFTDKGKV
FT                   YRIRAHQIPPGFRTNKGIPAVNLIKIDKDEKICALISVNDYQNGYFFFCTKNGTIKRTS
FT                   LSEFANILSIGKRAILFKENDVLFSVIRTSGQDDIFIGSTAGFVVRFHEDTVRPLSRAA
FT                   MGVLGINLNQGEFVNGLSTSSNGSLLLSVGQNGIGKLTSIDKYRLTKRNAKGVKTLRVT
FT                   AKTGPVVTTTTVFGNEDLLMISSAGKIVRISLEQLSEQGKNTSGVKLIKLKEKERLETV
FT                   TIFKKEEAIKTTTATETDDVGSKQITQ"
FT   gene            7297..8559
FT                   /gene="serS"
FT                   /locus_tag="MPNE_0006"
FT   CDS_pept        7297..8559
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="serS"
FT                   /locus_tag="MPNE_0006"
FT                   /product="serine--tRNA ligase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87205"
FT                   /db_xref="GOA:A0A0H3DLE2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLE2"
FT                   /protein_id="ADK87205.1"
FT                   /translation="MLDRNKLRNNLDFFKKKLVERGVSESQFEAYVQADKAMRKLLHQI
FT                   ELANQKQTLLAKQVAKKKGDLKLLKESKELKQKLEQLNIAFKEAETLSQELLLNLPNIA
FT                   DESVPVGRDETANLELLKEGRKPVFDFTPLPHWELCERLQLVAFDKATKLTGARFVAYT
FT                   DKAAKLLRAIASLMIDFNKNKYQEWNVPVIVNETSLTGTGQLPKFKDDVFKLENTRYYL
FT                   SPTLEVQLANLHANEIFTEGELPKYYTATGVNFRQEAGSAGKQTKGTIRLHQFQKVELV
FT                   KFCKPSEAIHELEEMTRDAEQILLELKIPFRRLLLCSGDMGFSAQKTYDLEVWMAGCNE
FT                   YREVSSCSSCGDFQARRAMIRYKDLTTGKNTYVATLNGTALAIDRIFAAILEHYQTKAG
FT                   EVMIPQALLKYLDFDKITKPK"
FT   gene            8564..9196
FT                   /gene="tmk"
FT                   /locus_tag="MPNE_0007"
FT   CDS_pept        8564..9196
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tmk"
FT                   /locus_tag="MPNE_0007"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="identified by match to protein family HMM PF02223;
FT                   match to protein family HMM TIGR00041"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86798"
FT                   /db_xref="GOA:A0A0H3DK89"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK89"
FT                   /protein_id="ADK86798.1"
FT                   /translation="MKQGVFVAIEGVDGAGKTVLLEAFKQRFPQSFLGFKTLFSREPGG
FT                   TPLAEKIRALLLHEAMEPLTEAYLFAASRTEHVRQLIQPALQQKQLVIVDRFVWSSYAY
FT                   QGLIKKVGLDVVKKLNADAVGDSMPDFTFIVDCDFETALNRMAKRGQDNLLDNTVKKQA
FT                   DFNTMRQYYHSLVDNKRVFLLDGQNQTGCLEQFIEQLSQCLTQPTLS"
FT   gene            9169..9930
FT                   /locus_tag="MPNE_0008"
FT   CDS_pept        9169..9930
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0008"
FT                   /product="DNA polymerase III, delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87103"
FT                   /db_xref="GOA:A0A0H3DN25"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN25"
FT                   /protein_id="ADK87103.1"
FT                   /translation="MFNPTHALLIIQRRGSYLQPVLTEYLTRVVCEQQTGCQTCPSCLE
FT                   ILHGTYNNFYSFDQANPFKREHALHLSEVLNRQSESNQKQLYLIKNLETLTATAMNSLL
FT                   RLIEEHPVNTYGVFTTKNENMILPTILSRVQKVVLKKATQLPFQVDSKDQAILKSFFSV
FT                   DEQLQALDNGSFTRLKTIITTLTNKKNTASTVHKAWVLFKQLNQTETAQVLNFMVDYTK
FT                   DLTKKDRLLNMVQNLVFNPPKAALFANLINW"
FT   gene            9932..11260
FT                   /gene="trmE"
FT                   /locus_tag="MPNE_0009"
FT   CDS_pept        9932..11260
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trmE"
FT                   /locus_tag="MPNE_0009"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF08477; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR00450"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87042"
FT                   /db_xref="GOA:A0A0H3DMT4"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMT4"
FT                   /protein_id="ADK87042.1"
FT                   /translation="MDTKQTMFALATAPFNSAIHIIRLSGPDVYRIINQITNKEVKPLG
FT                   MRIQRVWLIDHNQKKVDDVLLFKFVAPNSYTGEDLIEISCHGSMVIVNEIIGLLLKHGA
FT                   VQAQPGEFTQRGYLNGKMSLNQAASVNNLVLSPNTTLKDVALNALAGQVDARLEPLVEK
FT                   LGQLVMQMEVNLDYPEYTDEQRELVTMNQAVLQITQILNQIVVGQDQLQRLKDPFKIAI
FT                   IGNTNVGKSSLLNALLDQDKAIVSAIKGSTRDIVEGDFALNGHFVKILDTAGIRQHQSA
FT                   LEKAGIQKTFGAIKTANLVIYLLDARQPEPDPKIIARLKKLKKDFFLVHNKADLVQQSF
FT                   QVSISAKQKQIQPLVDLLTQYLHQFYSVEQNQLYLISDWQTILLQKAIAELEHFLIKQQ
FT                   NCLFFDILVVHLRAAHEYILQVLGKNTNYDLINEIFKHFCLGK"
FT   gene            11260..12045
FT                   /locus_tag="MPNE_0010"
FT   CDS_pept        11260..12045
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0010"
FT                   /product="hydrolase, TatD family"
FT                   /note="identified by match to protein family HMM PF01026;
FT                   match to protein family HMM TIGR00010"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87090"
FT                   /db_xref="GOA:A0A0H3DL22"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL22"
FT                   /protein_id="ADK87090.1"
FT                   /translation="MEYFDAHCHLNCEPLLEQHEKSLANFRLIGLKANVVGTNLTNSQI
FT                   AVNLAKQHPDLLKAGVGIHPNDVQLFDLKAAQATLEKLVSTHRSFISCIGEYGFDYHYT
FT                   KDYITQQEQFFLMQFQLAEQYQLVHMLHVRDVHERIYEVLKRLKPKQPVVFHCFSEDTN
FT                   TALKLLTLREVGLKVYFSIPGIVTFKNAKNLQAALSVIPTELLLSETDSPYLAPVPFRG
FT                   KTNWPECVVHTVQTIADIKQVPLAEIKQAIVHNAKKLFW"
FT   gene            12377..12637
FT                   /locus_tag="MPNE_0011"
FT   CDS_pept        12377..12637
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86999"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL80"
FT                   /protein_id="ADK86999.1"
FT                   /translation="MKTPGTRYVTHKQLDEKLKNFVTKTEFKEFQTVVMESFAVQNQNI
FT                   DAQGEQIKELQVEQKAQGKTLQLILEALQGINKRLDNLESK"
FT   gene            complement(12823..13518)
FT                   /locus_tag="MPNE_0012"
FT   CDS_pept        complement(12823..13518)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00938"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86924"
FT                   /db_xref="InterPro:IPR001595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL10"
FT                   /protein_id="ADK86924.1"
FT                   /translation="MKFKFLLTPLLSSVLFLSACSATFEADLKNLIKETDGKDLDVSKL
FT                   IITSEGKQILIGYLKKSYEVNSEKTTELLLNAWKQSAEKNEIGIDLFNWTKSIFSGVNT
FT                   FNKKQKVEYFNMTYKGISDVSVKAKLNHTLTWNENYSYRGFNIHKGDKHYFNSFLTLKA
FT                   NSYLPFTSKNFDVYSKRIRLSVSFHWILKGKDELSQKILDKTVLNGYIEYIVDNYQINL
FT                   FRYLVYLIE"
FT   gene            complement(13543..14250)
FT                   /locus_tag="MPNE_0013"
FT   CDS_pept        complement(13543..14250)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00938"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86837"
FT                   /db_xref="InterPro:IPR001595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNQ5"
FT                   /protein_id="ADK86837.1"
FT                   /translation="MKFKYLSIPFLSSTLLFSAYASIQSDLRNLIQETTKQDVDVYKVI
FT                   KTSEGRKNLITSLKKSYEVNPDKTTKLLLDAWKQSAEKGEIDIEKINFPDVGIYATGND
FT                   PLKIELKVEYFDMEYQDLNNFSINAKLNYNFNWHGNYSSNGFAAKKGDKHVFDLPLAIK
FT                   PSSKNQSKTISFITKTGEGVDTEWIEFPVSLSWSLQGKINKVKEILRKSFWKAMILEQI
FT                   LNTQLISLDTCFS"
FT   gene            14978..15751
FT                   /locus_tag="MPNE_0014"
FT   CDS_pept        14978..15751
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86683"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKA9"
FT                   /protein_id="ADK86683.1"
FT                   /translation="MPKVISQKEFNILSRTKERVNFQIVYTKQRNDLHKAAKEYFFKDK
FT                   DFTIIEDTPDTPDQPDGPCITKGPKEPGGPEEPNGPDKPEDPKDPDTPDVSEGPKEQGG
FT                   QKDPGGPDDPNEGKQKVSKPDKYVTHRELDEKLKDFATKADFKRVEDKVDVLFELQKTQ
FT                   GEQIKVQGEQIKAQGKQIEQLTETVKVQGEQIRAQGEQIKAQSEEIKEIKVEQKAQGEQ
FT                   IKELQVEQKAQGKTLQLILKTLEKMNERLEKLESK"
FT   gene            15925..16491
FT                   /locus_tag="MPNE_0016"
FT   CDS_pept        15925..16491
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0016"
FT                   /product="DNA primase-like protein"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM TIGR00646"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87190"
FT                   /db_xref="InterPro:IPR004611"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLC5"
FT                   /protein_id="ADK87190.1"
FT                   /translation="MQYLTKRGFNLQDLLSVGGGLAYLGEKQWLNLSLYNFNNQLVGFL
FT                   SRKVGFEKKFLYLPINKPPSKSESFLGLKHLPTETNTIYLVEGDFDWLAFRKGGILNCL
FT                   PLCGLTLSDKQMKFFQQSKIEKVVLCLDNDFAGKVAAANLERILKNAGFQVKVVQLKGK
FT                   VKDWNELLLLYPKNWAKALRDHLAL"
FT   gene            complement(16468..17325)
FT                   /locus_tag="MPNE_0015"
FT   CDS_pept        complement(16468..17325)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0015"
FT                   /product="RimK-like ATP-grasp domain protein"
FT                   /note="identified by match to protein family HMM PF08443"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86894"
FT                   /db_xref="GOA:A0A0H3DKY4"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKY4"
FT                   /protein_id="ADK86894.1"
FT                   /translation="MAKIKLKNRKALVVYNKTDFDKNKHFAQALVDELNKKKLVGHILL
FT                   LDDETADHKHIKNVELIINRSRRIDFLTKHNFLNSFLINPQNIVLVANDKYETYRWLKQ
FT                   HKFLTVDTTIFDPKKIKTFPIVIKKRDSHGGEDVHLIQNAEEIKQLPIQNPNEWIVQPF
FT                   LSIGKVEYRAYILFGKVLKTIRRTASGDDFRANYSQNAAVDLFKLKWYMKHKIKRIAKK
FT                   LGHGYYAIDFFLNKYNRIVVNEIEDAAGARALTKMCPDLNLPRVIIKSSLTHFKHHLKR
FT                   QMIP"
FT   gene            complement(17325..18191)
FT                   /locus_tag="MPNE_0017"
FT   CDS_pept        complement(17325..18191)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0017"
FT                   /product="alpha-L-glutamate ligase, RimK family"
FT                   /note="identified by match to protein family HMM PF08443;
FT                   match to protein family HMM TIGR00768"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86758"
FT                   /db_xref="GOA:A0A0H3DK51"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK51"
FT                   /protein_id="ADK86758.1"
FT                   /translation="MKHISAVYNPAFTNIASKLNQTELLKDAAQSLNIQLDFFTCFDIN
FT                   TNQDKTKLPFKSNTILFLDKNIALAQWLESVGLRVINSSIAINNADNKALSHAVLAQHP
FT                   TIKQIPTLIGPQNFRLAWYPEKLEQFIEQIKRCFQFPVIVKSIYGSFGDYVFLCKDEQK
FT                   LRQTLSGLTEQIIVQQYIATSNSEAVRVIVVNNQVVGALHTQNEGDFRSNLNKGAVGEP
FT                   YQLSQEETKLAITISQAMQLFYCGIDFLFDQDRSLIFCEVNSNVQLTKSSMYLKTNLAI
FT                   QLLASIA"
FT   gene            complement(18166..18975)
FT                   /gene="folD"
FT                   /locus_tag="MPNE_0018"
FT   CDS_pept        complement(18166..18975)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="folD"
FT                   /locus_tag="MPNE_0018"
FT                   /product="tetrahydrofolate dehydrogenase/cyclohydrolase,
FT                   catalytic domain protein"
FT                   /note="identified by match to protein family HMM PF00763;
FT                   match to protein family HMM PF02882"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87012"
FT                   /db_xref="GOA:A0A0H3DMQ0"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMQ0"
FT                   /protein_id="ADK87012.1"
FT                   /translation="MSFDGKQLAHEILLTYKNRDWSQVKLVILQTNNDVSSDAFIRQKM
FT                   NACNTLGAQSELIKYHESVTEKELLEKIQQLNTDPEVTGIILQLPVYPHLKQNKLLKAI
FT                   DPYKDVDYLTGNCPLPIRSCVVEAVLILKEHFHHDFTNKQIVVVGLGVTGGGPIFHYLK
FT                   ETGHQVVGCDKHTPNTMELIKTADVVITAIGKPHFFKTTNFKPGVILYDVGVSRNALNK
FT                   LCGDIDPNGIEKVAKWWSPTPGGVGPFTVLAIMKNLWVLYEAHQRRI"
FT   gene            complement(19060..19135)
FT                   /locus_tag="MPNE_0019"
FT   tRNA            complement(19060..19135)
FT                   /locus_tag="MPNE_0019"
FT                   /product="tRNA-Ala"
FT   gene            complement(19141..19217)
FT                   /locus_tag="MPNE_0020"
FT   tRNA            complement(19141..19217)
FT                   /locus_tag="MPNE_0020"
FT                   /product="tRNA-Ile"
FT   gene            19311..21182
FT                   /locus_tag="MPNE_0021"
FT   CDS_pept        19311..21182
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0021"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87092"
FT                   /db_xref="GOA:A0A0H3DMW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMW2"
FT                   /protein_id="ADK87092.1"
FT                   /translation="MGLVLKQFNRKIRTALILAPLFTFAQIIIDLIIPSFLASAIAVVF
FT                   SIVTLKQKEASGEGVAVDFIAESKLSFQSVQEAQIVLATSVILLALFGLVFGLISIFCA
FT                   SIVAGNTSYFLRRKIFRKIMHITAPSHDQYGSSTLLVRLTNDVYLMEIMTFDFLRLIVR
FT                   APFLFIGGLAFAIATNSDMSISLAITFPLTFLVIGILNKKSTPLFKNNQKSVDQINERV
FT                   EEDVSGYKVVQSFNLKDTECLKFKAANARWTKSSTNSLFVNTLNIPFTFFFSSMTIIIA
FT                   LLLVFQLDNSVRVDPLPDNAAIRPSIFAFFQYNFYIVLGLILTSLTMVNFTRSRVALGR
FT                   IKDVLNKPEIQQHVVPDQTVLAPSLEFKNVAFGLGNKENRDFLQDLNFKFEAGKTYGIV
FT                   GPTGSGKSLIANIIGGLYEPNQGEIFVGGQSIKTIDSDYLAKMIGIVFQQNILFKGTIA
FT                   SNIKIGLETREDWKHEPDSKKDAAMKRAAAIACADTFIEKFSDTYDHTVEQLGKNLSGG
FT                   QKQRVAITRTVITKPQILVLDDSMSALDALTEKKVRENIANELPGTTKIIISQNINSIK
FT                   YAHKIMVIDNGRIAGFDSDAKLMQSCDIYVKMKQAQKDQGGDFDAVA"
FT   gene            21169..22998
FT                   /locus_tag="MPNE_0022"
FT   CDS_pept        21169..22998
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0022"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86965"
FT                   /db_xref="GOA:A0A0H3DMH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMH4"
FT                   /protein_id="ADK86965.1"
FT                   /translation="MLSHNQKPNSWKILWRLIKSVQGRTSSKVLYVMVCAIFGILTGVT
FT                   NSILLAQGLGFIFPTTNTETDGIQSVYLLVFAHNLPVMERLTIVCVTVVVAYILIFSFN
FT                   VAQNYLGLKLYQEICALLRWKAYLKIQSMSTSFFDTQNNGDLMSRLTNDVYNINNLYAQ
FT                   VGGQTIQSLFILMTTATILFVLSPVIALISLTVLIALIALSFLFLKKARAAYAKVQNNL
FT                   GDMSGYIEEVLSNHKVVHVLKLQEVMIDNFDKYNRPMVNPTIKANTYAVFIYSWFGFIS
FT                   NITYLASISIATAFSVNNIPSFGVSAINYSFMLSYIAALRQTALPLNQIFSLWNLIQLG
FT                   IVSGERVFKILDLESPQKQATITKLPNIKGNIRFEKVAFGYSADKPILTGIDFSVKHGD
FT                   IVAIVGPTGAGKSTIINLLMKFYKPFAGKIYMDNFEISEVSETAWREKISIVLQDPFLF
FT                   SGTIKENIRMGRQDATDEEIIEACKVANAHDFIMRLPQGYNTFISNKTDYLSVGERQLL
FT                   TIARAVIRNAPVLLLDEATSSIDVHSEKLIQQSIGRLMKDKTSFIISHRLSIIRNATLI
FT                   IVINDGKVLEMGNHEQLMRQNGFYARLKRSAVK"
FT   gene            23008..26100
FT                   /locus_tag="MPNE_0023"
FT   CDS_pept        23008..26100
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0023"
FT                   /product="SNF2 family N-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF00176;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04434; match to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86885"
FT                   /db_xref="GOA:A0A0H3DM89"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM89"
FT                   /protein_id="ADK86885.1"
FT                   /translation="MTIAEIRKFAQTTQKFVEAENLFEHGNVVLPKKYLNKARGMAEVL
FT                   YNSQVIKVSFTAKDGELTCKCSCLANVDNCVHIVAVLLKYHQMLVESKRSFNLAEAFHL
FT                   DCDQAEMLIENLSLEIIAGGWNFKLGFTINLDKHNPQPSVLRFYCCDATFVYFLHLEND
FT                   TLHSVELSKFKPEERATLLFFDKLCKQFTVGYDRNSLLFPLAGFLKELQANTEPTIFVF
FT                   NDDKIDNILFLRISKKHHGLNHVCGFSGKKVFDFVTYKQKEKQIVLRSAYLSKFTDFKF
FT                   PYTINIYKLQFGEPLFFHFLIQLKRDGFKNFYFQSEDSIVKEKEYLPKLYFKVEYDPVK
FT                   NKFVSDAFFKYKNHFNKGTTTVYPHRYYMAKKSDRGGFNRLLFYEEAVENFYQDQFDLG
FT                   YFRKFEHLPIQDKNQIEAFKAALDDLMPVDLAEVSLSDNLLHQKPLHFALSDLEAVAVD
FT                   DKQIKLSFAPSAVELKLIKRILSAYHKGNVVCIDQESWYDLKQPAAKELIQFWNQFDLR
FT                   NATSDGNHIYLPKYYLFEVAKIFSQYLDIKNLFDVPTIKKIEDQNNNVFDLSLEHKKIT
FT                   SLRNYQQEGVKWIRGLEENKFGGILADEMGLGKTVQVIFALLDSYLKNHVNLPSLIIVP
FT                   ASLLLNWKSEFEKFAPQIKVKVANIPSKERGELYEKLTNEILIVSFNVLRSDVKLITKQ
FT                   RFHYVVIDEAQGIKNDSSSITKAAKKVKGNFCLALTGTPIENRLLDLWSCFDFVLPSFL
FT                   GNKKQFTDQFEKEKTDQSFHLLMQRTSPFILRRTKSKVLKELPNKITTDIYVELNPMHQ
FT                   KLYEEERDRGLEEIKQIQDKSSFNILTLILKLRHLCSLPKNSQGILENSAKKEAALEII
FT                   HEAIENQRKIILFTQFIDVIDHFKDTFKEQGIEYFIFDGRKSPKSRHSIIEKFNNAKNP
FT                   CVLLASLKAGGVGINLTAAEVVIHFDVWWNTAVENQATDRAHRIGQKKTVQVYRIIAKN
FT                   TIEERVCQVQAEKQELVSKTLVEDVNFFESLTNEELLRLFE"
FT   gene            26146..27318
FT                   /locus_tag="MPNE_0024"
FT   CDS_pept        26146..27318
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0024"
FT                   /product="putative chaperone protein DnaJ"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF00684; match to protein
FT                   family HMM PF01556"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87080"
FT                   /db_xref="GOA:A0A0H3DL12"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL12"
FT                   /protein_id="ADK87080.1"
FT                   /translation="MAAGKRDYYEVLGVSRSATAQDIKRAFRKLAMQYHPDRHKGEGET
FT                   VQKQNEEKFKEVNEAYEVLSDTEKRGMYDRFGHEGLNASGFHETGFNPFDIFNSVFGEG
FT                   FSFDMDGGSPFDFIFSRGKKSRQNRVVLPYDLEIAVGVDISFFEMTNGCTRTIEYTKRV
FT                   TCSACDGFGAEGGETGMVSCNSCEGNGFILKNQRSIFGTVQSQMLCQSCGGQGKQAKHK
FT                   CKTCKGSKYKKVPTTKEIQIPAGIYHGDALVDDHGGNEFGGHVGKLVVHVGVLPSKIFK
FT                   RVDHNVVANVLVDPMIAITGGKIELPTLEGIKEFNLRAGTKSGEQIVIPGGGIKFTKNF
FT                   RKKAGDLIIIISYARPSEYSAPELRKLKEFIKPNQEVKQYLNALKNEYKS"
FT   gene            27302..28231
FT                   /gene="pip"
FT                   /locus_tag="MPNE_0025"
FT   CDS_pept        27302..28231
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pip"
FT                   /locus_tag="MPNE_0025"
FT                   /product="prolyl aminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM TIGR01249"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87053"
FT                   /db_xref="GOA:A0A0H3DPB6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPB6"
FT                   /protein_id="ADK87053.1"
FT                   /translation="MNTSPKQSGYLKVGNGHEVYFWTAGNPQGKSALYVHGGPGSGTDA
FT                   GCLKYFDLDTTYVILLDQRGCGQSKAVNPLLHNTTQDLVGDLEALRQHLKLERWTLFGG
FT                   SWGSTLALVYAITHPQVVEQVFLRALFLGREQDWAEMLLGLGKLFYPYEHQTLLKAIPQ
FT                   ACRTDFTKFTNYFYEVLQGNDSALKTQLANAWVKWENTLLSPISYVKDEKAEDANFTFK
FT                   LALLECHYAKHHSFLKPNFILENVAVLKDKPVHLIHGRFDLVCPLSQALELKRALPTLN
FT                   LYVTNNAGHSGSDPNNLTTIKHLLKTQL"
FT   gene            28231..29769
FT                   /gene="metG"
FT                   /locus_tag="MPNE_0026"
FT   CDS_pept        28231..29769
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="metG"
FT                   /locus_tag="MPNE_0026"
FT                   /product="methionine--tRNA ligase"
FT                   /EC_number="6.1.1.10"
FT                   /note="identified by match to protein family HMM PF09334;
FT                   match to protein family HMM TIGR00398"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87265"
FT                   /db_xref="GOA:A0A0H3DLJ6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLJ6"
FT                   /protein_id="ADK87265.1"
FT                   /translation="MKRCYITTPIYYASGKPHIGHAFTTILADVIKRYKQQNGYEAYFL
FT                   TGTDEHGNKIESKAKSLGLDPQTFVDQNVAYFQQMWKQLDINFDHFIRTTDLSHKAQVQ
FT                   QAFQLLYDKGLIYQSNWEGAYCVECEQNYFTYDKQTMLCEIGHQLTLVQEPSLFIAFKD
FT                   SKDWIGEMIATNKLNITPESRAAELKNNFLDGGLNDLALTRQNVTWGIPVPFDNKQTIY
FT                   VWFDALFNYITNLGFAHNDPKFNKWWNNNDEEHEVIHLISREITRFHCIYWPIFLHQLG
FT                   FKLPTQFLSHGWIVDGNGHKMSKSLGNVISPEELLAQFGVDGTRYCLLKEMRLDKDNRC
FT                   SMAIFKDIYNADLANSFGNHASRTFGMIKKYLGGQLDFIEVQDPQVKQLMDQADQAMVQ
FT                   FDTAWNNFQFYKGINGLLQLVFQASKLIDQLKPWELVKQTDYTLLKQLLFACVRCTQVC
FT                   FVLLAPILVHTSTQIFDLFNFSAQARSKTHLADPQQLQKISLAPVIQLLFKRLD"
FT   gene            29796..30230
FT                   /gene="rpoE"
FT                   /locus_tag="MPNE_0027"
FT   CDS_pept        29796..30230
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpoE"
FT                   /locus_tag="MPNE_0027"
FT                   /product="DNA-directed RNA polymerase, delta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF05066"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86759"
FT                   /db_xref="GOA:A0A0H3DKJ6"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR029757"
FT                   /db_xref="InterPro:IPR038087"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKJ6"
FT                   /protein_id="ADK86759.1"
FT                   /translation="MQVEYLDLISQAKEIAETQFKAEPFSFDAIWKEVVKHFKISKQDE
FT                   PNLISRFYQDFLEDPNFVYLGERNWKLRDFMKFDEWNKISQAMFVTKEIFEEGYEDLSN
FT                   KKKENEEEVNDFIMGNDGDDNSTGDEIVQGLINDFRDDNQ"
FT   gene            30230..31096
FT                   /gene="fba"
FT                   /locus_tag="MPNE_0028"
FT   CDS_pept        30230..31096
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="fba"
FT                   /locus_tag="MPNE_0028"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167; match to protein
FT                   family HMM TIGR01859"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86662"
FT                   /db_xref="GOA:A0A0H3DJS0"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DJS0"
FT                   /protein_id="ADK86662.1"
FT                   /translation="MLVNIKQMLQHAKQHHYAVPHININNYEWAKAVLTAAQQAKSPII
FT                   VSTSEGALKYMSGHQVVVPMVKGLVDALKITVPVALHLDHGSYEGCKAALQAGFSSIMF
FT                   DGSHLPFQENFTKSKELIELAKQTNASVELEVGTLGGEEDGIVGQGELANIEECKQIAT
FT                   LKPDALAAGIGNIHGLYPDNWKGLNYELIEAIAKATNLPLVLHGGSGIPEADVKKAIGL
FT                   GISKLNINTECQLAFAKAIREYVEAKKDLDTHNKGYDPRKLLKSPTQAIVDCCLEKMQL
FT                   CGSTNKA"
FT   gene            31097..32197
FT                   /gene="ychF"
FT                   /locus_tag="MPNE_0030"
FT   CDS_pept        31097..32197
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ychF"
FT                   /locus_tag="MPNE_0030"
FT                   /product="GTP-binding protein YchF"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF06071; match to protein
FT                   family HMM TIGR00092"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86877"
FT                   /db_xref="GOA:A0A0H3DNU1"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNU1"
FT                   /protein_id="ADK86877.1"
FT                   /translation="MLSAGIVGLPNVGKSTLFSAITNLQVEIANYPFATIEPNAGIVNV
FT                   IDERLDKLASLIKPDKVTHTTFRFVDIAGLVKGASKGEGLGNQFLANIREVDLICHVVR
FT                   CYEDKKIVHVNNQVDPVFDFEIIVNELIQADIEVVNTRIGKIKRKAESGDKQSKEEYQL
FT                   LAPVLQGLQQNQMVLHLVNEVDLKKLKSLNLLTAKPILVVANVSEADLSNLDHNPHLTQ
FT                   LNQFLKQHNLPHAIPVCALLENELSSLDANGRQDWLKELGLSDYQGLNQLIKTAYDAIG
FT                   LWSFFTFGKQEVRAWAFKKGWLAPQCAGEIHTDFERGFIKVEVISWNQLYELKSLQEAK
FT                   KQGLVRLEGKAYVMQDGDVCHFKFNV"
FT   gene            complement(32187..33011)
FT                   /locus_tag="MPNE_0029"
FT   CDS_pept        complement(32187..33011)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86979"
FT                   /db_xref="GOA:A0A0H3DL61"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL61"
FT                   /protein_id="ADK86979.1"
FT                   /translation="MDKNTILEFCFFGDRYQLMALKNPNKLVKNKQVKAAFNVFMKHRT
FT                   TLSATNYMAQIVENFEQFLEYIHDKLQPGKLLALLFKNKQFLGWFCVGQWGNMPVLSFW
FT                   IDPSQQQSGVALETISFFLKYYQRTLQPRELVWSFYESNQRSRHLANKLGFPSLFYFKK
FT                   AEPNAPKVYFGTKDFKGESVIETKPYLGWGSGWKVNQMLKPTKNLTVNLINIGFDAYSD
FT                   SQKALLAWFKTHKLTKGQVEVFFNYELCCLCISYNHKQSWVVYSFQQLLAKR"
FT   gene            33044..33943
FT                   /locus_tag="MPNE_0031"
FT   CDS_pept        33044..33943
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0031"
FT                   /product="glycosyltransferase, group 2 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87110"
FT                   /db_xref="GOA:A0A0H3DL46"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL46"
FT                   /protein_id="ADK87110.1"
FT                   /translation="MQFKYLFTVIIPTYNCGQYIPKALDSLLLQGEYFTKTQVLIVNDG
FT                   STDNTKQIVEPYTQQYSNIEYLEKPNGNWGSVVNFVKQNQLAKGQYITVLDSDDYFLAN
FT                   AFQRVAAHFGHDMIVSAFYCYISPKRRRFLKPYFGKTGVIEQKTKLRTPHSQPLAKFYR
FT                   HEIFNLLDPLKEKLFYQDCLLYHNAINKVQSVFYICEPLAVWYATRPGNSTTMPWNNAD
FT                   KFQAWCDLLKQMNLYGAGIVIYIYTMLPGFLKELKRQQLVLDLAKKPAYTWLPQPLAFL
FT                   FGGLMALRTRKYIRYPKN"
FT   gene            33964..34536
FT                   /gene="efp"
FT                   /locus_tag="MPNE_0032"
FT   CDS_pept        33964..34536
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="efp"
FT                   /locus_tag="MPNE_0032"
FT                   /product="translation elongation factor P"
FT                   /note="identified by match to protein family HMM PF01132;
FT                   match to protein family HMM PF08207; match to protein
FT                   family HMM PF09285; match to protein family HMM TIGR00038"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87021"
FT                   /db_xref="GOA:A0A0H3DMN2"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMN2"
FT                   /protein_id="ADK87021.1"
FT                   /translation="MADMIEAKSLRSGQTIFGPNKEILLVLENTFNKTAMRQGIVKTKV
FT                   KNLRTGAIVWIEFTGDKLEQVIIDKKKMTFLYKDGANYVFMDQQDYSQIEIPEKQLEWE
FT                   KNFITEDSEVTIISYQSEILGVNLPELVPIEVEFAEEAVQGNTANMARKRARLVSGYEL
FT                   DVPQFIRTGDKIVISTIDGSYRERYNK"
FT   gene            34517..34960
FT                   /locus_tag="MPNE_0033"
FT   CDS_pept        34517..34960
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09185"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87228"
FT                   /db_xref="InterPro:IPR015268"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNE6"
FT                   /protein_id="ADK87228.1"
FT                   /translation="MNGTTSKLTRTQRRIAIVEFIFATLFFLPKTADQIQAAFLDYDVP
FT                   ERPLNDWQKEIVKVFSERCVEFIELIENQQQRNQAEVQSKYNKVSGKKVDLLTKAVILC
FT                   ALSEQHAQATDKPLLISEALLIMDHYSQVPEKKQTHALLDKLL"
FT   gene            34960..35571
FT                   /locus_tag="MPNE_0034"
FT   CDS_pept        34960..35571
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87139"
FT                   /db_xref="GOA:A0A0H3DPM4"
FT                   /db_xref="InterPro:IPR035217"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPM4"
FT                   /protein_id="ADK87139.1"
FT                   /translation="MRRNWREHYNVFVANLALVLGFMLNIVVARYTLTGATPQARFLFL
FT                   TPFLGIVAASIFYFFDVKWFLADYPYKKFHFQKKWTWTYLSGVFVFFANILVNVILLAL
FT                   LVNQMTNQILSEKYTGLLDNAYPLLWSAVGVSIFLSLISIGLSKTAHFKIDVEMLKAKK
FT                   GEPTAADKTDSRPVVVDLDQTKSKKDGDNPPQASGDMTSL"
FT   gene            complement(35795..36121)
FT                   /locus_tag="MPNE_0035"
FT   CDS_pept        complement(35795..36121)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86907"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNX2"
FT                   /protein_id="ADK86907.1"
FT                   /translation="MKKLLVIVYPDMNDVEYTNTMVVFGFVKELQTVIYHPNLSTVKGS
FT                   NGVTLVNQITSKVNLEEFDGVFIPGGMGATKVLDHDQQLLDTIRYFKDHDKYVFAICDT
FT                   PNVL"
FT   gene            complement(36125..36745)
FT                   /gene="upp"
FT                   /locus_tag="MPNE_0036"
FT   CDS_pept        complement(36125..36745)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="upp"
FT                   /locus_tag="MPNE_0036"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01091"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86664"
FT                   /db_xref="GOA:A0A0H3DLJ9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLJ9"
FT                   /protein_id="ADK86664.1"
FT                   /translation="MIKKVHHALIENELTKLRDKSSSSSQFRMALSQITSLLFFEVTKE
FT                   SPLEEIVVKTPFTKTKGYKLKNEIVLVPIMRAGLGMVDPIVRYSEKIRVGHLGIYREHE
FT                   GTNVISYYKKMPENIGNSHVIILDPMLATGTTLATAISSIKKNHPIKISVVAIVAAPEG
FT                   IKAVEAAHPDVDIYLAAIDEKLNKDNYIIPGLGDAGDRLFGTK"
FT   gene            complement(36785..41116)
FT                   /gene="polC"
FT                   /locus_tag="MPNE_0037"
FT   CDS_pept        complement(36785..41116)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="polC"
FT                   /locus_tag="MPNE_0037"
FT                   /product="DNA polymerase III, alpha subunit, Gram-positive
FT                   type"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00929;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM PF02811; match to protein family HMM PF07733;
FT                   match to protein family HMM TIGR00573; match to protein
FT                   family HMM TIGR01405"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86793"
FT                   /db_xref="GOA:A0A0H3DK82"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006308"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK82"
FT                   /protein_id="ADK86793.1"
FT                   /translation="MVFDTETEKGKRILALSQFLVKKNILDHNELHQLNNRIELVYLEN
FT                   DRENALFLVALTLKKPLTIDIWNALYEGFQDVEGAELRITFQEDATFFKDGSTKSSVTL
FT                   AIIKDYFKSFFGKDKKYRILLEQELTHPNFLSYSNHELKANCQSQELDQWLIEQRQAFI
FT                   KWMHQAGFTHFGFVSLFNPPAEKQLKVKSMKVSKYDKQFETEVFSTEFVPIHKINQQMD
FT                   EIKLMGQIFELKDFPGYNNLRNTLNIYVTDFQLGGSLILKWFYKDPKTIEGIKIGTWVK
FT                   ATVKVERDAKTQLLQGIIKEISPIETPAYYRRPDQDKQKRVELVFHTKMSAFDGINSVQ
FT                   EYAQFAKERDWKTIAVTDKDNIHIYPTLYEVAKKYGLKAIYGLECNLIDDHIKIVSNPD
FT                   KTKLKDATFVIFDIETTGLHGRYDSVIEFAGIKVKHNREVERMQFFLKIDGPLPAAVTE
FT                   ITKITQAQLEDGMEQQAGLEKLRAWLDGCVMVAHNGLSFDLPFLQTQFEKYNIAPLTNP
FT                   LIDTLALSWALNPGFASHTLSNICAKLKFDFDDERLHRADYDTQALKKVFDYFKEQVEL
FT                   MGITNLEQLDQELNQQCHFELLKRTFTNTGIIYIKSQSGFAKLYELLSIALTDNNATRP
FT                   LVLTSTLQKFAKSFVITDNPVQGDIFKAALTKPLKELEAAIKRVDFVLIAPPDAYAGYT
FT                   IREGLKKEAIPNAIKLVVDTAQRLNKLVAVASDAYFIHPWENEYYKAIVCAKGLGGRWH
FT                   RHFNYKEREQRVPNVFVRTTGEMLNEMSFLGEQLAYELVVKNTNKLAKQLTADDLVPVQ
FT                   TKLQPPVIEGSNENLAAKTWSQAKAIYGDPLPKLIEQRIQEELKAIIDNGFGIIYWISH
FT                   LLVKQSVQDGYFVGPRGSIGSSLVANLIGISEINPLVPHYLCESCQYFEVNEEVDDGYD
FT                   LMVRDCPKCGAKAAFKGDGHNIPFATFMGFAGDKIPDIDLNFSSEYQAKAHAYVRELFG
FT                   EQYTFRAGTIATVAEKTAYGYARNYFEIIKQTELATAPEIERFKQKLVGIKRTTGQHPG
FT                   GIMIFPNHKSVYEFTPCGYPADDTSSDWKTTHFEYDALGDTILKLDILGQDDPTMLKHL
FT                   ADLTHVNPQNIPRFDKKLTEMFWSVNPLKLKPHYLDEPTGAIGIPEFGTKFVRKILEQT
FT                   KPKGFGDLIRVSGLSHGKNVWADNAQKILKDQNLSLKDVIACRDDIMLYLIHKGMQAKD
FT                   AFEIMEKVRKGIALNAKEVQLMQSNGVEQHWINSCLKISYLFPKAHAAAYVLMAWRIAW
FT                   FKLYHPLSYYACLLSFKLKEHDVSGFKSGVSFVKQKLEELNTLYRIKRIKPKEAELLTS
FT                   YEVYLEMMARGIKLEQISLTHSHATRFVEHNGMLIAPFITIPGMGEAVANSIIEARNEK
FT                   PFSSLDDFKKRTKITKKHIEAFTQMQLLDEFREQDNQKKLF"
FT   gene            41394..43394
FT                   /locus_tag="MPNE_0038"
FT   CDS_pept        41394..43394
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0038"
FT                   /product="MG032/MG096/MG288 family 2"
FT                   /note="identified by match to protein family HMM PF03072;
FT                   match to protein family HMM PF03086"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87198"
FT                   /db_xref="InterPro:IPR004306"
FT                   /db_xref="InterPro:IPR004319"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNC9"
FT                   /protein_id="ADK87198.1"
FT                   /translation="MKAFRKLLLGLALPTTIGPLLGLLLTNTDTVKNESLTTVRHRSSI
FT                   NQDFDGIFHTVKLLEPIQQSNADPAASFALFQQKFPNLKRVANSTLNTFDVYNLLSGWK
FT                   SSLTAYLNQVLALQQRIKAADQIFPNQKETLPKDENPNIFEVLGAYGGKGFFPTLGSNG
FT                   LHLPPQLFQFFRDFQLSSFTIKDFEVALVSEPDIVQHDKVRYAFQVQFNLVLQLQINRN
FT                   PVLFDFNLQLKTNNFANQTSFDELFNEKTNPLNWQFFSKLKVNHLVYEGNDITQLANTL
FT                   LQSQFNVLQLDLNKSIYRLNLNAMAQRFEHDWVQPLYAKRTQAKIAYEAEQARIAAENK
FT                   RKELERQKLLAELKAKAEHYQKIKQARENMLKGLKSITDFVKFWKSPDRLLVGFNKQDD
FT                   ITTRAGVYKALQIAYANYPQWTFYLTLQGWKNGSELLLKRPSWTNLLSDIHFQKAFNLK
FT                   NTVSEQTLGAATLPGYGYYGLRMSDWLRWALGYYSYIHMGVPQNVQTKFTGTPDNEQQV
FT                   WIANEPFEWNKHYGVGPKYKDKAYRFNMEISFELEGWIAVKWWAWAFKGSIPGNWKGKL
FT                   KVTHLFDGMVPVWELGPVNTHLPQYSFTDQQQLLFVPHSIQKIEAIGADKGINDLLKTQ
FT                   NLHNLERLSYESTNPIDLISYLLYAIQYIKV"
FT   gene            43566..45587
FT                   /locus_tag="MPNE_0039"
FT   CDS_pept        43566..45587
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0039"
FT                   /product="MG032/MG096/MG288 family 2"
FT                   /note="identified by match to protein family HMM PF03072;
FT                   match to protein family HMM PF03086"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87258"
FT                   /db_xref="InterPro:IPR004306"
FT                   /db_xref="InterPro:IPR004319"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNK1"
FT                   /protein_id="ADK87258.1"
FT                   /translation="MKTLHKLLLGLSLPAILGPLFGLLVTKTDAESPVAALHKSKSFSK
FT                   NLDSFRALFVGEDIEEQLAKVQQQTPEVSFASFQQKFPDKASLRNGFQPIDVYNFLSGW
FT                   KGALENFLAKVVELQKKIKAADDIFPNQKKNPDKKDNPNVLEVLGEYGGDGFFPTLGNN
FT                   GLNIPDQVFQSFNNFQIENYKISDFKVDIASERDIVQHDKFRFSYVVNIGLELALLVNK
FT                   RPVYFNFSLDLRTNNFSNQAGFNEIFNAPGNAATNWQFFSKIKVKQLNYDGNDSTHLAN
FT                   TLLQDQFNTLNLNLQKSIYELPLTEMETKFQQEYVELLLAKRREEKRLWDEEQKRIEAE
FT                   RKQKEAELAQIQRELKEKAEKDAAVKQAQTNLKTALSSVEGFVKFWTEGEDRIKLGFTK
FT                   EDNLYTRAGLVKALKISFANYRAWTFYITLLGWKAGSEKLLRKTSWTNLLSDVNFQNAF
FT                   GLKNTASEEQVGKTSLPGYGYYGIRMSNWLRWALGYYANTHAGSPQNVKATIDGNPSDT
FT                   TKVWIAPEDFKQGVHIGVGEHFKGKAYKFKFEVSFELEGSIAAHWWTLALRGNIPGYWK
FT                   GKLQVTHTFDGDVPSWYYGSVHTHAPEYRFTEDNKLLFVPHSIQKITAVGGDSNGVNGL
FT                   LKSQNLHNLERQSYEVTAPIDLVSYLMFAIAKEPTNNW"
FT   gene            complement(45721..46053)
FT                   /pseudo
FT                   /locus_tag="MPNE_0040"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01519"
FT   gene            complement(46163..46279)
FT                   /locus_tag="MPNE_0041"
FT   CDS_pept        complement(46163..46279)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0041"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86848"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKE0"
FT                   /protein_id="ADK86848.1"
FT                   /translation="MHRNNFAYWSIKQLILVDNKVAISSYFLNFTEKKGGMA"
FT   gene            complement(46427..46669)
FT                   /locus_tag="MPNE_0042"
FT   CDS_pept        complement(46427..46669)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87154"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPN9"
FT                   /protein_id="ADK87154.1"
FT                   /translation="MEKGKSGYVTHKQLDKKLEVFKQDLLVELSEKFVTKEEFRAQGKQ
FT                   IKELQIEQKAQGKTLQLILEALQGINKRLDKLESK"
FT   gene            complement(46816..46935)
FT                   /pseudo
FT                   /locus_tag="MPNE_0043"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            47179..48195
FT                   /locus_tag="MPNE_0044"
FT   CDS_pept        47179..48195
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0044"
FT                   /product="MG032/MG096/MG288 family 2"
FT                   /note="identified by match to protein family HMM PF03086"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86986"
FT                   /db_xref="InterPro:IPR004319"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMM6"
FT                   /protein_id="ADK86986.1"
FT                   /translation="MTKLPKLLLGLTFSVSLIPFSSLLITSTDVNKQPVPTALQRTGAS
FT                   AIHEGSFQTITLGQSLMEQIEQLQQFTPAQRFTQFKKKFPNQKLLSQSELSPVDVYNFL
FT                   SGWQGALVSFLDRVIKLQGKVKEANEIFNPNVGDQIVLPKKENPNVLEVLGEYNGFGFF
FT                   PTLGKNGLNLPQQIFENFTDFKVESYQINDFKVSLVGERDIIKNDKVRFSYAVQIPLNL
FT                   ELLVNNQKVTFNITVDLRTNNFSTQETFNDLFNNGTAPTNWQFFSRIKVNKLHYDQTDA
FT                   THLANTLLQDQFNALNLDLQKSIYDLNLDGLEERFEEEYAKPLREKRTQQKKEWEEE"
FT   gene            48655..49215
FT                   /locus_tag="MPNE_0045"
FT   CDS_pept        48655..49215
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0045"
FT                   /product="MG032/MG096/MG288 family 1"
FT                   /note="identified by match to protein family HMM PF03072"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86811"
FT                   /db_xref="InterPro:IPR004306"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM50"
FT                   /protein_id="ADK86811.1"
FT                   /translation="MREAIDKYATYSVSRPNNVTTYLPGKVDGSGKDQIWISPNNFQVN
FT                   REWGNGAHFKDKAYRFNFDVKVEYDVEVKAAWWTALFRGSIPGYWKGKFKVTYSFNVEV
FT                   PSWNYGDKQVRPPQYSFKEQEKQLLFVPRHVQKIEAEGKHLEIINPFLKDQHLDFFEHY
FT                   HPDLTQPLDMVSYLMYAIADKVK"
FT   gene            49277..51295
FT                   /locus_tag="MPNE_0046"
FT   CDS_pept        49277..51295
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0046"
FT                   /product="MG032/MG096/MG288 family 2"
FT                   /note="identified by match to protein family HMM PF03072"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87077"
FT                   /db_xref="InterPro:IPR004306"
FT                   /db_xref="InterPro:IPR004319"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMX2"
FT                   /protein_id="ADK87077.1"
FT                   /translation="MKKLHKILLGLSLPASLAPLSGFISTDADNSQFSLKKSSTEIKGT
FT                   QSIHLLNLGESLTEEIKEAQKRTPETSFASFKQKFPNKESFVKGFQPIDVYNLLSGWKD
FT                   AISSFLDKVVELQKKIEEANKIFNTNIGNQIDLPEDENPNVLNVLGSYGGEGFFPALGK
FT                   NGLNLPQQIFENFTDFKVVSHKIHDFQVSLVGERDIIKNDKVRFSYAVQIPLNLELLVN
FT                   NQKVTFNITVDLRTNNFSTQETFNELFNKCIGPVNWQFFSRVKVDKLHYDQTDATHLAN
FT                   TLLQDQFNALNLDLEKSIYDLELPRLEAEFQQKYVDPLIEKKQRQKAEWEEAERIRKEE
FT                   EEKHQKELEEQQRIQAEKAKNDEQLRKAQTELKKALGGIDSFVEFFTNNDLRLKLGYTK
FT                   EDNVRTRAGLFRALEVSFGNYRAWTFYITLLGWKDTTEKIFKKAKWQDIRDDEKFRKAF
FT                   GLSPKATEKDVGKVTNPGYGYQGIYIKDSLRDGIAKYSDSTVSEPKNVKVSLPGTVGDN
FT                   EEGKIWIASHNFRQNHEWGAGEKFKYSAYRFKFDVTVDYDVEVSAKWWTWAFRGSIPGY
FT                   WRGKFKVTYSFDGVVPSWKYGHIQVRTPQYSFNKQEQKILFVPHAIQKIAAEGSNLDLI
FT                   NPFLKDQKLDEFEHYHPDLTKPLDLVAYLLYAITTRS"
FT   gene            51619..52413
FT                   /locus_tag="MPNE_0048"
FT   CDS_pept        51619..52413
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0048"
FT                   /product="transporter, major intrinsic protein (MIP) family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00230"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86916"
FT                   /db_xref="GOA:A0A0H3DME8"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DME8"
FT                   /protein_id="ADK86916.1"
FT                   /translation="MFNLSDFSELPRWIGAEFLGTFFLILLGNGAGSQLTLNKMFVKES
FT                   KAKLLTAAFAWGIAVLVGVLIANSLFEGAGNINPAVSLFYAVSGTIQKALYPLHVNFSI
FT                   PLLWVALLLAWVAQFAGAMLAQALLNFLFWKHIEQTDPQSVLVTHCTNPAIFNIPRNFA
FT                   TEFVATSVLIASLLVAGSFGANRFDQSPRGVVPMLVVTGLIMSFGAATGTAINPARDLG
FT                   PRIVYWLSPIKNKDPNLKYSWIPVAAPLSASVILGVLVAVIV"
FT   gene            complement(52384..53058)
FT                   /gene="tdk"
FT                   /locus_tag="MPNE_0047"
FT   CDS_pept        complement(52384..53058)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tdk"
FT                   /locus_tag="MPNE_0047"
FT                   /product="thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="identified by match to protein family HMM PF00265"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86806"
FT                   /db_xref="GOA:A0A0H3DM44"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM44"
FT                   /protein_id="ADK86806.1"
FT                   /translation="MFNYNWATMSFSQVFHQSPRGWIEVICGPMFSGKTEELLRKIKRW
FT                   KLAKIPVIIFKPKIDTRQQHLVKSRNGHSDEAIEINSPLEIYDYLTKDRFDVVAIDEAQ
FT                   FFSSEIVEVVKSLNDLGINVIVSGLDTDFRAEPFGSIPQLLAIADKICKLDAVCNVCGQ
FT                   LAQRTQRIVSKSNETVLIGDIEAYEPRCKLHHHVQGKPVTVKTKQFKERFKELNDNSHK
FT                   HT"
FT   gene            53061..54305
FT                   /gene="hisS"
FT                   /locus_tag="MPNE_0049"
FT   CDS_pept        53061..54305
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="hisS"
FT                   /locus_tag="MPNE_0049"
FT                   /product="histidine--tRNA ligase"
FT                   /EC_number="6.1.1.21"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM TIGR00442"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87229"
FT                   /db_xref="GOA:A0A0H3DPZ8"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPZ8"
FT                   /protein_id="ADK87229.1"
FT                   /translation="MSVLQKPRGVKDWYGEELIYFNWTVHQITNLAWKWGFSEVKTPLL
FT                   EYAEAFKRTNANADIVKKELYEFHDKSNRLLALRPEATAGIVRLVCENKLLQPQNYPLR
FT                   LFTIGTMYRYERPQSNRYREHYQFSCEVIGDTNPTVLLDTLLLGHAIIQQLGIEGVILK
FT                   LNNLGNSATIQQWNQALQAYLTQFKAQLTELSQSRLSTNPLRILDDKVDGQLPFISDAP
FT                   QIEQFLDAEQQALNTWLQQQLTQQQVPFEWNPTLVRGLDYYTGVVFEFVKDDTTVLAGG
FT                   VYDNLVEELGGTPTKALGFACGIERSINCLSAVKKQAILANQPPRLLVIGLTEAALEKL
FT                   LQLSLGWRAYHPVTIYPKVIRIINGIRAAQRLGYRFLGVIGGNNLEQQTITVKDLATEQ
FT                   QTTYTWDEFRQRQVL"
FT   gene            54277..55950
FT                   /gene="aspS"
FT                   /locus_tag="MPNE_0050"
FT   CDS_pept        54277..55950
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="aspS"
FT                   /locus_tag="MPNE_0050"
FT                   /product="aspartate--tRNA ligase"
FT                   /EC_number="6.1.1.12"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00459"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86802"
FT                   /db_xref="GOA:A0A0H3DNM2"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNM2"
FT                   /protein_id="ADK86802.1"
FT                   /translation="MNLDNAKCFKQRVFIGNLTSEHLNKTVTIAGWVKRIKKLGELNFV
FT                   IVGDKTNTIQVTCKNKEQVKYLTREDLVIVKGKLKRLDSVRFEITNPTITLFAKSKTPP
FT                   LIIEDKTDALEEVRLRYRYLDLRRPVMQKRLALRHKVTLAVRNWLDQMGFIEVETPTLT
FT                   KSTPEGARDFLVPARIREHSFYALPQSPQIYKQLLMVGGTEKYFQIAHVYRDEDSRKDR
FT                   QPEHTQIDLEVAFYTKEMVMDLIQRLFVDVFRQVLNIKLKKPFPVLKFAEAFNRFGSDK
FT                   PDLRYGFELEDCTDLFQDSPNQFTNLINAGGIVGGIQLPNLYLDEVSFKALRKLAKDNG
FT                   VSLEFYSDKASSLKQPLDLPLAGTILLVAHKSKTQAWTALGAIRNELKYHLNLVKPNQY
FT                   SFCWIVDFPLYEFDEKEQKWVSAHNMFSNPQPQWLVNFENHKAEALSEQYDLVLNGFEL
FT                   GSGSIRIHDPEVQTRLMQSLGVDPQQFGFVMEAYQYGAPVHAGMGLGLDRLMMIINNVD
FT                   NIREVMAFPKNAQGIEMHTNAPDQVDIKDITTIWSKHPVK"
FT   gene            55926..57281
FT                   /gene="pncB"
FT                   /locus_tag="MPNE_0051"
FT   CDS_pept        55926..57281
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pncB"
FT                   /locus_tag="MPNE_0051"
FT                   /product="nicotinate phosphoribosyltransferase (NAPRTase)
FT                   family protein"
FT                   /EC_number="6.3.4.21"
FT                   /note="identified by match to protein family HMM PF04095"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87082"
FT                   /db_xref="GOA:A0A0H3DMU8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016471"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041529"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMU8"
FT                   /protein_id="ADK87082.1"
FT                   /translation="MVQTPSEINTHLKHLLACDAYKLSHRLMYPNDTTNLYSCLTARGG
FT                   RGGFPNFVWNHEFAKKIILEVFGNFCDSVLAVQNDPGLAQALTDKVTTVFGDPQFGLEF
FT                   TQHICYLANFLKQHHQLPLTVKIHQSSEGLAFRTPLVTITGSDQMVPELVWLVNYFETV
FT                   LLENIWLYQTTLTVAQSLKLLLERYANETADNTEFTHFQCHDFSMRGMSSLQSALYVAN
FT                   AHLQYFSGSDTILGGVAAKSILASEHSVMCADGQEGELNTFKRLLEQFPNKNLSLVIDS
FT                   YDMWHVLDNILPQLKDLVLQRQEKLYLRPDSGNFETLICQGKRFNPEDKTTWGVIDYLD
FT                   YHFGSTVNQKGYKVLNQKLGIVYGDGITYERIEYILEQLKQRGFCSSNIVFGVGSTTYQ
FT                   NLNRDTLGFVYKLTAIKKGNTWHDVTKSPITDPTKQSIGGRFDNPNLIQVYG"
FT   gene            57586..59343
FT                   /pseudo
FT                   /locus_tag="MPNE_0052"
FT                   /note="MG032/MG096/MG288 family 2; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF03072; match to
FT                   protein family HMM PF03086"
FT   gene            59294..59428
FT                   /pseudo
FT                   /locus_tag="MPNE_0053"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            59605..61503
FT                   /locus_tag="MPNE_0054"
FT   CDS_pept        59605..61503
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0054"
FT                   /product="MG032/MG096/MG288 family 2"
FT                   /note="identified by match to protein family HMM PF03072;
FT                   match to protein family HMM PF03086"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87068"
FT                   /db_xref="InterPro:IPR004306"
FT                   /db_xref="InterPro:IPR004319"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPD6"
FT                   /protein_id="ADK87068.1"
FT                   /translation="MRFRYKAFLLTLFASTTTLTGFIIPTLSQHGSSTDPSFVALRNNS
FT                   SLSCDGKSRLLEFGNDLGFSKEETDVLAKQKNWEQNYTNFKKQFEHKLLDPKSFSLTDV
FT                   YNLFSGFQQSVADTVKLMNELQTQVNKANDIYPVESFQVPKVPQKLFGFVDQGFFPKLN
FT                   PKGLNIADNVAYLFEKYSLKQATLKDFDIVLEKKNDIVLEHKVRYNFALQFHFETTYIG
FT                   SGGEINLQFALQASTTNFSSLEELQASFSKVGNNLTAQLFWKPVVTKLTSGENDLTHIA
FT                   QTAVGESLFDSRVDLTSSIINNEAAIKTTQQQFETEALALFKAEREKALAEYKAEQERI
FT                   AKELEEQRKELERLKKEQQNKQELVESLYNVANFVSYWEKRGKDVTDKKQLIQALKSAF
FT                   ATNWNEVFQLLTAGMREGIKEYYKHNKPDQSANAKKAFGQNGLAFPRTGFDGIYMSDWL
FT                   RGELRNKGNINLHLKQNETTVKKIRDDISIEWNESKGGIEFHQTYPYWFEFEVNFKYIG
FT                   GYSLNWWDAIWAKVAGIPGSWKGEMNLKLVIDGEIHKWMVTKPDYPGTFFPFDDQFDKL
FT                   WFTLHVSQEISVRDESFMNLLKKQGLDKLDLRTGSTKPPVVDLASYLHYLILADKS"
FT   gene            complement(61963..63489)
FT                   /gene="glpK"
FT                   /locus_tag="MPNE_0055"
FT   CDS_pept        complement(61963..63489)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="glpK"
FT                   /locus_tag="MPNE_0055"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782; match to protein
FT                   family HMM TIGR01311"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87152"
FT                   /db_xref="GOA:A0A0H3DN52"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN52"
FT                   /protein_id="ADK87152.1"
FT                   /translation="MDLKQQYILAIDEGTSSCRTIVFDKDLNQVAIAQNEFNQFFPKSG
FT                   WVEQYPLEIWSVQLATMQSAKNKAQIKSNNIAAVGITNQRETIVLWNKENGLPVYNAIV
FT                   WQDQRTASLCDKLNQDTKIKEFVKKHTGLPINPYFSATKIAWILENVPLAQKMLKEDKL
FT                   LAGTIDTWLIWKLTGGKMHVTDVSNASRTLLFDITTMTWSQELGDIFKVPLSILPKVMP
FT                   SNAHFGDIVPSHWSTSATGMVPIRGVAGDQQAALFGQLCVEPAMVKNTYGTGCFMLMNI
FT                   GNELKYSQHNLLTTVAWQLENQKPVYALEGSVFVAGAALKWLRDSLKVMYSAAESDFYA
FT                   KLAQKEEQEVVFVPAFTGLGAPYWDASARGAIFGIEANTKREHLVKATLEAIAFQANDL
FT                   IKAMASDLNSSIKKIKADGGACNSNYLMQFQADIANLEVIIPKNVETTAMGAAFLAGLA
FT                   VNYWKDTKQLEKLTGIAKQFKSQMNQTVREKKSKRWNEAVKRTLKWASLD"
FT   gene            complement(63480..64634)
FT                   /locus_tag="MPNE_0056"
FT   CDS_pept        complement(63480..64634)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0056"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87224"
FT                   /db_xref="GOA:A0A0H3DPW7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPW7"
FT                   /protein_id="ADK87224.1"
FT                   /translation="METRDVLIVGGGVIGCATAYELSQYKLKVTLVEKHHYLAQETSHA
FT                   NSGVIHTGIDPNPHKLTAKYNILGKKLWLNTYFKRLGFPRQKIRTLIVAFNEMEREQLE
FT                   VLKQRGIANQINLEDIQMLSKEETLKLEPYVNPEIVAGLKVEGSWAIDPVLASKCLALA
FT                   AQQNKVQICTNTEVTNISKQVDGTYLVWTNNETTPSFKVKKIIDAAGHYADYLAHLAKA
FT                   DDFEQTTRRGQYVVVTNQGELHLNSMVFMVPTIHGKGVIVSPMLDGNFLVGPTALDGVD
FT                   KEATRYITKDAPCMLTKIGKHMVPSLNINNALISFAGSRPIDKATNDFIIRIAHNDPDF
FT                   VILGGMKSPGLTAAPAIAREAVRLLNWKLTKKPNWNGKYNLPWI"
FT   gene            64817..66790
FT                   /locus_tag="MPNE_0057"
FT   CDS_pept        64817..66790
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0057"
FT                   /product="basic membrane protein"
FT                   /note="identified by match to protein family HMM PF02608"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86970"
FT                   /db_xref="GOA:A0A0H3DMI4"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMI4"
FT                   /protein_id="ADK86970.1"
FT                   /translation="MFGKGLVKKGLLFFSGVSTMAVFLVSCGATRIWESSIQLLVSNDE
FT                   ATLADKSFSEMSYEGIRRYFRSQKHIELPSPNSSLLQDGNGLWKRPGRTLSDRIATFKN
FT                   IKNDGSDVIVATGFNQQEALQAISSDDRRYLADKNDLAKVGFIFVDGQIEKEYNVINKT
FT                   PQFRSTPLNISSVAFRSDDGSFLTGVATAVYLNLNQDYFLKKNGATNNSSQDLTVSGFV
FT                   GVPIPSTLSFLNGFRLGIAYFNEVIYTHLSDAETTSDNKSNSSSASNSVLVQLKQMQGN
FT                   DKKIKKIKWISPKQGSDNNSNLSIDDHKSGSFSSTEPRATTIINNLLDKGVSAIIPVAG
FT                   PQVNLAVNEVARRKAHTAIIGVDSAQELLDINQDAPDKDQLIKGNKKIIPFSSIKALDV
FT                   AIENMLIAIQKGSDNNGYKGFGYNNIGTVGTSSVGISEAGYEFLIDPVFWKTTQSQGKS
FT                   MATNMTNLKRLSSDDTNTKKALKEVSTHKNGSDKDGIIGKYSNLLTKKSTTVTAVAQKS
FT                   MTDNNSGTEQKKNLSEVDTKKKEKESKGKTQSNGQDSGQQNGKETNDIISKYSKLLTMT
FT                   TMNNKVMSSKKQSSDDNSFKKTSENGDWVIKGDELTKKKSTELPAFAKGADYPTFPTEA
FT                   VSVINGSTALDGKGFKWSFKQI"
FT   gene            66808..67074
FT                   /gene="ptsH"
FT                   /locus_tag="MPNE_0058"
FT   CDS_pept        66808..67074
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ptsH"
FT                   /locus_tag="MPNE_0058"
FT                   /product="Phosphocarrier protein HPr"
FT                   /EC_number="2.7.11.-"
FT                   /note="identified by match to protein family HMM PF00381;
FT                   match to protein family HMM TIGR01003"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86726"
FT                   /db_xref="GOA:A0A0H3DLT1"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLT1"
FT                   /protein_id="ADK86726.1"
FT                   /translation="MKKIQVVVKDPVGIHARPASIIAGEANKFKSELKLVSPSGVEGNI
FT                   KSIINLMSLGIKQNDHITIKAEGTDEEEALNAIKAVLEKHQVI"
FT   gene            67518..67769
FT                   /locus_tag="MPNE_0059"
FT   CDS_pept        67518..67769
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0059"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86886"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMB8"
FT                   /protein_id="ADK86886.1"
FT                   /translation="MLKSTHNFLDKNIPLRKKWIEEKIASDELEGWEYTQIYPFLRKLS
FT                   RRKRYHFLRALENGDKPTSVLTDRENQLSENQISQAHA"
FT   gene            68601..68972
FT                   /pseudo
FT                   /locus_tag="MPNE_0060"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00938"
FT   gene            68984..69313
FT                   /pseudo
FT                   /locus_tag="MPNE_0061"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(69658..69771)
FT                   /locus_tag="MPNE_0062"
FT   CDS_pept        complement(69658..69771)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0062"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87279"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ32"
FT                   /protein_id="ADK87279.1"
FT                   /translation="MEKKAKRKFLGKKRAKSLDKEKAIFWLKSGNFFNKKG"
FT   gene            70080..70229
FT                   /locus_tag="MPNE_0063"
FT   CDS_pept        70080..70229
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0063"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87202"
FT                   /db_xref="GOA:A0A0H3DNA7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNA7"
FT                   /protein_id="ADK87202.1"
FT                   /translation="MLIPLLLAYNFSFFLLKDSLSFYQENLFFYVLKVVFILVQNLVQK
FT                   QSNF"
FT   gene            70379..72061
FT                   /locus_tag="MPNE_0064"
FT   CDS_pept        70379..72061
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0064"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86846"
FT                   /db_xref="GOA:A0A0H3DM80"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM80"
FT                   /protein_id="ADK86846.1"
FT                   /translation="MNERFLIEIEGLNKTFDDGFVSVRDINLKIKKGEFITILGPSGCG
FT                   KTTTLRLLAGFEDPTYGKIKVNGLDIKDLPIHKRPFATVFQDYALFSHLTVYKNIAYGL
FT                   KAMYTKLDPIDKLVEQYHQSLLDKQHRLHKRIERLEKSNANPQLLEQLKQTVVVQQKQF
FT                   KQQTETFKQKENARRDAIQQRLVQLTKEWESLSKQKLQQLEAEKKLLDKKFEQTERKYQ
FT                   KDAWMATHSEMRLKQFKQEVLALKQLIKTKFKQNEPVDKLQLKLQTLKQKYAAKRQIDK
FT                   EYDKLVLAYNKKDYWTSYWETYSLQQQEAFEKRYLSRKLTKQEQHQKVCAVIELVGLKG
FT                   NEDKLPEELSGGMKQRVALARSLVIEPDILLLDEPLSALDAKVRKNLQKELQKIHQQSG
FT                   LTFILVTHDQEEALVLSNRIVVMNEGNILQVGSPADIYDSPKTEWIANFIGQANIFKGT
FT                   YLGDLKIKLHSGEVIKTDVDNNYVVGKEYKILIRPEDFDIVPKNKGFFNVRVIDKTYKG
FT                   LLWKITTKLVDDTIVDLESVNDIEVDKTFGVTFDPIDVHLMEV"
FT   gene            72063..72923
FT                   /locus_tag="MPNE_0065"
FT   CDS_pept        72063..72923
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0065"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86674"
FT                   /db_xref="GOA:A0A0H3DLL2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLL2"
FT                   /protein_id="ADK86674.1"
FT                   /translation="MKLSKKYLLAVPFFVLMVIFFVVPMAWIIVSGLQNENGASITEKY
FT                   QPLVGGYSFFQSFWTSLWTATVTVLVALLVAFPFCYFLSQSKNKVFRSFVIALATAPIW
FT                   SSFLIKLIGLKTLLDLVLGLALNRVGDNNLTFGSGYTLIGMIYLFTPFMFLPLYNNFCI
FT                   LPKNLILASQDLGYNWITSFIKVVIPFSKTAILSGIALTFFPSLTSVAIAQFLDNSNQN
FT                   NTLGNYVFTLGNNGYDSAIERGRASGAIIIAALITFAFYFVVIFAPRIVRLIQTKCLEY
FT                   RRVNV"
FT   gene            72925..73776
FT                   /locus_tag="MPNE_0066"
FT   CDS_pept        72925..73776
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0066"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86728"
FT                   /db_xref="GOA:A0A0H3DK24"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK24"
FT                   /protein_id="ADK86728.1"
FT                   /translation="MKSCKLWLRGSFFVIVLVLIYLPLIIVVLVSFNGSSTRGNIVLDF
FT                   GNVLNPNPDAKSAYLRLGEADFAIPLLNSVIIGLITVIVSIPIAIMTAFALLRSRQWLN
FT                   KTVFGIANFSLATPDIITGISLVLLFANTWLSFNQQLGFFTIISSHISFSVPYALVLIY
FT                   PKMQKLNRNLILASQDLGYSPIATFFHITLPYLLPSILSAILVVFATSFDDYVITSLVQ
FT                   GSVKTVASELYSFRKGIKAWAIAFGAILILVSILAVLLVTLHKYLRFKHKEMLRVKQWK
FT                   NS"
FT   gene            73806..75218
FT                   /locus_tag="MPNE_0067"
FT   CDS_pept        73806..75218
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02030"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86781"
FT                   /db_xref="GOA:A0A0H3DM24"
FT                   /db_xref="InterPro:IPR000044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM24"
FT                   /protein_id="ADK86781.1"
FT                   /translation="MSVGLTACSSNQFVFANFESYVSPLLLERAEAKQPMTFLTYPTNE
FT                   KLINGFANNTYTVAVASSYAVSELQQQGHLLPIDWAKFNLKKTQNGSNQATIQNKEDAK
FT                   ELFTKEIGDISGELLNWGVPYFLQDLVFVYRGEKIQELEGQDVTWSTIIKAIVNHKDRF
FT                   NNNRLALIDDARTIFSLANVVHHEVKNTTVDVNPTGSTLNYFGNVYESFANLGLKRDNL
FT                   NTLFVNSDSNIIINELANGRRQGGIVYNGDAVYAALGGDLRDEINENNLPNGDNFHIVQ
FT                   PKHSPVALDFLIINQQQTHFRDAAHQLIYQLALEGADQTAEELLKTDEEKGTSDEDYYT
FT                   YGAMQNFSYVNYVSPLKNISDETTGIVFKENKQADTKRVVKQQSQSEQQSESAEKEETE
FT                   QDDFYTATLKSLLKADSLDDKAKKLVDTIKKTYKIKKADNINWANLIEKPITPLQRSNL
FT                   TLSWLDFKQRFW"
FT   gene            75218..76177
FT                   /locus_tag="MPNE_0068"
FT   CDS_pept        75218..76177
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0068"
FT                   /product="putative glycoprotease GCP"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329; match to protein
FT                   family HMM TIGR03723"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87243"
FT                   /db_xref="GOA:A0A0H3DNI4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNI4"
FT                   /protein_id="ADK87243.1"
FT                   /translation="MEQPLCILGIETTCDDTSIGVITESKVQAHIVLSSAKLHAQTGGV
FT                   VPEVAARSHEQNLLKALQQSGVVLEQITHIAYAANPGLPGCLHVGATFARSLSFLLDKP
FT                   LLPINHLYAHIFSALIDQDINQLKLPALGLVVSGGHTAIYLIKSLFDLELIAETSDDAI
FT                   GEVYDKVGRAMGFPYPAGPQLDSLFQPELVKSHYFFRPSTKWTKFSYSGLKSQCFTKIK
FT                   QLRERKGFNPQTHDWNEFASNFQATIIDHYINHVKDAIQQHQPQMLLLGGGVSANKYLR
FT                   EQVTQLQLPYLIAPLKYTSDNGAMIGFYANLLINGKNN"
FT   gene            76161..77312
FT                   /gene="metK"
FT                   /locus_tag="MPNE_0069"
FT   CDS_pept        76161..77312
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="metK"
FT                   /locus_tag="MPNE_0069"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87211"
FT                   /db_xref="GOA:A0A0H3DLP1"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLP1"
FT                   /protein_id="ADK87211.1"
FT                   /translation="MAKTIKHPRWGRYVAEAVGRGHPDKICDQIADSILDECIKQSPTS
FT                   HVACEVFASKNLIMVGGEILTTGYVDVVQTGWKVLNRLGYTENDFSFLSCINSQSSEIN
FT                   QAVQSNDEIGAGDQGITVGYACSETEQLMPLGSIVAQALVQRAARIIDQYPFIKHDMKS
FT                   QVVLNYTGNKVQCESVLMSVQHTQDVSLDQLRQTIINQVILPVLTEYGLNDPKIKHLVN
FT                   PGGSFVVGGPMADTGLTGRKIIVDTYGPYANHGGGSFSGKDPTKVDRTGAYFARFIAKH
FT                   IVSLGWAEECEVSISWVFSQPLPQSIQVKCFNINKEFSEQLINQVISQYFNWSVAKIIA
FT                   KLKLLDQVEYFRYAVYGHFGHQTAPWEQLSERDSLQCLIKNFQ"
FT   gene            77288..77569
FT                   /locus_tag="MPNE_0070"
FT   CDS_pept        77288..77569
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0070"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87006"
FT                   /db_xref="GOA:A0A0H3DMM1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMM1"
FT                   /protein_id="ADK87006.1"
FT                   /translation="MFNQKFPIKAPKAPFFKKKTPPVPPKNPVVTSTTPELKKTKIKKV
FT                   KEAGDTNLWDKIKAKVKKHPYLFAVLVSFILLIALLGWLFAIPISQIP"
FT   gene            complement(77600..78952)
FT                   /gene="ffh"
FT                   /locus_tag="MPNE_0071"
FT   CDS_pept        complement(77600..78952)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ffh"
FT                   /locus_tag="MPNE_0071"
FT                   /product="signal recognition particle protein"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM PF02978; match to protein family HMM TIGR00959"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87074"
FT                   /db_xref="GOA:A0A0H3DL09"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL09"
FT                   /protein_id="ADK87074.1"
FT                   /translation="MFKSMISSIVMRSMQKKINAQTISETDVQAVLKEIRIALLDADVN
FT                   LLVVKNFIKAIREQTVGQTVEPGQDLQKWLLKVIKQELINILSQPNQEITSKRPLKVMV
FT                   VGLQGSGKTTTCGKLAVWLKKQFQQKAMLVALDIYRPAAIDQLATLAEQTESVFFAKGT
FT                   QAPDQTTKEAVKTFKESGCQAIICDTAGRLQTNQELMDELVAIKNELHPDEILMVVDGL
FT                   SGQEIINVAKEFHNRLKLTGFIITKLDSDARAGAALSLTSLLEVPIKLMGTSEKLTGLE
FT                   QFHPERIASRILGLGDVMTLVEKVEEVFDKQSLTKTVSKMFLGKMDLEDLLLYMEQMNQ
FT                   MGSVSSIVKMLPGNLTVSDDHVESIEAKVKLWKVLINSMTREERRHPKLINRDPSRKQR
FT                   IIKGSGRKMDELNKLMKEWSKLQTKTAEMGRMLKGGKNPFSGFGGLGGLGF"
FT   gene            79008..79724
FT                   /gene="deoD"
FT                   /locus_tag="MPNE_0072"
FT   CDS_pept        79008..79724
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="deoD"
FT                   /locus_tag="MPNE_0072"
FT                   /product="purine nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="identified by match to protein family HMM PF01048;
FT                   match to protein family HMM TIGR00107"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86845"
FT                   /db_xref="GOA:A0A0H3DM47"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM47"
FT                   /protein_id="ADK86845.1"
FT                   /translation="MTPHINAKKDDIAKVVLMPGDPLRAKWIAEQFMEKPRLVNEVRGM
FT                   LAFTGQYKGKTITIMGHGMGIPSIGIYSYELMKFYEVNTIIRIGSCGALQDSLNLQDLI
FT                   IAAKAWSESIYANDMGVEVPADKILMASPQLVELAKKTANQLQLAFHEGLVFCEDAFHQ
FT                   TRKDVLKLAQEKHALAVEMEAHALYANAMLLNKQALTMLTVSDSLVTHAALPAEQRQAT
FT                   FKNMAILSLEMASQLV"
FT   gene            79728..80402
FT                   /gene="deoC"
FT                   /locus_tag="MPNE_0073"
FT   CDS_pept        79728..80402
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="deoC"
FT                   /locus_tag="MPNE_0073"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="identified by match to protein family HMM PF01791;
FT                   match to protein family HMM TIGR00126"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87268"
FT                   /db_xref="GOA:A0A0H3DNL2"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNL2"
FT                   /protein_id="ADK87268.1"
FT                   /translation="MKLEYNRIIDSTLLKADTLPHEIDALCADAHKYQFYAVCVNPSYV
FT                   RYAKNILKGTGVKLCTVVGFPLGQTTQRQKVYETKIAIKEGADEIDMVMNIAEFKKRCA
FT                   CVISEIRAVKKVCGKRTLKVIIETALLNQDEIRDAVNVCIDGNADFVKTSTGFSMRGAS
FT                   LEDITIMREASGNLIKIKASGGVQTAQQFLDFFNAGVSRIGTSNAVKIMEELHKLESHE
FT                   HR"
FT   gene            80389..81654
FT                   /locus_tag="MPNE_0074"
FT   CDS_pept        80389..81654
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0074"
FT                   /product="putative pyrimidine-nucleoside phosphorylase"
FT                   /note="identified by match to protein family HMM PF00591;
FT                   match to protein family HMM PF02885; match to protein
FT                   family HMM PF07831; match to protein family HMM TIGR02644"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87009"
FT                   /db_xref="GOA:A0A0H3DKT2"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKT2"
FT                   /protein_id="ADK87009.1"
FT                   /translation="MNIVNLISKKQRGKALTETEINWFVHSVNNKSLADYQVSAFLMAV
FT                   WFQGMNSKELFCLTKAMVKSGESLHFNHHSKLSVDKHSTGGIGDKVSIALIPILTALDY
FT                   SVAKLSGRGLGYTGGTIDKLEAVGVKTDFTPTEAQNLLDQNDCFIIGQSEGIAPVDKVL
FT                   YALRDTTATVDSLPLIASSVMSKKLAINNDYIFIDLKYGKGAFCKTKTMAKELAQYMYS
FT                   IAKQFKRKLYIKLSDMNQVLGKTIGNALEVLEVVHFLKRNWTEVGADFIQLMEQIVTEI
FT                   LIETKRAPNKRAAVALYHATLEGEKPWQRFLKFIELQGSSRERFLDLKELFNPQYKAPV
FT                   LASQSGTLSYTSPVDLAMVSISLGAGRMVKTDLIDPMAGIKLVKQANEVVKAGDTVLEL
FT                   YSSKPITPAHIEAAQHTIIIKQ"
FT   gene            81665..82066
FT                   /gene="cdd"
FT                   /locus_tag="MPNE_0075"
FT   CDS_pept        81665..82066
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="cdd"
FT                   /locus_tag="MPNE_0075"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /note="identified by match to protein family HMM PF00383;
FT                   match to protein family HMM TIGR01354"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87024"
FT                   /db_xref="GOA:A0A0H3DKU9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKU9"
FT                   /protein_id="ADK87024.1"
FT                   /translation="MKVDLDWVHHKLQEVVNHAYTPFSKFKVACMLVANNQAFYGVNIE
FT                   NASYPVTLCAERSAIANMVTSIGKATIDYVFVYFDTKTPTNSPCGMCRQNIFEFATDKT
FT                   QLFCIEKDKSFKQFTIPEILKGGFRSYEQ"
FT   gene            82074..83720
FT                   /locus_tag="MPNE_0077"
FT   CDS_pept        82074..83720
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0077"
FT                   /product="phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II"
FT                   /note="identified by match to protein family HMM PF02878;
FT                   match to protein family HMM PF02879"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87169"
FT                   /db_xref="GOA:A0A0H3DPQ5"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPQ5"
FT                   /protein_id="ADK87169.1"
FT                   /translation="MEAQRWLSHPRVKPNLKEVITAMSAEEIEHFFSLKKPSFGTAGVR
FT                   GKMAPGYHGMNVFSYAYLTQGYVNYIQSLNPTKKPLRFLVARDTRKHGALFNGIVCDVI
FT                   TSMGHVVYMFDNNEPTPTPLVSYVIKKYHFDGGVNVTASHNPKTDNGFKIYDGHGAQLL
FT                   DFQTDQLIAMLPPVVTMLDFEPRGNNELLHFLDNEVVYKNYFDDLKESLVVDNDSFKNL
FT                   PVVFTGLHGTSVKLLPRFLTYLGYSNIISVQPQNVFDANFANADHLNPESKDTWELARQ
FT                   YASNTKAKLMMAIDPDADRFAIAEWNPQTQDWHYFSGNESGVMVAYYKLKHKQFKRQPY
FT                   IVTTVVSTDLVDKIAKKYGAFVKRTNVGFKFIGQAVDHFSKDNELVVAFEEAIGMMASD
FT                   GLNREKDSFQAAAIMLEIARYCHNKGISLLEFYRGEIFGEFGDYYNWTVPHTIHGVNWK
FT                   EKMEQVLHQLTTATIKEVVGHKITKIKNYVDINLVEYVLENGNWIKFRISGTEPKLKLY
FT                   FNLSKGYLAALKHEAKKMHEFLVRLLNLDKA"
FT   gene            complement(83688..84650)
FT                   /locus_tag="MPNE_0076"
FT   CDS_pept        complement(83688..84650)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0076"
FT                   /product="NusG family protein"
FT                   /note="identified by match to protein family HMM PF02357;
FT                   match to protein family HMM TIGR01956"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87233"
FT                   /db_xref="GOA:A0A0H3DNH6"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR010216"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNH6"
FT                   /protein_id="ADK87233.1"
FT                   /translation="MEQVELIPQWYVAPVSVKDEAVVRNLKAKVKALGFDNEILDVRVL
FT                   KEREVIEEVFSLKSGKLPRSLKNTAFTKWFVLDEDRYLKVKISEKNLLGRYIYIKMIYS
FT                   EDAWRIIRNFPGITGIVGSSGRGALPTPLDQADADNLEQMLKGISVNPKKRVLVTNTAI
FT                   VEMDADKFDEKFQYILKHKQVKPEAIAQVNESGEIIDTNQFAQALMEANKAEQDEWNED
FT                   VAIVKSEANKVDPSVLIPYLGKYEIVEGDTKVDQLQQFSVGNLVEVHLTGAIHIQGQIK
FT                   ALYQGTINKAVVEVELTTKTQLINLPLENLSFIEVEQSH"
FT   gene            complement(84658..85086)
FT                   /gene="secE"
FT                   /locus_tag="MPNE_0078"
FT   CDS_pept        complement(84658..85086)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="secE"
FT                   /locus_tag="MPNE_0078"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="identified by match to protein family HMM TIGR00964"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86743"
FT                   /db_xref="GOA:A0A0H3DK38"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK38"
FT                   /protein_id="ADK86743.1"
FT                   /translation="MQALQPKNQAPRFLLSFMEKKKLPFGLKNKEKLTAYNDEKIHELH
FT                   RQLKAKIEAKKAKEKQDSKTKDTDKKVDQTPKVKVPFTKKFSNLWFGIDKEVNKIVWVT
FT                   SKKLITIFLLIVLVSAIMIGIYFGINHLFIALGVFKGK"
FT   gene            complement(85203..85586)
FT                   /locus_tag="MPNE_0079"
FT   CDS_pept        complement(85203..85586)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86953"
FT                   /db_xref="GOA:A0A0H3DKM0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKM0"
FT                   /protein_id="ADK86953.1"
FT                   /translation="MKVIKKLNLLNELTMLVCIFFFVCTISLIGIGIMYDLINRTSLSA
FT                   PRRDPIFRNLNTVLIVLGVLEILLMVAQLVMSNMAANIINEVAENVEQKFAKALKWSRF
FT                   LPFGLLQLYCYHKIKLVTQTDNI"
FT   gene            complement(85573..86403)
FT                   /gene="yraL"
FT                   /locus_tag="MPNE_0080"
FT   CDS_pept        complement(85573..86403)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="yraL"
FT                   /locus_tag="MPNE_0080"
FT                   /product="S-adenosylmethionine-dependent methyltransferase,
FT                   YraL family"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86731"
FT                   /db_xref="GOA:A0A0H3DLX3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLX3"
FT                   /protein_id="ADK86731.1"
FT                   /translation="MPALKVIATPIGNIEEVSPRVKAALTKCEVLFCEDTRVTKKLLGL
FT                   LGIDFSNKQFIINNEFKEKQNLSKVANLIHQYHCGLVSDAGYPSVSDPGHILVEYVRTQ
FT                   LPQIAIEVINGPSALVCGLVTSGFPESPLLFLGFLDHKPTQITQTLKHYQNFQGTIVLF
FT                   EAVHRLQQTLEVIQTVFSNTEVFVGRELTKLHESHYWFNTSAPLPDITLKGEFVIVINN
FT                   HHTQPVGQYSDQLLKQEITQLVQMGVKVKDACHYLAKRLQLKSNKLYTLFHESD"
FT   gene            complement(86385..86921)
FT                   /gene="rnmV"
FT                   /locus_tag="MPNE_0081"
FT   CDS_pept        complement(86385..86921)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rnmV"
FT                   /locus_tag="MPNE_0081"
FT                   /product="ribonuclease M5"
FT                   /EC_number="3.1.26.8"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM TIGR00334"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86860"
FT                   /db_xref="GOA:A0A0H3DM63"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM63"
FT                   /protein_id="ADK86860.1"
FT                   /translation="MDKKTRLKLDGVIVCEGKTDQARLQQLFDVSVITTNGSALNQRTI
FT                   NLIKAVAKKQPVILFLDPDVAGQKIRRQLEQHLDKYESCFIARKDMKPNSTKIGVAEAT
FT                   DAALIQALQQRQVFTKTTQPTLSWEQYLELNLNSKSKRLALCNKLHLSYFNHKQLFRKL
FT                   NLLQLTFDQVCQLLK"
FT   gene            complement(86900..87886)
FT                   /gene="prs"
FT                   /locus_tag="MPNE_0082"
FT   CDS_pept        complement(86900..87886)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="prs"
FT                   /locus_tag="MPNE_0082"
FT                   /product="ribose-phosphate diphosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86950"
FT                   /db_xref="GOA:A0A0H3DMF5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMF5"
FT                   /protein_id="ADK86950.1"
FT                   /translation="MDRHNHVVFSLSKTHDLVSRICQKLKMPMGLITHNEFADGETYIR
FT                   FEESVRNKDVFIFQSTCAPVNDSLMELLIAIDALKRGSAKSITAILPYYGYARQDRKTM
FT                   GREPITSKLVADLLTTAGVSRVALTDIHSDQTQGFFNIPVDTLQTYHVFLTRTVELLGK
FT                   KDLVVVSPDYGGVKRARLIATSLELPLAIIDKRRPAHNVAESINVLGEVANKNCLIVDD
FT                   MIDTGGTVIAAAKLLREHHAKKVCVMATHGLFNGEAPQRFQKAFNEGLVDYLFVSNSIP
FT                   QTKFNQCPQFQVIDLAPLFEEVLLCYANNSSISAIYTRHIEWIKKHV"
FT   gene            complement(87979..88317)
FT                   /pseudo
FT                   /gene="smpB"
FT                   /locus_tag="MPNE_0083"
FT                   /note="SsrA-binding protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01668; match to
FT                   protein family HMM TIGR00086"
FT   gene            88324..89223
FT                   /locus_tag="MPNE_0084"
FT   CDS_pept        88324..89223
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0084"
FT                   /product="glycosyltransferase, group 2 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86790"
FT                   /db_xref="GOA:A0A0H3DM01"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM01"
FT                   /protein_id="ADK86790.1"
FT                   /translation="MKISVIISTYNCGALIVKALCSLVSNQTPACELEVLVIDDGSIDN
FT                   TRQIIKKFQAKVSFTLKYFYKKNGNWGSVINYVKENRLANGDWITVLDSDDTLKPNTLN
FT                   KLANLVEKADYDLVVFDYTKCWKKIKLKIHTYPTWWKNMTRELQKQTPFCIPLGKFLKR
FT                   NLFYKLPKLKEKVSFQDALYTASSLKLAKKVRHVNQSGGNYHFKRAGNSMSIPWNIKRF
FT                   SAELDICKDLIRLNAQEIALVHLLRQQFRVQLKEKQIQLAVTRDFNFSGFSWYTRCFLW
FT                   MVYQTMLKRYFYLQTTKQ"
FT   gene            complement(89275..90969)
FT                   /locus_tag="MPNE_0085"
FT   CDS_pept        complement(89275..90969)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07672"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86777"
FT                   /db_xref="GOA:A0A0H3DNJ7"
FT                   /db_xref="InterPro:IPR011699"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNJ7"
FT                   /protein_id="ADK86777.1"
FT                   /translation="MLWAIVLLGYLLFVVEWFVIDRIAGKPAGILDSNTKVLPNYDGWV
FT                   NSFFANSAGSIAGSATNWSITLLRAVGSVLCGIVVLKFGYRYAVMIMMGLMCLCFPFLI
FT                   IGDPLGGNNQLTLLRPLSKEVMGKLSSLSSQLHEGQLLGPVMAEGKTMLADGQTIDLVQ
FT                   GLDKNLIGTSSSIAGYALFIIFRSTIAIGGTTLVTYSQPLIASLSTQRRKSVLSNANLW
FT                   GFNSGIVVAFVPFLFQSVQQAGTKYWVFILTALILIGFGILCVFAWFEKQMDPFMPQKQ
FT                   TKEQMQLGNQPSAGDILKRKATWKMIGMYGICLVVLVNPLTGGWWNILQAVSPASSFNV
FT                   KDGVKTLKPLEGAGGYFAGLPTLAILWVLGYGMGYMVFSPFNKTVYDRKRWLSFMFFMN
FT                   ALMVIVIVLFAATLGVGTAVGFAFVAIATFIGGSFAWSMQSTILILPHEFKEYKRSEVS
FT                   VLFGYIWGFGYVIYTAFDITNSMFLEAPKLANPGMKGVSILPGAIAGVALFAGLLLAAI
FT                   AIVVTLPSSYLKNGDELVSEMTKKWKLNQWQFLVASKEKNRYADLLK"
FT   gene            complement(91175..92788)
FT                   /locus_tag="MPNE_0086"
FT   CDS_pept        complement(91175..92788)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07672"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86729"
FT                   /db_xref="GOA:A0A0H3DKH6"
FT                   /db_xref="InterPro:IPR011699"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKH6"
FT                   /protein_id="ADK86729.1"
FT                   /translation="MLFVIEWFVIDFIRGSAASLLTEQTSAVPQYGGWFSSFFVADAGF
FT                   IPGQATNWTITLLRAVGSILCGVMVVKFGYRHAVMIMMGLMCVCFPFLIIGSPLGGHNE
FT                   LTLLRPASSEVISKLTKISSSLQQGQLLGPVQVGSQTMLADGTPVSLIKGINGNEIGTS
FT                   ASMTGYAFFIIFRSTIAIGGTTLIAYAQPIIASLSSNRKKSILSNANFWGFNVGLVIVA
FT                   APFLIPGVGRFATANWVWVVTFMILLVFAMLLVFAWFEKKVDHMLPQKQSKTNQSLSVR
FT                   PSALSILKRKTTWKLLAIAGVGTILLINPLTQTWFNSLLAISGAKKAIIPTARPILLIL
FT                   WVMGYLLGYFLLSPFNKTIYDKKRWLHFIFTANAVLVLLIVIFAATLGLNTVVGFTFVG
FT                   IFTFIAGGFGWSLGSSILILPYEYKEYKRNEVSIIFGYVWGFAYVFYSIFDIITSVFLD
FT                   APRIATGNTSANILPGAIAAIVLFVSLLLVINWVIIYLPSSWIKNGDECVSEMTKKWRI
FT                   TQWQFVIANKAKNRYADLLK"
FT   gene            complement(93028..93116)
FT                   /locus_tag="MPNE_0087"
FT   tRNA            complement(93028..93116)
FT                   /locus_tag="MPNE_0087"
FT                   /product="tRNA-Ser"
FT   gene            93179..95251
FT                   /locus_tag="MPNE_0088"
FT   CDS_pept        93179..95251
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0088"
FT                   /product="phosphotransferase system, EIIC"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM PF02379; match to protein family HMM TIGR00829;
FT                   match to protein family HMM TIGR00848; match to protein
FT                   family HMM TIGR01427"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86969"
FT                   /db_xref="GOA:A0A0H3DL52"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL52"
FT                   /protein_id="ADK86969.1"
FT                   /translation="MLSAELFFNWTAKDFKDKTSFLKQACRVLQAKNCIKEEQIALTAL
FT                   KEREAQITTGIMSKLALPHMQSATVLKPFVAVFKVNNVDWQSLDNQPVKLIFLIGVPKD
FT                   QGNLHLEFISQFSKLMLQDEFANKVPNIRSFNGLINLIDSFQQTAVASQPVVNEAAAQT
FT                   EEPKDTNTQYDFVAVTACPTGIAHTFMAKEALEKFARDHNLKVKVETQGTDGIQNQLTE
FT                   SDLNNTKGIILACDRLIDLTRFYGHANVVEVSTTKAIKTPQTVYDQVVKKEGKLLGNKS
FT                   SDSASQTELKETTEQLSFKDFHKRIYRAILSGVSYMLPFVVFGGILIAIAFLIDINNAG
FT                   NAGKQFGSKDPIANWFKTLGGLSFGLIVPILSAYIAFALVGRQGLLPGFIVGLISAGKF
FT                   LLNIDIVTGKIDWATESKVSSGFFGAIFGGLLAAVLIIVQQRYIYRKLPQALQGIKNIL
FT                   FIPLLGTLVTAALFWVINIPLIYLNYGLSKFLQIMDKPYLAPLLGLVIGLMMCFDLGGP
FT                   VNKAAYVFGVVSLESQNSGTVAMASAILSGMVPPLGIAIAATIRKQCFDKEELPAAYAC
FT                   YVMGLSFISEGAIPFVAKRPKIMLAANLIGGAVCGVLTGAFALTIRAPHGGVFVFALLK
FT                   TNLEGIAGNTLQIGAGVGLALLALIVSSFISAGIIIGHNLLVVRKKTKQLVNTNA"
FT   gene            95244..96146
FT                   /locus_tag="MPNE_0089"
FT   CDS_pept        95244..96146
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0089"
FT                   /product="kinase, PfkB family"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87093"
FT                   /db_xref="GOA:A0A0H3DN03"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN03"
FT                   /protein_id="ADK87093.1"
FT                   /translation="MLNHNSKVWIVNYACAIDYYLDKHKQQRGVLTPGGKGINMAIVMA
FT                   LFGIKPTVLTFLGQPTKDLFLQLLKPYQLDLVSFPATTQTRINVKLLDGAQTTEINDVT
FT                   PLMEEQAVHEMIAYLKANVKPNDLLVLNGRFLQRDLVKLLDVAFSLTKYVVLDVDEPQL
FT                   LQLLNQRQPWLMKPNRDEFVAMVNANNSNVDQQELVQLIKQFQTTQNLLMSDGAQGAYF
FT                   FDQQQLLFMEAIPPQQLVSTTGAGDTLLGVFLANLLLDKDPVGSLKVAVNYASATISKL
FT                   GVVNSNDQIVLKATNYYYL"
FT   gene            96154..96315
FT                   /locus_tag="MPNE_0090"
FT   CDS_pept        96154..96315
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0090"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87225"
FT                   /db_xref="GOA:A0A0H3DLG3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLG3"
FT                   /protein_id="ADK87225.1"
FT                   /translation="MSTKELAKQPKVNQERESILLPVLLAVFSMLFFMLLLALVLLYAI
FT                   PGKVNNLN"
FT   gene            96383..100543
FT                   /locus_tag="MPNE_0091"
FT   CDS_pept        96383..100543
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0091"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87197"
FT                   /db_xref="GOA:A0A0H3DNA2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNA2"
FT                   /protein_id="ADK87197.1"
FT                   /translation="MRNLIKNVFRSFRTAKIALIALTFLIFVAVGSFVLLNNTVNNFNA
FT                   SFQHVTEQGQLSNAIINERYDFGKLEFQKTSNDATSSAQPSVSTRSTLTAQKANGANSS
FT                   FTLTLTPDSRTSFINNALQLKPDVYNSLVTVTFSYGSESDQTKKTQIEEQSKLIAANNL
FT                   SRALQTDKELLVTGQLEQLKATFRTYKAINITDQGVFKKLIASEPTDQVNRLVLFDGHQ
FT                   LARSRQVEFNELVSQFTQVQAKGKDQLSTTLKNGNYEQLLQAIANNFGSSETELLKEIQ
FT                   DALKQTNSSTTLAQTQSSQQFSKLKNLFDSGSTFTNIAGKLTLQWMEGTNKKQLVIFDP
FT                   SSYETVVAPGNWSYEQQQGKAVYQDINHWNRIKRLPFNEFEREFQKIDKRYKMLVDKIE
FT                   YLILGVGITPDFVYPVFSESLLIPNTANEQLYYVNQTGYERTASSFLTNPTETGIVARL
FT                   PNLNHDLDVINQWAVKNMSWPPNLKAAYSNTDTTNILNLLAARTVFIPNLINTISLVSS
FT                   FLTIAILLVAIFVTILILVSYLKKNTEQIGILKANGVSGRKINLSLLIFSLIPGIVGSF
FT                   IGYTLGISMQNVAINLFSNYWFIPTQTSSFSVLGLLFFALLVVLMMSGISLFVGWLILR
FT                   QDVVKILKHDSEFKVSHLGLWAKWLFAKFGIMTRFRVALAFNAPWKLVFLTLMSALTMM
FT                   ILNLSFATKDAFQVAQTKTTLTQSNHQYEFELASPTEQSGLLKWQLFAELGATDDRTTD
FT                   AVKLANRRMEIQSVDESKKWKNQQVINFVTDATGFSNDINYLENIVQSKIGLDYSLGFG
FT                   NVSSNPWKLSETLMPANQASASNTAFQNFLKAIIVIDPNEGGKYIKQTKDEVTVRFLYE
FT                   IDSSKALKNGNTKSVNKIQKSTAAPQAQQGQSNQLMLDNDFAKFLYKQFNLIKEGGKAD
FT                   PVDLNNFDFANQNQIKRFYSKYNALPPVDYKLAFNVIGLPKETIANQKDAPLFGFLTLQ
FT                   AQLGNDAIKIKGIKDWKLDNTNLGPVLRTNEDEIINQRLFSKPNGIIINSSAAKKYRLK
FT                   EGSQLHVKIHNGYKRVNAKLVNQDPTLTATFNIVGINNSVHEPEFYTSYKTAATLLQYP
FT                   NEWIEKQLPFNSFYANSILPFTQSTSLFSESGLFPGTSSFAANNTVLTEVIKKTIEGGK
FT                   TNSKTDVQKRAAQATANGKDNSSQNNKMNYERLQKALGITSDLDSSKAGEYATILERVY
FT                   DGLPYNSTISFISNVQANDALFANIANTTQQIQTAAIGIIIPIIMLIVLLVSTTLIQEL
FT                   KKIAIRLKALGYSNPKILLSFLSIYLPLFIFGLLISTPISIYLIALHNQVIFSSAAILL
FT                   EATLNFPTVILSMLVLSGVLSITFVLNWLELNKIKIAKEIKNS"
FT   gene            100543..101940
FT                   /locus_tag="MPNE_0092"
FT   CDS_pept        100543..101940
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0092"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87060"
FT                   /db_xref="GOA:A0A0H3DLD6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLD6"
FT                   /protein_id="ADK87060.1"
FT                   /translation="MRYFALTDLTKPTAKFTTDAMELRQISNAYLNQAQAYLQKGLKQL
FT                   KKDYKNAILYTPKTEYKRFLKWKQTFLQDLNQTQKRFFIVRAQHFSYVLLFNLLDEQVE
FT                   AVIATFNNFLDEHRLEAQSKQFDLDTAVNELHDYFDQLQKNTAYSEDLPTHLTQKTEQL
FT                   INARNTQLTNLLNKIATTKPPLNKQQRLLASFRNYHEHLFLKNEVKKVTWLNEPRAKKE
FT                   SVTPDEEHIIELKNVYKYITNGVTTNAVLKGIDLKLKAHDFIVILGPSGSGKTTLLNII
FT                   SGMDRPSSGSVVVNGQEMICMNDRQLTNFRRNYVGYIFQQYGLLPNLTVRENVEVGANL
FT                   QRNPDKRINIDELLEAVGMKHLQKKLPNELSGGQQQRVSIARAFAKNPLLIFGDEPTGA
FT                   LDLEMTQIVLKQFLAIKQRYKTTMVIVTHNNLIAQLADLVIYVADGKIQALQANPNPKQ
FT                   VEDINWI"
FT   gene            101961..103907
FT                   /gene="tkt"
FT                   /locus_tag="MPNE_0093"
FT   CDS_pept        101961..103907
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tkt"
FT                   /locus_tag="MPNE_0093"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="identified by match to protein family HMM PF00456;
FT                   match to protein family HMM PF02779; match to protein
FT                   family HMM TIGR00232"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86821"
FT                   /db_xref="GOA:A0A0H3DM58"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM58"
FT                   /protein_id="ADK86821.1"
FT                   /translation="MKNLFACQHLALSAIQHAKGGHVGMALGASPILYTLWTKHIQFNP
FT                   NCPKWINRDRLVMSAGHGSMALYPILHFAGLITKQEMLHHKYGQVNTSSHPEYAPNNFI
FT                   DASTGPLGQGLGMAVGMALTQRVLAAEFKALSPKLFDHFTYVVVGDGDLQEGVSYEVAH
FT                   LAGVYQLNKLIVLHDSNRVQMDSVVRDVSLENLQTRFTNMGWNYLETSDAVADIDAAIE
FT                   QAKKSDKPTFIEVHTTIAKNTTLEDQPAGHWFIPTDKDFARFNSNTKTNFTPFEYPQTV
FT                   YDFFHKQVIARQAKPVQAYKELLEKLKDKPLYTKFINWTENDYQALYLNQLDERKVAQT
FT                   NAATRNYLKDFLGQINNSNSNLYCLNADVARSCNIKLGDDNLHTNPHSRNIQVGIREFG
FT                   MSTIMNGMALHGGVKVMGGTFLAFADYSKPAIRLGALMNLPTFYVYTHDSYQVGGDGPT
FT                   HQPYDQLPMLRAIENVQVWRPCDEKETAAGVNYGLLSQDQTNVLILTRQALPSLEQSDS
FT                   VQTLKGGYIISNRKQPDVIVAASGSEVQLALQLEQALNEQQLKTRVVSVPNINMLLSQP
FT                   QSYLQQLFDPNSVLLTLEASASMEWYALAKYVKKHTHLGAFSFGESNDGQVVYEHKGFN
FT                   VTNLLKLIKTLKS"
FT   gene            103917..105542
FT                   /pseudo
FT                   /locus_tag="MPNE_0094"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01727; match to
FT                   protein family HMM PF01732"
FT   gene            105569..107143
FT                   /locus_tag="MPNE_0095"
FT   CDS_pept        105569..107143
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01727;
FT                   match to protein family HMM PF01732"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86938"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR022381"
FT                   /db_xref="InterPro:IPR022382"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKK7"
FT                   /protein_id="ADK86938.1"
FT                   /translation="MLLRSVWYKLGSLLIILPLTGCGYVRLKRANFQTDFTINRIPTQG
FT                   DVYHDNYDLTFSLNFATSSKDSYGTGWLIDWKGDENKPSNTDPFLIYLATNLHVVDALR
FT                   NPQDYEPYNKDSNGQDYGNRDITHFFALGKYTDPGLLGVETKEQSAFISIQTSAIPKTA
FT                   YTANDFVDYQYDSLTKQWNKKSDQKDQTQEQTVTGQSWSYKPAYADFAVIEVPLFLDNV
FT                   RDKQVFDYFVKPAIETYKKLGDTAQLFTEQNLKELEKETYIMLGYPVVESNIYAHILGQ
FT                   GKELRVTQQVNNQPVKKNYVLQTITKEQHTLDITREIPTLIQNKSLSGDFVGSKLLSQE
FT                   EQQQEHAFLGNLNQGIIDFARLSNFNLQYHNREYQQYGKGLALANTNFSGGSSGTLVLN
FT                   QQKQISGVYFGVLEFGGTNGTNRESSIGVGQILRVKDDAQLQQHSHNNLLSQLGSSHNS
FT                   ITYDIIFGNKDTKNYYAQFAKKHQTHLYSQISSSNQQELKYVDNDPNLKIKEEAAKSTV
FT                   QNLTVYS"
FT   gene            107250..108683
FT                   /locus_tag="MPNE_0096"
FT   CDS_pept        107250..108683
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86812"
FT                   /db_xref="GOA:A0A0H3DNN1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNN1"
FT                   /protein_id="ADK86812.1"
FT                   /translation="MQLTTSQQMQTNFLTTNKHHLLKYTNGLIWCWWLFVISLVLASST
FT                   FRGFFLGTINIVNFVFWILALIFGVAVAFINGVLSSELKENSVFQEEQKRFFLGFFFPQ
FT                   MAFCNALWLKLKLSYLNSERENLLEKIKQKLKKLTLSVFVVWGIYCVLATSIYLPNALR
FT                   ILNIYQIPNLIALINNRLSEILPDGNRYFLGHSSFAFHYYEIVSRIPFLVFFIIPTITL
FT                   ITLGCYLFAYLRFINSNKLRKPLSTLSIVIMLTDVVGIIQWIIIDILLIWLNVPFVIFV
FT                   IFWVIKLVLPLAMIGTFVSSLTIYKKVTSKEWLAIKEEQINLTTMNINMGEQSSKNMNS
FT                   FENHESNERNSLQIYQQHSSMMSETKRKQSSLSYDARILLPKSPYNTKKTLFLIIFFSI
FT                   ISLILATIGSVFISFAIVQISIPFYVIGGVIWFFTFIFFIVTFVAIVRFIAEYFANKLN
FT                   ALTWKVDLSGLEIKPKEEE"
FT   gene            109573..109770
FT                   /locus_tag="MPNE_0097"
FT   CDS_pept        109573..109770
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0097"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86929"
FT                   /db_xref="GOA:A0A0H3DL15"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL15"
FT                   /protein_id="ADK86929.1"
FT                   /translation="MLTVFIFIDVFGLVVSVLFGYLLPLAFDSLPFSVNLTREVFLSLA
FT                   MIVIFANSVIFTLRQKRNID"
FT   gene            110863..111090
FT                   /locus_tag="MPNE_0098"
FT   CDS_pept        110863..111090
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0098"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87266"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLU2"
FT                   /protein_id="ADK87266.1"
FT                   /translation="MIEINNLTALERDEKVETEDINTNVIANTYTVQANVPTAFQTSET
FT                   NSNTVTNVPKSPELISIQRLERLKNRYTFL"
FT   gene            111169..111333
FT                   /locus_tag="MPNE_0099"
FT   CDS_pept        111169..111333
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0099"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87217"
FT                   /db_xref="GOA:A0A0H3DNC6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNC6"
FT                   /protein_id="ADK87217.1"
FT                   /translation="MAFLSFIDAVAFICFIVFLVLAISTSRRIRDLEMMQQMKELVDKK
FT                   QETPEQNKQ"
FT   gene            111450..112589
FT                   /locus_tag="MPNE_0100"
FT   CDS_pept        111450..112589
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0100"
FT                   /product="type I restriction modification DNA specificity
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86981"
FT                   /db_xref="GOA:A0A0H3DMM3"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMM3"
FT                   /protein_id="ADK86981.1"
FT                   /translation="MEIKTYKIKDICEASHGREINTKYLRENQGIYPVYSSATSNEGEM
FT                   GRIKTYDFDGEYVTWTTRWSYAGSIYYRNGKFSASSNCGILKVLNKEINPKFLAYALKK
FT                   EAKKFVNTTSAIPILRTQKVVEIPIDFPPLQIQEKIATILDTFTELSAELSAELSAELS
FT                   AELSAELRERKKQYAFYRDYLLNPKNWKEENKYYKLGEIAQKVLVGGEKPADFSKEKNE
FT                   VYKYPILSNNSKAEEFLVYSKTFRVEEKSITVSARGTIGAVFYRDFAYLPAVSLICFVP
FT                   KEEFDIRFLFHALRAIKFKKQGSATGQLTVAQFKEYGIHVPSLKKQKEIAAILDPLYSF
FT                   FTDLNEGIPAEIELCKKQLDYYQNFLFNWVQNQKAASIL"
FT   gene            113032..113733
FT                   /locus_tag="MPNE_0101"
FT   CDS_pept        113032..113733
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86826"
FT                   /db_xref="GOA:A0A0H3DM64"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM64"
FT                   /protein_id="ADK86826.1"
FT                   /translation="MGNIGINSLLFGQLSICQQFQNEKKWLLWAIFIPQLTLTNSLLVR
FT                   EKLKNILDANSNSSTQKNRLTWWMIGFFVVWFIQLFLGFLIYLPAYSAEARLNLNLSFL
FT                   SFALNSPLPVGHAANGYFFLGLIFAFMDLTIIVLLVISGFILKHLIQTNKTEHKKYQLM
FT                   FFWTALAIDVIGLIMTISFIVVSFSLEKGDDYLLKTPFFGSSLMALITIATLVTTILLF
FT                   IRFNKKRLLKN"
FT   gene            113923..114540
FT                   /pseudo
FT                   /locus_tag="MPNE_0102"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            114555..115064
FT                   /pseudo
FT                   /locus_tag="MPNE_0103"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            115338..115823
FT                   /pseudo
FT                   /gene="mgpC_1"
FT                   /locus_tag="MPNE_0104"
FT                   /note="MgpC protein; this gene contains a frame shift which
FT                   may be the result of a sequencing error"
FT   gene            116257..116679
FT                   /locus_tag="MPNE_0105"
FT   CDS_pept        116257..116679
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87245"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLI6"
FT                   /protein_id="ADK87245.1"
FT                   /translation="MKEKIPFYNEKEFHDMMKKTKKGTFSGWYIIDKDNKSVEFSGNFN
FT                   RQFKLNKPVIPVNTEYVTRKEFNEYKDSNDQRLTKIETTLAAQGEQIRIQGEQIKELQI
FT                   EQKAQGKTLKLILQTLQKMSDRLNKMDVRLDKLESK"
FT   gene            116887..117144
FT                   /locus_tag="MPNE_0106"
FT   CDS_pept        116887..117144
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0106"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86712"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DJX7"
FT                   /protein_id="ADK86712.1"
FT                   /translation="MKVLFTFQTLQRKEDLNMKKVKALRNLFLEKAEEKLKYPKIASMV
FT                   AYFDPKEDGTCEFIMKIKTVNEVTDNEVKSEEKPLGTWKS"
FT   gene            117203..117898
FT                   /locus_tag="MPNE_0107"
FT   CDS_pept        117203..117898
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03257"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87133"
FT                   /db_xref="InterPro:IPR004940"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN54"
FT                   /protein_id="ADK87133.1"
FT                   /translation="MVFLFSPTLSRFSTGFNLAGTVLDQVLDYVPWIGNGYRYGNDHRG
FT                   SNSSTSGVTTQGQSQNASSNEPAPTFSNVGVGLKANVQATLGGSQTTTTKGSPWRTLDP
FT                   ANLQLWTGAGWRNDKASNKQSDENHTTFKSATGMGQQGQSGTSAGNPDALKQDKITKEN
FT                   SGNLKTEDGTATNSTTAFASNYTNLPPTADWPNALSFTNKNNAQRAQLFLRGLLGSIPV
FT                   LVNKSGENN"
FT   gene            118290..119805
FT                   /gene="rrs"
FT                   /locus_tag="MPNE_0108"
FT   rRNA            118290..119805
FT                   /gene="rrs"
FT                   /locus_tag="MPNE_0108"
FT                   /product="16S ribosomal RNA"
FT   gene            120037..122942
FT                   /gene="rrl"
FT                   /locus_tag="MPNE_0109"
FT   rRNA            120037..122942
FT                   /gene="rrl"
FT                   /locus_tag="MPNE_0109"
FT                   /product="23S ribosomal RNA"
FT   gene            122980..123087
FT                   /gene="rrf"
FT                   /locus_tag="MPNE_0110"
FT   rRNA            122980..123087
FT                   /gene="rrf"
FT                   /locus_tag="MPNE_0110"
FT                   /product="5S ribosomal RNA"
FT   gene            123238..124830
FT                   /locus_tag="MPNE_0111"
FT   CDS_pept        123238..124830
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0111"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87221"
FT                   /db_xref="GOA:A0A0H3DLQ0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLQ0"
FT                   /protein_id="ADK87221.1"
FT                   /translation="MVLVKTKADFFMNQQLNTTRKSTAARGRMGLVGGILLVIGTCIGA
FT                   GIFFKSERVLQNMGGNTTLALLVWLMAGITVILMGLALVEITAKAAFDDLALLSWTQKF
FT                   TNNTFYKACKRFLIWIYLPTTFFFMPLYLVQSLQDGLRGFGVANHFNTPHDWAIWMVIV
FT                   LLINLWFFFTSGLSVKWTSVQNVVLLLLKVIPLIAVVILALWLGASAEQMERQPVVPVK
FT                   DFTAILPFFGWFSAMGAIFFAFDGFYVSAAAKTQLKKPKKLPQVMLLGLGIVVLIYSLI
FT                   ALSVSLTTPNGAFSGLGDWLKHKKLGWFFGVLNLLIALGVAGIINGFVMWTGKLTQSLI
FT                   KSGELWVPDKCKLCLNKPKPVVGLIHAGILMVLTTVALSSLGGLLYLPKVNASYDGKGF
FT                   KSMGCLLEFADLIATWTSVGIFWFLGLVLLGGLLQIKKPKRWYFRTTGWLAVVVIGLTT
FT                   LVVMVQPFVDLGIAVFNRSYERIVANTILIAILVIIVLVMFFPTEPIKLRLWRKRIQAM
FT                   EACGEDCDACVEY"
FT   gene            125006..126631
FT                   /locus_tag="MPNE_0112"
FT   CDS_pept        125006..126631
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03305"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86890"
FT                   /db_xref="InterPro:IPR004984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM94"
FT                   /protein_id="ADK86890.1"
FT                   /translation="MQFKYGALIFSGFLGLSIVLASCGARGKFDQVDDGKIKLASSLTS
FT                   RSASAALQKVVEKYNKVKGVNDYPIEITQIAGGYDGGRTDLQTRVSVKDKTSFYNMILN
FT                   YPDLVSVLARNGMELPFDGVNVDKLSPNFLKFNERISGVAKKANYAIPISMSTDILILN
FT                   APVLHYILNSVKKNDGNTKVQVKAQSKDSQTKVKGTMEIGTDESTKNLWSDIQKKAGEN
FT                   GKATTEGTKKAAAKSTHLTLLTKSEQSTQGNNGASESDKKIEETWGTYSEVDGGLKNYT
FT                   FKADVFDTWHGLIDFSTRVAKSFKNKVSDISTKKGTDIQGVLGLDSTPNALFTSVFAAG
FT                   DSNFDNFFYKVKDGRADFSNFNENGTSYKNLEKVFNDYKKLTDSNGLFVNKGGSYTSNF
FT                   QKFHQLAYSISSSSGYAYAFAGENSKRLKFNDDTFIEYPSFTQEIHAPGQSSQKEGGQQ
FT                   QSNSKDNGNLLGTFTIEAAKSKTKTEVKKTEDTQNQGKKAEGTPNQGKKAEGTENQGKT
FT                   IFLYKTSIPNDKQDGVDAVLIKDK"
FT   gene            126932..127372
FT                   /locus_tag="MPNE_0113"
FT   CDS_pept        126932..127372
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0113"
FT                   /product="putative mycoplasma lipoprotein, C-terminal
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF03202"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87114"
FT                   /db_xref="InterPro:IPR004890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPJ6"
FT                   /protein_id="ADK87114.1"
FT                   /translation="MTQGPNLIGIHTNTKENEETQKFVNWFLNTSLTWDNNESKTPAQY
FT                   FTESASYILPLKETFTGSNNKGQSGKNDGKNSNNTFKAKALELFKEQSENKIVGYSDPS
FT                   DFRGGKFRESIGSAFNATVNSHVDFNTFVANFRANLGSGYDK"
FT   gene            127446..127769
FT                   /pseudo
FT                   /locus_tag="MPNE_0114"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            127924..129099
FT                   /pseudo
FT                   /locus_tag="MPNE_0115"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            129238..129438
FT                   /locus_tag="MPNE_0116"
FT   CDS_pept        129238..129438
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0116"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86769"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKK2"
FT                   /protein_id="ADK86769.1"
FT                   /translation="MQLVPLFSQNFLQVLLALLNKPVNLFSENTTMKTNKKYAFAALLM
FT                   QAQAKLPNSFKFFLSKKGGMA"
FT   gene            129438..129989
FT                   /locus_tag="MPNE_0117"
FT   CDS_pept        129438..129989
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86689"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLN2"
FT                   /protein_id="ADK86689.1"
FT                   /translation="MKEKIPFYNEKEFHDMVKKTKKGTFSGWYIIDKDNKSVEFSGSFN
FT                   RQFKLNKPVIPVNTEYVTRKEFNEYKVSNDQRLTKIETTLAAQGEQINKLTQTVEKQGE
FT                   QINQLVQVVLLHGEQINKLTQTVEKQGEQIKELQVEQKAQVEQIKAQGKQIKAQGKTLK
FT                   SILQALGGINKRLDKIDPPK"
FT   gene            130446..131723
FT                   /pseudo
FT                   /locus_tag="MPNE_0118"
FT                   /note="putative adhesin P1; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            131914..133641
FT                   /pseudo
FT                   /gene="mgpC_2"
FT                   /locus_tag="MPNE_0119"
FT                   /note="MgpC protein; this gene contains a frame shift which
FT                   may be the result of a sequencing error; identified by
FT                   match to protein family HMM PF05220"
FT   gene            134111..134683
FT                   /locus_tag="MPNE_0120"
FT   CDS_pept        134111..134683
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86680"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLM3"
FT                   /protein_id="ADK86680.1"
FT                   /translation="MSKNKFFTITKEQYRKFTRNKIELLFKVQCTEKKKGKRRFKIFQQ
FT                   VEDKPKPPVKIIEKESKGPEEPKDPGIKNGPKGPGGPKGPKKPPVPDDPDTPDVPKGPK
FT                   EPGGSKGPGGPDDPNGGKKKVPKPDKYVTHRELDEKLTEFHDKLMVELDGKFATKADLK
FT                   RVEDKVDVLFELQKTQDEQIKVQGKQI"
FT   gene            135704..136729
FT                   /gene="pheS"
FT                   /locus_tag="MPNE_0121"
FT   CDS_pept        135704..136729
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pheS"
FT                   /locus_tag="MPNE_0121"
FT                   /product="phenylalanine--tRNA ligase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01409;
FT                   match to protein family HMM TIGR00468"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86770"
FT                   /db_xref="GOA:A0A0H3DLY2"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLY2"
FT                   /protein_id="ADK86770.1"
FT                   /translation="MIDQSKLIERWKTTFETAQNPTELLAFKNSFRNADLKPLLSQIKE
FT                   TTDIETKRHLGQLYKQLESTLQTLHDTQLQVFTQAQSSSVLTHGDVMLLATSFAPGSSN
FT                   IIYQVIDELVNYFKKFLFTVNYDSELTTIADCFDLLNIPKDHPSRNLTDTFYLDKNRLL
FT                   RTHCTAATLRAVKETKKSNNPDIRIASFGAVFRKDDDDATHSHQFNQLDFMWIKKDFSL
FT                   TNLKWFMQNMINHIFGENTSARFRLSHFPFTEPSFEIDIRCWLCQNGCGVCKKTRWIEV
FT                   LGAGILHPQVMANMGFSDTDNIRGIAAGIGIERLVMLKHGISDIRDLYDNNFKFLAQFT
FT                   D"
FT   gene            136732..139149
FT                   /gene="pheT"
FT                   /locus_tag="MPNE_0122"
FT   CDS_pept        136732..139149
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pheT"
FT                   /locus_tag="MPNE_0122"
FT                   /product="phenylalanine--tRNA ligase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01588;
FT                   match to protein family HMM PF03483; match to protein
FT                   family HMM PF03484; match to protein family HMM TIGR00472"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87061"
FT                   /db_xref="GOA:A0A0H3DMS5"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMS5"
FT                   /protein_id="ADK87061.1"
FT                   /translation="MLISKKTLAVLIPEITHVSNNEICEKLQQIGIEVEAIRAFKNPDY
FT                   LQLGILRAVTPHPHDNHLYVCQVQIDKNKQLNVVTGAVNIVDPNNLNKHVIVAKKGAEL
FT                   LNGLIIKTKNIKGIISDGMLCSYVDINPFSKHLIADGDDTHAIVLDNINRDEFGDYLSF
FT                   LNLDDVVFEVTLPTNRSDLQSLIFLAKELAAVLKRPIFLEQKTTMTLREFYRFPLNLRN
FT                   RAQANFFGGLFLRDVAITSSPWTTKGLLINQELRPVNCFVDQANMVTVYTGQPIHCHDA
FT                   DKIHGSVELKLATQLETMLALDNKEYEIKPGDLVVADEQGTIAIVGIIGSKRTMVDNTT
FT                   NNIFFEVVNYNHERIKQTAQRLGVANFASRLMSKPISLQATENCLNYLQNNFLNPESIG
FT                   KISKFSSTIKAPAFNRKIYLNFNQLRELIGVTKKQLNDYMIRNYLTSLGFKMENQIARA
FT                   PAYRQDITVWQDISEELLKILDLNKIKEDEILSTTKLEKHEKLNAYDALQKLRTKLQTL
FT                   GFHNVITYQLISPERARNFNLFGLSNLWEIKNPLSNERSVLRVGLIDSLLRVIQKNAAY
FT                   KNKLGNIFEFSFVKTKDSNQLHIAALWLEKMFGSTYQKDQGVSVDIPAMKGLAQLIISN
FT                   FGFNCDFEPITEGEYFTKNVGLKLVVFNEQIGYVGLIKDELLAPYDLKGRPVYGLEINL
FT                   DRLLNSLNRLERSYTPISKLQDVFKDITFSFPRDESHFETFVKAIKKLQTIFKWELISV
FT                   FDTEKDGVPITKYTVRYYLKNFTNTPLTLEQIKAVETQLKQQCELAKIALDL"
FT   gene            139262..139570
FT                   /pseudo
FT                   /locus_tag="MPNE_0123"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            139624..140016
FT                   /pseudo
FT                   /locus_tag="MPNE_0124"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            140018..141232
FT                   /pseudo
FT                   /locus_tag="MPNE_0125"
FT                   /note="Eco57I restriction endonuclease; this gene contains
FT                   a frame shift which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF07669"
FT   gene            141917..144493
FT                   /pseudo
FT                   /locus_tag="MPNE_0126"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            144765..144980
FT                   /locus_tag="MPNE_0127"
FT   CDS_pept        144765..144980
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0127"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87130"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL70"
FT                   /protein_id="ADK87130.1"
FT                   /translation="MNKTDPKVFSVAVGIEMDEFSKIQKFFKVENMNRLIEQFSFRESV
FT                   KTENTEKSQYRNSFNWFGFGPDSLKS"
FT   gene            144997..146262
FT                   /pseudo
FT                   /locus_tag="MPNE_0128"
FT                   /note="Eco57I restriction endonuclease; this gene contains
FT                   a frame shift which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF07669"
FT   gene            147129..147521
FT                   /pseudo
FT                   /locus_tag="MPNE_0129"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            147503..148741
FT                   /pseudo
FT                   /locus_tag="MPNE_0130"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            148731..150533
FT                   /locus_tag="MPNE_0131"
FT   CDS_pept        148731..150533
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0131"
FT                   /product="ChOline/Carnitine o-acyltransferase"
FT                   /note="identified by match to protein family HMM PF00755"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86659"
FT                   /db_xref="GOA:A0A0H3DLJ3"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="InterPro:IPR039551"
FT                   /db_xref="InterPro:IPR042231"
FT                   /db_xref="InterPro:IPR042232"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLJ3"
FT                   /protein_id="ADK86659.1"
FT                   /translation="MDTKLTPPWLRQENNLLNPEVTQRLFINQDNIPNLPTEAPQVYLA
FT                   RFLEWVEPLVSKVKFVKAQAAVQDYLNSKACAQIETIIAERAQNTHSSWLANWWVQYAY
FT                   LTSTGPVSPEVNAPYYLELPTVGWSQAELAAALSAQLWHIYQQVQKRQLTSFSVKDKLF
FT                   SLDTLQSIFASCQIHRADGDVYFVNDQPANFIVVIKNNVFYKLVIDNSGSLEQLQAQLQ
FT                   LSFVQILDNELSHPPHWNLLTATTTKAESQSLLDQLWAQNPEMLLDIYNSAFIVNLDNV
FT                   ELTTPLQLLRNSTWTPNFNRWHAKGIQLVITKNAQLVILADHTSFDGSSVATLANIFVS
FT                   KLQKVNTEGASALTPTMLSFPTVDQDKQKYFKQLSKNFKDYVYNAVMFELKWDWFTKPL
FT                   IKAKGIKNSEAFIHLCYQIAQYQTNKKLQNTYVAVDMRQYFRGRTECLRPLSKQSVAFV
FT                   KRYCKDPKGTLKQFRKYYPAIESLHFEKTRLAQKGSGVNRHLLGAYLAWNEHQDTIAKP
FT                   ALFETKAWKTIAANPLSTSSIVDKYLRNFSFDPVEPNGIGIAYAIDDTNFRAILSVYQH
FT                   NLQYLKDWMKHFEQTVKTILKTLK"
FT   gene            150623..151228
FT                   /gene="infC"
FT                   /locus_tag="MPNE_0132"
FT   CDS_pept        150623..151228
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="infC"
FT                   /locus_tag="MPNE_0132"
FT                   /product="translation initiation factor IF-3"
FT                   /note="identified by match to protein family HMM PF00707;
FT                   match to protein family HMM PF05198; match to protein
FT                   family HMM TIGR00168"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87212"
FT                   /db_xref="GOA:A0A0H3DNC0"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNC0"
FT                   /protein_id="ADK87212.1"
FT                   /translation="MPLILDQGCFVSESRFHRLAQNIKQGSRREREQKPLINDKIGFNE
FT                   FILIDENGSNLGTVRRTDALKMAEEKQLDLVLIGSNPAKPIVKLLDFGRYTYDLKRKKR
FT                   QSKKNQTIIQIKEVVVKPTIAKHDLEFKAKQTTGWAEKGYHVKFVVRAFGRVSTRIELI
FT                   EKVFNDFYLLVEPAVEVQKPLTASSKTMYSALLIPRKK"
FT   gene            151234..151413
FT                   /gene="rpmI"
FT                   /locus_tag="MPNE_0133"
FT   CDS_pept        151234..151413
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmI"
FT                   /locus_tag="MPNE_0133"
FT                   /product="ribosomal protein L35"
FT                   /note="identified by match to protein family HMM PF01632;
FT                   match to protein family HMM TIGR00001"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86822"
FT                   /db_xref="GOA:A0A0H3DNN8"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNN8"
FT                   /protein_id="ADK86822.1"
FT                   /translation="MKVKSAAKKRFKLTKSGQIKRKHAYTSHLAPHKTTKQKRHLRKQG
FT                   TVSASDFKRIGNLI"
FT   gene            151424..151807
FT                   /gene="rplT"
FT                   /locus_tag="MPNE_0135"
FT   CDS_pept        151424..151807
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplT"
FT                   /locus_tag="MPNE_0135"
FT                   /product="ribosomal protein L20"
FT                   /note="identified by match to protein family HMM PF00453;
FT                   match to protein family HMM TIGR01032"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87005"
FT                   /db_xref="GOA:A0A0H3DL84"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL84"
FT                   /protein_id="ADK87005.1"
FT                   /translation="MRIKGGKQTRVRRKKWLKQASGSFGTRHASYKVAKQTVIQAAKYA
FT                   YRDRRNKKRDFRSLWILRLNAALREQGMTYSVFINLLKKHNIEINRKVLSELAIKEPSK
FT                   FNLIVQKVKSEQPKAAKPAALGN"
FT   gene            complement(151782..152492)
FT                   /gene="rnhB"
FT                   /locus_tag="MPNE_0134"
FT   CDS_pept        complement(151782..152492)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rnhB"
FT                   /locus_tag="MPNE_0134"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF01351"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86869"
FT                   /db_xref="GOA:A0A0H3DKV9"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKV9"
FT                   /protein_id="ADK86869.1"
FT                   /translation="MQHANTTALYLIGSDESGKGDSFGGIAVSAVLIHKDKINTLHQIG
FT                   VGDSKQFNDYQIKALVPKIKAAVHDQVTLSVDAKTYNQLVQSFKNVNVMLTFLHCKVYH
FT                   QLLQQNKLTAQQCDISIDEFANVKLFTQYTQKLTSLQNELKELVIPNHFLIRGESYSKV
FT                   IAAASILARAAFIAQMEQLSHQYGVQFPKGSAHGIVEALHLLKTKRQFHKFAQYSAVCK
FT                   TTFKNVASFLKQLA"
FT   gene            152548..155280
FT                   /gene="topJ"
FT                   /locus_tag="MPNE_0136"
FT   CDS_pept        152548..155280
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="topJ"
FT                   /locus_tag="MPNE_0136"
FT                   /product="terminal organelle assembly protein TopJ"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM TIGR03834; match to protein
FT                   family HMM TIGR03835"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86991"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR022465"
FT                   /db_xref="InterPro:IPR022466"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="InterPro:IPR038145"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMN0"
FT                   /protein_id="ADK86991.1"
FT                   /translation="MAEAKRDYYEVLGLSRDADDNDIKKAFRKLAKKYHPDRNKAPDAA
FT                   QIFAEINEANDVLSNPKKRANYDKYGHDGVDNEGGFAFQADVFDSFFEEIEKSGAFDNL
FT                   SESNTKKKEKTKTKKKGWFWGKSKQEESTSDTTEYADVDAGLEDYPPQSDYPDDIPDVD
FT                   ARIEEVDQSAYADDIPDVDAGMDWEQNAEVANSASEIIPDVDAGLADEFNTSSAAPQAS
FT                   DWEAMIGNPEYGYFDAAGEWNWKGFFDEAGQWVWLEETEPSSVSNDETTTDSDAVTAAT
FT                   TVEETDQDSWTANSAPESVDVETPVELQPETEPEPIITLSSEPVEAPASVVIEPTPETE
FT                   ETTSAVEMDASVKADVSDEADATNEPTEQDTISEPEQETDAAALEEINHTTADLEPAEV
FT                   SATNDLEQDVVEKVNFSEPESTVDTAATDPVVEQATETSTNGFKFFNFSSFVLSDQNPN
FT                   PQTPTHHEEDAAAPEPTVDETSGESTAPEVTIAESTVELETAAEINNPATFVEEYLQPT
FT                   KTTVVDKLDEPTVAKPTVSDSENSVAPEPEFVAGPEQTFSWKPAISETEEIPLTAVEPA
FT                   SETQTLIAEDVTSPVTPTATAIPAPSINAVPTAPVAETFEAAVDFLKEAAKIEAQLPLV
FT                   PTVPEQIDGTDPSLLTQWDEYLEKTRKLFHKLFLTEQLPFIVKTDQFEIVDPNLDEHNV
FT                   NLIYTEHVPQICFLNEQLKEIRYTRKLVDPQTQVTTTESITLEVQLSHKSQTEAIAIFK
FT                   GFGHDYGSGCGDLKVVLKVIPSVFFQLQADGLHTAALVDPLVAYNGGLIDFFGPVNSFK
FT                   VDIEGGIANNDLIEFNQLGVLRTKTKRGSLYVHLYYSSVAKKGTKTNCQVQQFFDLVHV
FT                   EYKLLNYNLKQLHNYHSALTAQKKTLDRKSYQCLAVESH"
FT   gene            155303..155956
FT                   /gene="grpE"
FT                   /locus_tag="MPNE_0137"
FT   CDS_pept        155303..155956
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="grpE"
FT                   /locus_tag="MPNE_0137"
FT                   /product="co-chaperone GrpE"
FT                   /note="identified by match to protein family HMM PF01025"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87219"
FT                   /db_xref="GOA:A0A0H3DPW1"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPW1"
FT                   /protein_id="ADK87219.1"
FT                   /translation="MSENSLTITEILSSIRTLLVKHNKAKVTQIEKELLQAVAELEKKF
FT                   KQQVQNFNELQQKIPNLQKVNEEFRLKVEKIQEEAQKKIQEKVAELTIKSKEELENAKK
FT                   YVIEKSIDQPLIIIDQFEIALSYAQKDPQVKNYTTGFNMVLDAFSRWLEGFGVTKIAIE
FT                   PGAQFDEKVMAALEAVPSDQPANTVVKVSKSGYKLHDKVIRFASVVVSQGNKTE"
FT   gene            155956..156321
FT                   /locus_tag="MPNE_0138"
FT   CDS_pept        155956..156321
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87183"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNB2"
FT                   /protein_id="ADK87183.1"
FT                   /translation="MSTNKRRTIQIEITEEHFKDLEKALEALKGTQLPFSTTVEQFVEL
FT                   ILSNYVATSNKISNLAESGFDVASIQQELEKIGSAAGADDALKSFLDELLKTSQKSFSN
FT                   TKDGKKNDDDNNSSSKS"
FT   gene            complement(156339..156412)
FT                   /locus_tag="MPNE_0139"
FT   tRNA            complement(156339..156412)
FT                   /locus_tag="MPNE_0139"
FT                   /product="tRNA-Thr"
FT   gene            156447..158354
FT                   /gene="parE"
FT                   /locus_tag="MPNE_0140"
FT   CDS_pept        156447..158354
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="parE"
FT                   /locus_tag="MPNE_0140"
FT                   /product="DNA topoisomerase IV, B subunit"
FT                   /EC_number="5.99.1.-"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01058"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86799"
FT                   /db_xref="GOA:A0A0H3DKM6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005740"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKM6"
FT                   /protein_id="ADK86799.1"
FT                   /translation="MKNNYSEANIKILKGLDAVKKRPGMYIGSTDSRGFHHLLWEILDN
FT                   CVDEVLSGFANTIAVVLHAENQITVSDNGRGIPFETHSDSKISTIDTVFTYLHAGGKFD
FT                   NDSYKIAGGLHGVGASVVNALSDQLQVTVKRQGKVYRSVYENGGKIKQKAHCIGNAKID
FT                   EHGTSVTFRPDPKVFKKIHFDSELIRARLKELAFLFKKLQLTFVDETGSGEKEVFFTEA
FT                   GISQYLDELNADSKQIAQKIFVSGTEDDIELEAVFQFIDGEDEKLLSFANSIRTSEGGS
FT                   HEAGFRQSVGDVINNYCRKYNFLKERDKNFEASEIREGLNGIIKVNLPEKIIAFEGQTK
FT                   SKLFSKEVKAVVQKLTQKHFFQFLERNSVDAKLIVEKLFYNRKLRQELKQQRQIKKNLS
FT                   NPKAERILFGKLAPAQSKKVAERELFVVEGDSAGGTAKMGRDRFLQAILPLRGKVLNVE
FT                   KINNKKEAINNEELLTLIFCIGTGIGNNFTIRDRKYDKIIIMTDADNDGAHIQILLLTF
FT                   FYRYMKPLIEKGHIYLALPPLYKFEGRDKKARYLWTEQELEQYRAKHSHFNVQRYKGLG
FT                   EMNADQLWETTMNPMTRKLIQIKLDNFIQAEKQINVFMGDKTELRKSWIEANINFSSEN
FT                   "
FT   gene            158354..160723
FT                   /gene="parC"
FT                   /locus_tag="MPNE_0142"
FT   CDS_pept        158354..160723
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="parC"
FT                   /locus_tag="MPNE_0142"
FT                   /product="DNA topoisomerase IV, A subunit"
FT                   /EC_number="5.99.1.-"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01061"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86685"
FT                   /db_xref="GOA:A0A0H3DLN1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005741"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLN1"
FT                   /protein_id="ADK86685.1"
FT                   /translation="MEKNKQALLLQAIEDVFAFSFSKYAKYIIQDRALPDLRDGLKPVQ
FT                   RRILYGMYQMGLKPTSPYKKSARAVGEIMGKYHPHGDASIYDAIVRMSQAWKNNLTTIS
FT                   IHGNNGSIDGDNAAAMRYTEARLSPYGFELLKDIEKQLVPFVNNFDDSEVEPSVLPTLL
FT                   PNLFINGTSGIAAGYATNIAPHNVGELLDGLSYRIENPDCDLKAILKIVKGPDFPTGGL
FT                   VYFEQELANIYQTGKGKFVIQAKYETNTAFGQNQIVITEIPYETVKANIVKQIEELISD
FT                   NKLSALESVIDSSDRSGIRIIINHKDFLSADKIMAFLFKHTQLQVNFNLNNTVIANRCP
FT                   VRVGLLAYFDQFLAFAHELIINSAKYDLALANKRLEIIKGLIKAVSMIDEIIRLIRRAT
FT                   DKQDAKTKLIDKYAFTLNQAEAIVSLRLYQLTNTDIKVLFAEQKELEQTIQTAECLIAK
FT                   PQARNQLLQAQFFQYKKQFNQPRRAQIVGLIEKQKVQDSDFIEHKEVGLLISHDGIYFK
FT                   FEPEQLAKHLVEFKSEQDQLIFGGVVQNSDYFFMVTSLGNIITVPIYKTLSNTKTKMNE
FT                   LLAKKPILMEDEKLVLAGIVNPDKMEQQLLVLTSQCGMVKRVELSKVINTKQIKSSCCM
FT                   ALRERDKLVNAFVQTKREPKLVCLVSSSNSFATFLAEEIPIISNKGIGVKGIKLKAEEK
FT                   VRFAMPLQDNDALVVINSDGGVYNFEVVELAVASRMSVGKKLIPKTKTPVSCFAANKHS
FT                   EIIGHRGKNGSDLFTLNELNRLPKSTVSQMRLFKWS"
FT   gene            complement(160710..161765)
FT                   /gene="hrcA"
FT                   /locus_tag="MPNE_0141"
FT   CDS_pept        complement(160710..161765)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="hrcA"
FT                   /locus_tag="MPNE_0141"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="identified by match to protein family HMM PF01628;
FT                   match to protein family HMM TIGR00331"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86753"
FT                   /db_xref="GOA:A0A0H3DK47"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK47"
FT                   /protein_id="ADK86753.1"
FT                   /translation="MKNLTTRQAQILKAIINEYIAYPVPVGSKLLTKKYFKNLSGGTLR
FT                   NEMAVLEKEGYLKKNHISSGRIPSQLGYQYYVKLLTKNDDKSNLKTRLRAIILQKHKTI
FT                   DEIIELGVKFINEMVNLPVVLTHFSSDEVLKKIDLIMLDQSCALLLLVSASGNVFKKTI
FT                   SYANQRQFEDIMVCVRIFNDRIIDTRFCDIAQHLDVLKEIIRSKVHEYQYVIDEILFKL
FT                   FNFEEFQQARKQVYGIHYLAQQPEFANQERLTRILNLLEDTSVWQQMAFMNQNNQTTNI
FT                   TFGDKLGLEGEEVSVASTLINTTNESKHQLAIVGPTRMDYQKVKALLLTLKEEIEEYDK
FT                   QLHGGKTTSST"
FT   gene            161806..163599
FT                   /pseudo
FT                   /gene="uvrC"
FT                   /locus_tag="MPNE_0143"
FT                   /note="excinuclease ABC, C subunit; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01541; match to
FT                   protein family HMM PF08459; match to protein family HMM
FT                   TIGR00194"
FT   gene            163592..164071
FT                   /locus_tag="MPNE_0144"
FT   CDS_pept        163592..164071
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0144"
FT                   /product="phosphodiesterase family protein"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00040"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86937"
FT                   /db_xref="GOA:A0A0H3DP00"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR020935"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP00"
FT                   /protein_id="ADK86937.1"
FT                   /translation="MTKVLVLSDTHGYNDRWLAVMKLHNPDVVIHAGDHLTTKKFMDQN
FT                   ATFWVAGNHDVVGEEIQMFELEGIQFVLMHGHQAPRHDLKQWYKMLVDQAKSYLCDVLI
FT                   VGHSHIEHYETIDGIQVINPGSLEIPRNPRKLPTYCNLNLSQGRISDLTFHFPRD"
FT   gene            164462..165235
FT                   /locus_tag="MPNE_0145"
FT   CDS_pept        164462..165235
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86730"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLV1"
FT                   /protein_id="ADK86730.1"
FT                   /translation="MFKLKINNFQLGFKLVQWPVTNHLLKHFYVFPINNKGGLAIKRII
FT                   SLALFKKRLNKDKINNCHVWEEELPDGSYDMGFNGNFNHMEKRKSGYVTQKQFSEFKDA
FT                   NNQRLIKIETTLAIQGEQINKLTQTVEKQGEQINQLVQVVLLQGEQIRELQVEQKAQRQ
FT                   EFNARMDRLENLLVESIESTNNRFDSMERRLDSMDSRLDSMENRLDSMEGRLDSMENRL
FT                   DSMEGCLDFVEGRLDSMETRLDSMETRLDKVDPPK"
FT   gene            165774..166907
FT                   /pseudo
FT                   /locus_tag="MPNE_0146"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            167070..167210
FT                   /locus_tag="MPNE_0147"
FT   CDS_pept        167070..167210
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0147"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86686"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN90"
FT                   /protein_id="ADK86686.1"
FT                   /translation="METTAKSIDCKELGLSVTTKQQLHKLTLATIWLWDSLFFVFSYFC
FT                   L"
FT   gene            167162..167710
FT                   /pseudo
FT                   /locus_tag="MPNE_0148"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            167670..168056
FT                   /locus_tag="MPNE_0149"
FT   CDS_pept        167670..168056
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87165"
FT                   /db_xref="GOA:A0A0H3DLA3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLA3"
FT                   /protein_id="ADK87165.1"
FT                   /translation="MNTFQLKELGLPIKEIAVPLGTLVFLFVVIITLIPLLIIGNLIWT
FT                   NLRLIERENTQQYQLVFGYSLIVSDIVGFAIVFFGAILGTNLKSVELFIALGWMMMLGS
FT                   LIALGTTVNLVSSIYLYIKLALKR"
FT   gene            168126..168677
FT                   /locus_tag="MPNE_0150"
FT   CDS_pept        168126..168677
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86700"
FT                   /db_xref="InterPro:IPR004940"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLQ3"
FT                   /protein_id="ADK86700.1"
FT                   /translation="MLDYVPWIGNGYRYGNNHRGVDDITAPKTGAGSSSGTSTNTSGSR
FT                   SFLPTFSNVGVGLKANVQATLGGSQKTTTGGSKWPTLDQANLLLWTGAGWRNDKNGQSD
FT                   ENHTTFKSATGSGQQGGSSGTNTSAGNPDSLKQDKITKESSGNLKTEDGAANSNENKDN
FT                   TNYQNLPAYGKVSGWITPDY"
FT   gene            168906..169022
FT                   /locus_tag="MPNE_0151"
FT   CDS_pept        168906..169022
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0151"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DML7"
FT                   /protein_id="ADK87000.1"
FT                   /translation="MQIFNFWNWSAKRLIPVGNRVASVSYFLKNQKKKERNI"
FT   gene            169025..169231
FT                   /locus_tag="MPNE_0152"
FT   CDS_pept        169025..169231
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0152"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLL7"
FT                   /protein_id="ADK87181.1"
FT                   /translation="MKKVKALRNLFLEKASEKLEYPKIASMVAYFDPKEDGTCEFIMKI
FT                   KTVNEVADTETTNKEKPLGTWKS"
FT   gene            169366..170028
FT                   /pseudo
FT                   /locus_tag="MPNE_0153"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF03257"
FT   gene            170097..170540
FT                   /pseudo
FT                   /locus_tag="MPNE_0154"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            170512..171114
FT                   /pseudo
FT                   /locus_tag="MPNE_0155"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            171617..172477
FT                   /locus_tag="MPNE_0156"
FT   CDS_pept        171617..172477
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0156"
FT                   /product="nuclease-like protein"
FT                   /note="identified by match to protein family HMM PF00565"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87001"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMN9"
FT                   /protein_id="ADK87001.1"
FT                   /translation="MLLAVAPILTACTRDYTTKNEFQLTTAQQAKLKPATIEYWRDGDT
FT                   PEINYASEERRKEAEQKSKENAKKEDKKEEKKTEDSQDSSSASTQVRSSKHGLRIYGID
FT                   TPEKHVSSKGDSTGDEKIEAEKASNYAEKLIPKGSTVWVWSLNTYSYDREVGALFFKSN
FT                   PKQTFFQSFEVAMVEAGHAIPIAGTGLNLIADPELSADDPLSVIGLQLANAANKAYNAK
FT                   INIWSHDTDGYRSLTAVYKLRGADISWTRFLDEANGYSSASAGTGASLYQLWDQRQAKL
FT                   AQKGS"
FT   gene            172501..174261
FT                   /locus_tag="MPNE_0157"
FT   CDS_pept        172501..174261
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0157"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87206"
FT                   /db_xref="GOA:A0A0H3DLN7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLN7"
FT                   /protein_id="ADK87206.1"
FT                   /translation="MEKIQAEKSQSAIEFKNIVVDFGESIAIDNINLTVKKKELVTLLG
FT                   PSGCGKTTSLSVIAGLIAPTSGQVLFNGYDVTKKPPQQRKLGLVFQNYALYPHMSVFEN
FT                   IVFPLYSDTSWREAIFEKNTWAQHDINCLILKANGATSEELAELNRLMQQRIDEPKRMA
FT                   YQINDLMVSVFQKQSELEANLKLIPRKKQFAIISLSKETLSQIRDVETKAKAALETADS
FT                   AEVEQTIKSELKQKLSEIKANYHDEKANIKAYWWEMLANIKTELKTEKTAIKQTNDYAK
FT                   LKELKWKIHFEPLNLKKQYRSYFKQLKAKYSLKDGNLTESELSQIEELQKRIVSLKDFI
FT                   NRTAKEVAEKLEITKILHKRPANISGGQQQRVAIARAIVRRPKVLLMDEPLSNLDAKLR
FT                   VQTRQWIRKFQQDLQITTVFVTHDQEEAMSISDTIVCMSTGKVQQIGSPSELYLKPANE
FT                   FVATFLGSPEMNIVNATVKAGQLLWNESPLVKTKFDLPDGAIRVGFRYDEVTAPKNDGS
FT                   PVFSGTLISVENLGKHMVGVVESNGVQLNVRLELSHQFEVGNAVKFTIKPNGLHFFDPQ
FT                   TTQRVEVKHV"
FT   gene            174254..175243
FT                   /locus_tag="MPNE_0158"
FT   CDS_pept        174254..175243
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0158"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86956"
FT                   /db_xref="GOA:A0A0H3DMJ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMJ8"
FT                   /protein_id="ADK86956.1"
FT                   /translation="MFKWLLKHRSKPTPLELGIFDQKVSFWKPFLLFCPALLTTFLFTL
FT                   VPFFLTLQKGFSHNEDIYRVDSQQFGFQTFANLFSESNFILGLRNSFLYSIISLPLTIV
FT                   LAIIISSAIVFVYRKLARGFWQTVFFLPYVTSGVAVSIAFIYILDSSSGILNNIFHVNI
FT                   KWLDSGERDTFNALWGILIFGIWKNMAFNVLVISTAMLSVDPTLYKVANLDGAKPIRQF
FT                   FKITLPSIRPTLIFLLTLLILGGMQVFPISLFNGNDSEAVTNGGSTILLYIFQKIRDQN
FT                   NNFAGAATLVLFILGVCYGLVLRNGFRLIEWAQWKIKRHYVQTKLNLV"
FT   gene            175215..176174
FT                   /locus_tag="MPNE_0159"
FT   CDS_pept        175215..176174
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0159"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86889"
FT                   /db_xref="GOA:A0A0H3DKY0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKY0"
FT                   /protein_id="ADK86889.1"
FT                   /translation="MFKQSLIWYNRYVQKRKKGLDLTIKDRSWSNVLLGLIFKTVVLCF
FT                   FGLMVIFPFYLMLVVALTSDEVVLNIREPILKSDGWHFENFRRVLEDGKYLNAIWINSL
FT                   VTILSIILRLFFTVSMGYAFSLKKWKLKKLFWFIFLAVLILPESALLIGQYRVVVVANW
FT                   NQPEKPAIILGLTMPFVASVFSGFMFRTAFEAIPPRIKESAFVDGCTGLRYFLKIAFPM
FT                   VRSTTWTVSILTAFAAWNSYLWPLLLLTNRPDLNINLWVLAQGTDGNAGQSDEQIRVLL
FT                   NLKMAAAILAILPMFIVYFLFRKRIMKAVGSRANTIKG"
FT   gene            176177..176335
FT                   /locus_tag="MPNE_0160"
FT   CDS_pept        176177..176335
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0160"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86666"
FT                   /db_xref="GOA:A0A0H3DN68"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN68"
FT                   /protein_id="ADK86666.1"
FT                   /translation="MDSLKHFWQQLVMWSKTVTFWIIVAVGIAFCAFAIWGIIACIETI
FT                   IKEGALL"
FT   gene            complement(176752..177327)
FT                   /locus_tag="MPNE_0161"
FT   CDS_pept        complement(176752..177327)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86908"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKI9"
FT                   /protein_id="ADK86908.1"
FT                   /translation="MKEKIPFYNEKEFNEMMKKTKKGTFSGWYIINPENKSVEFSGNFN
FT                   RQFKLNKPVIPVNTEYVTRKEFNEYKDSNDQRLIKIETTLAAQGEQIRIQGEQIRELQV
FT                   EQKAQRQEFNARMDRLENLLVESIESTNKRFDSIEGRLDSMDSRLDSMENRLDSIEGCL
FT                   DSVEGRLDSMENRLDSMETRLDKIDPPK"
FT   gene            complement(177327..177443)
FT                   /locus_tag="MPNE_0162"
FT   CDS_pept        complement(177327..177443)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0162"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNJ2"
FT                   /protein_id="ADK87272.1"
FT                   /translation="MQIFYFLNWSVNGLIPVGNWVASSSYFLNFTEKKGVAY"
FT   gene            complement(177564..178055)
FT                   /locus_tag="MPNE_0163"
FT   CDS_pept        complement(177564..178055)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87160"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL99"
FT                   /protein_id="ADK87160.1"
FT                   /translation="MKEKIPFYNEKEFHDMVKKTKKGTFSGWYIINKNNNSVEFSGSFN
FT                   RQFKLNKPVIPVNTEYVTRKEFNEYKDSNDQKLTKIETELKSQGQRIQVVEDKVDRLTE
FT                   VVMVQSQQIKTQGEAMNARMDRFESLVLKSLESIGNTLTDFGKRLDVIETRLDKIDPPK
FT                   "
FT   gene            178306..179280
FT                   /locus_tag="MPNE_0164"
FT   CDS_pept        178306..179280
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0164"
FT                   /product="DHHA1 domain protein"
FT                   /note="identified by match to protein family HMM PF01368;
FT                   match to protein family HMM PF02272"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87067"
FT                   /db_xref="GOA:A0A0H3DMV8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMV8"
FT                   /protein_id="ADK87067.1"
FT                   /translation="MNSQVHRKGSIAEAVSAIQAHDKIVIFHHIRPDGDCLGAQHGLAR
FT                   LIQTNFPHKQVFCVGDPKHNFPWLEMVFTPKEQITPELMQQALAVIVDANYKERIECRD
FT                   LLDQNQFKAVLRIDHHPNEDDLNTTHNFVDASYIAAAEQVVDLAVQAKWKLSPPAATAL
FT                   YLGIYTDSNRFLYSNTSWRTLYLGSMLYRAQANIAKIHDELNHTSLKDIQFKQYVFKNF
FT                   QTFQNVIYFVADKKFQKKLKVTPLECARVNILANIEQFHIWLFFIEEGKNHYRVEFRSN
FT                   GINVREVALKYGGGGHIQASGAVLKSKRDIIRVVQDCQKQIAV"
FT   gene            179293..184197
FT                   /gene="mgpA"
FT                   /locus_tag="MPNE_0165"
FT   CDS_pept        179293..184197
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="mgpA"
FT                   /locus_tag="MPNE_0165"
FT                   /product="adhesin P1"
FT                   /note="identified by match to protein family HMM PF03257;
FT                   match to protein family HMM TIGR03839"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87038"
FT                   /db_xref="GOA:A0A0H3DP98"
FT                   /db_xref="InterPro:IPR004940"
FT                   /db_xref="InterPro:IPR022116"
FT                   /db_xref="InterPro:IPR022400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP98"
FT                   /protein_id="ADK87038.1"
FT                   /translation="MHQTKKTALSKSTWILILTATASLATGLTVVGHFTSTTTTLKRQQ
FT                   FSYTRPDEVALRHTNAINPRLTPWTYRNTSFSSLPLTGENPGAWALVRDNSAKGITAGS
FT                   GSQQTTYDPTRTEAALTASTTFALRRYDLAGRALYDLDFSKLNPQTPTRDQTGQITFNP
FT                   FGGFGLSGAAPQQWNEVKNKVPVEVAQDPSNPYRFAVLLVPRSVVYYEQLQRGLALPNQ
FT                   GSSSGSDSTNQTGAMFGLKVKDATVDSSKQSTESLKGEESSSSSTTSSTSTTQRGGSSN
FT                   ENKVKALQVAVKKKSGSQGNSGDQGTEQVELESNDLANAPIKRGSNNNQQVQLKADDFG
FT                   TAPSSSGSGTQDGTPTPWTPWLTTEQIHNDPAKFAASILILYDAPYARNRTAIDRVDHL
FT                   DPKAMTANYPPSWRTPKWNHHGLWDWKARDVLLQTTGFFNPRRHPEWFDGGQTVADNEK
FT                   TGFDVDNSENTKQGFQKEADSDKSAPIALPFEAYFANIGNLTWFGQALLVFGGNGHVTK
FT                   SAHTAPLSIGVFRVRYNATGTSATVTGWPYALLFSGMVNKQTDGLKNLPFNNNRWFEYV
FT                   PRMAVAGAKFVGRELVLAGTITMGDTATVPRLLYDELESNLNLVAQGQGLLREDLQLFT
FT                   PYGWANRPDLPIGAWSSSSSSHNAPYYFHNNPDWQDRPIQSVVDAFIKPWEDKNGKDDA
FT                   KYIYPYRYSGMWAWQVYNWSNKLTDQPLSADFVNENAYQPNSLFAAILNPELLAALPDK
FT                   VKYGKENEFAANEYERFNQKLTVAPTQGTNWSHFSPTLSRFSTGFNLVGSVLDQVLDYV
FT                   PWIGNGYRYGNNHRGVDDITAPQTSAGSSSGISTNTSGSRSSLPTFSNIGVGLKANVQA
FT                   TLGGSQTMITGGSPRRTLDQANLQLWTGAGWRNDKASSGQSDDHTKFTSATGMGQQEQS
FT                   GTSAGNPDSLKQDKISKSGDSLTTQDGNAMDQQEATNYTNLPPNLTPTADWPNALSFTN
FT                   KNNAQRAQLFLRGLLGSIPVLVNKSGQDDNSKFKAEDQKWSYTDLQSDQTKLNLPAYGE
FT                   VNGLLNPALVETYFGNTRASGSGSNTTSSPGIGFKIPEQSGTNTTSKAVLITPGLAWTP
FT                   QDVGNLVVSGTSFSFQLGGWLVTFTDFIKPRAGYLGLQLTGLDASDATQRALIWAPRPW
FT                   AAFRGSWVNRLGRVESVWDLKGVWADQAQSDSQGSTTTATRDALPEHPNALAFQVSVVE
FT                   ASAYKPNTSSGQTQSTNSSPYLHLVKPKKVIQSDKLDDDLKNLLDPNQVRTKLRQSFGT
FT                   DHSTQPQPQSLKTTTPVFGTSSGNLSSVLSGGGAGGGSSGSGQSGVDLSPVEKVSGWLV
FT                   GQLPSTSDGNTSSTNNLAPNTNTGNDVVGVGRLSESNAAKMNDDVDGIVRTPLAELLDG
FT                   EGQTADTGPQSVKFKSPDQIDFNRLFTHPVTDLFDPVTMLVYDQYIPLFIDIPASVNPK
FT                   MVRLKVLSFDTNEQSLGLRLEFFKPDQDTQPNNNVQVNPNNGDFLPLLTASSQGPQTLF
FT                   SPFNQWPDYVLPLAITVPIVVIVLSVTLGLAIGIPMHKNKQALKAGFALSNQKVDVLTK
FT                   AVGSVFKEIINRTGISQAPKRLKQTSAAKPGAPRPPVPPKPGAPKPPVQPPKKPA"
FT   gene            184203..187658
FT                   /gene="mgpC_3"
FT                   /locus_tag="MPNE_0166"
FT   CDS_pept        184203..187658
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="mgpC_3"
FT                   /locus_tag="MPNE_0166"
FT                   /product="MgpC protein"
FT                   /note="identified by match to protein family HMM PF05220"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86942"
FT                   /db_xref="GOA:A0A0H3DP05"
FT                   /db_xref="InterPro:IPR007885"
FT                   /db_xref="InterPro:IPR009896"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP05"
FT                   /protein_id="ADK86942.1"
FT                   /translation="MKSKLKLKRYLLFLPLLPLGTLSLANTYLLQDHNTLTPYTPFTTP
FT                   LNGGLDVVRAAHLHPSYELVDWKRVGDTKLVALVRSALVRVKFQDTTSSDQSNTNQNAL
FT                   SFDTQESQKALNGSQSGSSDTSGSNSQDFASYVLIFKAAPRATWVFERKIKLALPYVKQ
FT                   ESQGSDDQGSNGKGSLYKTLQDLLVEQPVTPYTPNAGLARVNGVAQDTVHFGSDQESSW
FT                   NSQRSQKGLKNNPGPKAVTGFKLDKGRAYRKLNESWPVYEPLDSTKNGKGKDKDGWTTS
FT                   GASEAKGDAPLVSSTESQMAAVTDSQQSGHNSGLVSLAQRSTTVAVQKSDSSGSQGQGT
FT                   TDNKFQKYLNTAQALHQMGVIVPSLETWPGKPSTGIATRAGGGVSVQAATRQSSSTNED
FT                   LPNVITQLYHTSTSQLAYLNGQIVVMGSNAVPSLWYWVVDERTTSGRATWWAHTELNWG
FT                   TDKQKQFVENQLGFKDDSNSSLTNFKSQGLTQPAYLIAGLDVVQDHLVFAAFKAGAVGY
FT                   DMTTDSNASTKDQALAWSTTAGLDSDGGYKALVENTAGLNGPINGLFTLLDTFAYVTPV
FT                   SGMKGGSQNNEEVQTTYPVKSDQKATAKIASLINASPLNSYGDDGVTVFDALGLNFNFK
FT                   LNEERLPSRTDQLLVYGIVNESELKSARENAQSTSDDNSNTKVKWTNTASHYLPVPYYY
FT                   SANFPEAGNRRRAEQRNGVKISTLESQATDGFANSLLNFGTGLKAGVDPAPVARGHKPN
FT                   YSAVLLVRGGVVRLNFNPDTDKLLDSTDKNSEPISFSYTPFGSAESAVDLTTLKDVTYI
FT                   AESGLWFYTFDNGEKPTYDGKQQQVKNRKGYAVITVSRTGIEFNEDANTTTLSQAPAAL
FT                   AVQNGIASSQDDLTGILPLSDEFSAVITKDQTWTGKVDIYKNTNGLFEKDDQLSENVKR
FT                   RDNGLVPIYNEGIVDIWGRVDFAANSVLQARNLTDKTVDEVINNPDILQSFFKFTPAFD
FT                   NQRAMLVGEKTSDTTLTVKPKIEYLDGNFYGEDSKIAGIPLNIDFPSRIFAGFAALPSW
FT                   VIPVSVGSSVGILLILLILGLGIGIPMYKVRKLQDSSFVDVFKKVDTLTTAVGSVYKKI
FT                   ITQTSVIKKAPSALKAANNAAPKAPVKPAAPTAPRPPVQPPKKA"
FT   gene            187775..188302
FT                   /locus_tag="MPNE_0167"
FT   CDS_pept        187775..188302
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86832"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNP9"
FT                   /protein_id="ADK86832.1"
FT                   /translation="MSHKDFNGLQAPQLLSSSSPVAKKQSSHKLRHALKHARYLNHSSK
FT                   RTLKHALELHEDNQVLLEKEGSPNFQDWLSKQPGVNKTSLKYNKSLGSWISKESKPKKR
FT                   FQPYFTYKDSKTTPEEAKALQQMKQSQKRFFHENMHSFLNEVAHNPMIQRFNQKQAKRA
FT                   ANTRQRTYKYRQ"
FT   gene            188525..189937
FT                   /locus_tag="MPNE_0168"
FT   CDS_pept        188525..189937
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0168"
FT                   /product="adhesin P1 domain protein"
FT                   /note="identified by match to protein family HMM PF03257"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87227"
FT                   /db_xref="InterPro:IPR004940"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DND5"
FT                   /protein_id="ADK87227.1"
FT                   /translation="MLDYIPWIGNGYRYGNNHRGVDDITAPQTSAGSSSGTSTNTSGSR
FT                   SFFPTFSNIGVGLKANVQATLGGSQTTTVGGSPWRTLDQANLQLWTGAGWRNDKASSGQ
FT                   SDENHTTFKSATGMGQQGQSGTSAGNPDSLKQDKISKSGDSLTTQDGNATGQQEATNYT
FT                   NLPPNLTPTADWPNALSFTNKNNAHRAQLFLRGLLGSIPVLVNRSGSDSNKFQATDQKW
FT                   SYTDLQSDQTKLNLPAYGEVNGLLNPALVETYFGNTRAGGSGSNTTSSPGIGFKIPEQN
FT                   NDSKATLITPGLAWTPQDVGNLVVSGTSLSFQLGGWLVSFTDFIKPRAGYLGLQLSGLD
FT                   ASDSDQRELIWAKRPWAAFRGSWVNRLGRVESVWDLKGVWADQAQLAAQAATSEASGSA
FT                   LAPHPNALAFQMSVVEASAYSSSTSSSGSGSSSNTSPYLHLIKPKKVESTTQLDQGLKN
FT                   LLDPNQVRTKLR"
FT   gene            190475..191014
FT                   /locus_tag="MPNE_0169"
FT   CDS_pept        190475..191014
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87008"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP71"
FT                   /protein_id="ADK87008.1"
FT                   /translation="MSYSPSLKEIIAILQKYTSKNYQSNCKTRPDGKLELSLNGVFEEI
FT                   VKTPGKTRYVTHKQLDQKLKDFKQDLMVELHDTFATKTDLKESEARINQKLEALIQIVM
FT                   VQGEQIKVHGEQINKLTQTVEKQGEKIEAQGQQIQKVNETLNFVVESLGSIHKRLDSME
FT                   GRLDSMENRLDKLESK"
FT   gene            191280..192131
FT                   /locus_tag="MPNE_0170"
FT   CDS_pept        191280..192131
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86966"
FT                   /db_xref="InterPro:IPR004984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMK9"
FT                   /protein_id="ADK86966.1"
FT                   /translation="MRFKYGAVAFSGFLGLAVMLASCGAKGRFDQVDDGKIKLASSLTG
FT                   KRDVILKEVLNKYNSRKAKDDYPIEITKIAGSYDGGRSDLQTRLSVKDKTTFYNMILNY
FT                   SDTISTLGRSNMELPLDSVDVSQFSENFLSFNDRISGISRKGIYGIPVSMSTDILVING
FT                   PVLHYILNSAKKKDGAVTKKNASNSNGNEGTLTVNNDQQTTELWKKIEEAAKTNGKTTQ
FT                   EQTKRDAKQSTSLIQLKEGSANTTEGNASESDKEIKKSWGNYQEVDGGLKGYTFKASVF
FT                   EN"
FT   gene            192138..193595
FT                   /locus_tag="MPNE_0171"
FT   CDS_pept        192138..193595
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03202;
FT                   match to protein family HMM PF03305"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86772"
FT                   /db_xref="InterPro:IPR004890"
FT                   /db_xref="InterPro:IPR004984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNJ1"
FT                   /protein_id="ADK86772.1"
FT                   /translation="MVDFATRVAKSFKDKVSGIDNKKGTDIQGVLGLDSTPNVLFASVF
FT                   AAGGGSYDNFFYKVENGRADFRNFANKGTSYKNLEKVYNDYKNLIGSNGLFASKDGSYS
FT                   SNFEKFHQLAFYVGSSSGYNYAFADETAKRLKFGDSAIEYPNDTLEIKVPTNNSQSGDG
FT                   NGGTNNDNLLGTFDIREKSNGKKGESNGKQGNGQDKKTISLYKDSIPKEKTEGTDAILI
FT                   SDNQLINQLQTAAKTSSSQNKANTAAITFKQSNKSETDQSTTSQFIGYTTTASLKADKK
FT                   NIFDVKKLNNEKSERKIIVGATVETLNQANTLQANEAIIKPAPGKYQSTDSHKVMITQG
FT                   PNIVGIHANEKEDKETQKFINWYLNKEESWSVQNSGSTTTKKQTAAQYFAEQSSYITPL
FT                   KNNFKADQSATKDSTVNTNYFTKQTFDLFKEVNDGKVLGFNDPSDFRSGKFRNTIGSTF
FT                   NATISSKVDFNKFFENFKASLGSGFER"
FT   gene            193760..194551
FT                   /locus_tag="MPNE_0173"
FT   CDS_pept        193760..194551
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0173"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86919"
FT                   /db_xref="InterPro:IPR001595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL05"
FT                   /protein_id="ADK86919.1"
FT                   /translation="MHKKKFLSRTSFASLFLLLGTVLSACSKVESTKSVHPVKSFKSDL
FT                   KSLLKETIKQDIDLSKTIKTSEGKQQIITSLKKSYGVNPKDTTKLLLDAWKQSFEEGEI
FT                   GIADLDFEVAYPKTQDPFTMERKVDHFQMTYQSFKDLSIKAKLSYTFNWFGDYSSGGFT
FT                   AKKGDKHYFDLFLKIKPDPNKSFKAANFKTEEKNSTVIDGQETTRNLEWIEFGASISWS
FT                   LKGKDDASEKSVKQFLDSYANNTSGYSSDINLFSYLEYLIR"
FT   gene            complement(194544..194690)
FT                   /locus_tag="MPNE_0172"
FT   CDS_pept        complement(194544..194690)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0172"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86780"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLZ1"
FT                   /protein_id="ADK86780.1"
FT                   /translation="MSFWKCQQNCKKVFDEINLNKNKKPSVQGEKQVAKIFPSTTKQSQ
FT                   QIT"
FT   gene            194717..194833
FT                   /locus_tag="MPNE_0174"
FT   CDS_pept        194717..194833
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0174"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86815"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM21"
FT                   /protein_id="ADK86815.1"
FT                   /translation="MQIFNFWNWSAKRLIPVGNRVASVSYFLKNQKKGGFDH"
FT   gene            195104..196408
FT                   /pseudo
FT                   /locus_tag="MPNE_0175"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            196587..196907
FT                   /pseudo
FT                   /gene="mgpC_4"
FT                   /locus_tag="MPNE_0176"
FT                   /note="MgpC protein; this gene contains a frame shift which
FT                   may be the result of a sequencing error"
FT   gene            197164..197289
FT                   /pseudo
FT                   /locus_tag="MPNE_0177"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            197309..197791
FT                   /locus_tag="MPNE_0178"
FT   CDS_pept        197309..197791
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86751"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLZ6"
FT                   /protein_id="ADK86751.1"
FT                   /translation="MFKKRLNKDKINNCHVWEEELPDGSYDMEFNGNLNHMEKRKSGYV
FT                   TQKQFNEYKDSNDQRLIKIETTLAAQGEQISQLVQIVFLQGKQIKELQAEQKAQRVEFN
FT                   ARMDRFESLVLKSLESIGNTLTDFGKRLDSMETRLDSMDGRLDSMETRLDKIDPPK"
FT   gene            198073..200547
FT                   /locus_tag="MPNE_0179"
FT   CDS_pept        198073..200547
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03202;
FT                   match to protein family HMM PF03305"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86724"
FT                   /db_xref="InterPro:IPR004890"
FT                   /db_xref="InterPro:IPR004984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKE7"
FT                   /protein_id="ADK86724.1"
FT                   /translation="MKFKYGAIVFSCLLGVSAILAACGARGKFNQVDDGKIKLASSLTS
FT                   RSASTALQKVVEKYNKVKGVNDYPIEITQIAGGYDGGRTDLQTRVNVKDTTNFYNLILN
FT                   YPDLVSTLGRVGMELPFDKVKTDKLADRFLDFNNRISAISKKGIYGIPVSLSTEVLSIN
FT                   GPVLHYILNSAQGKVSSVTSVQRTAASGSGTTNNNGVTKPLKIDKENESTKKLWEEIEN
FT                   KAKENGKKTSSSRRKRNLSSSKQMSTQTQPTDNSNDANQSDQAIEKTWGKYQEVEGGLK
FT                   DYTFKASVFENWHDLLDFSNRVAKSFSNINTNTNKKGTDIQGVLGIDSTPNSLFTSVFA
FT                   AGGGNYDNFFYKVANGRADFSNFKNKGTSYQNLQKVYGDYKGLIDSNGLFVNKGGSYSS
FT                   NFQKFHQLAYSISSTSGFFYSFAGENSKRLKFDGGNFIEFPGFTQAIYAPENNSQSGGE
FT                   SGDQTTNNEANLLGTFKIKSSNKSKSSSSKSSTKAETGKTSGGDQNQGKKGEGAQNQGK
FT                   KGEGAQNQGKNGGEETTIYLYKNSIPSGKNKGENAILIDNKTIVEQLESAAKKEDKKSG
FT                   ESTTEQTQIQSKSVTEQKQPKIIGYTTTGNVHEDNKHIFPIDKLTSDRNFDRKIIVGAT
FT                   EETLDKSNTLQSNEAIVLPAPSKYKSTDTNKVTITQGPNIIGIHANEKENAETQKFVDW
FT                   FLNSPQTWEGKGKGKEQTNKTAAEFFAESASYILPLKEIFEQKNEKKEGSDQKDSKSNG
FT                   RGKQTNLYTEKALELFRGISTDQIVSYSDPSDFRSGRFRDGIGATFNAAVSSKASFEKF
FT                   VQNFIATLGSDI"
FT   gene            200634..203975
FT                   /locus_tag="MPNE_0180"
FT   CDS_pept        200634..203975
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86704"
FT                   /db_xref="InterPro:IPR025103"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLQ2"
FT                   /protein_id="ADK86704.1"
FT                   /translation="MNDWQWLKNRLVNAKTKAVSFWLAQTTSTILDIAELIKCCSDLKN
FT                   TSINGLVDLINQQEKLEFNLTRLKEIDGEDARQLFGIEGNVYKHFQTELSRFYKQTRKH
FT                   FRETGSESLFLGLPVIEGINEFNDVFRAPLLYVGVKLKVAPRLERFWLEINREEIFLNP
FT                   TIIGVEINKRNSLFKNNYDTTKVDINQALEIFRELEYQFRMPLTSELKSFSKKAKSDFN
FT                   TEKRTNFLTNNVLLGIFDVKGDQLFQNFNEILNTDPDVLDELLKDRRDLLYDNREFREN
FT                   FNLKGTYLFSHLDIFQQYAVKQAFDGDVIIEGPPGTGKSETIVNILVNLALNKKKVLFV
FT                   SEKVTALDVVYNRLGSFKHIALFNASVASEKKRFYSQFADYESFFTDNFSKKDLVNEMP
FT                   VFDGQWVDKILSEFTNLQNIYDTQINSGNQSYSFKEILSSFPILDVSYIKIKEHDRFDE
FT                   WVRVFSSQVWLEKHLTYLAFKAELSKRWQNIDNFYALKDLLEKRKNIRVLCYVLDYFEQ
FT                   NNSIIKPKRVLLYTPTERGQKQLHQLQQDVAKYNSLQRFKSAAKFETIKLNLANKLAQN
FT                   AKPFFFSWFIQTHAQTLLENLVQTQKQLVKAKQSYLSKIEQYVVSCKRILKATILANFF
FT                   ELYQTNKNELLDICREAKNPVLKEITWWFKKNFALLSKLFPVHIMTFESAALLTPNQRR
FT                   LYDYVVIDEASQVYLERAIPILYRGAKYIIAGDTKQLKPSNFFQARAEYDVDEEFEDGN
FT                   VEAAVHSTSLLHFLKNRSRILTLLKFHYRSDSANLIAFTNNRIYNNELIFMNKATADKQ
FT                   VFIVHDVIDGIWRNNRNLQEARDVVQRLEQLTQTAEYQKSLGVICFNKNQAELIEYMID
FT                   KQNNPLLNEWRDRVNAQGEYVGLFVKNIENVQGDERDIIIFSLGYDRSVNSYGPISKQG
FT                   GENRLNVAITRAKQRIELFKTNRASDYNGLSSNSLGSKLLVEYLLYCEAMANNQGESLD
FT                   FQATQKQAPKAKYELELENQFFNELELIFGEQFTIKRNVNEGAYSFSFVFYFNENPYLA
FT                   VDFNPALPHSRKEVSENIIYREQFLKKRKWNLVNIWLDEWKLNPGGVLQKLRNCLTHSE
FT                   NEFEEI"
FT   gene            204052..205674
FT                   /pseudo
FT                   /gene="nusA"
FT                   /locus_tag="MPNE_0181"
FT                   /note="transcription termination factor NusA; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00013; match to protein family HMM PF08529; match to
FT                   protein family HMM TIGR01953"
FT   gene            205789..205968
FT                   /locus_tag="MPNE_0182"
FT   CDS_pept        205789..205968
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86925"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMC8"
FT                   /protein_id="ADK86925.1"
FT                   /translation="MDLAQTLPGRGYYLSVAALKLERKNFKALLQKRLKVSCSDAELDH
FT                   IIACLKERESDVKA"
FT   gene            205955..207808
FT                   /gene="infB"
FT                   /locus_tag="MPNE_0183"
FT   CDS_pept        205955..207808
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="infB"
FT                   /locus_tag="MPNE_0183"
FT                   /product="translation initiation factor IF-2"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03144; match to protein
FT                   family HMM PF04760; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00487"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86795"
FT                   /db_xref="GOA:A0A0H3DM06"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM06"
FT                   /protein_id="ADK86795.1"
FT                   /translation="MSKHKPRHFQKNKFDNRAKTSAKQQFRQVKTGVKDGVFVYKGPLT
FT                   VSEFCLKTNIPTANIIKHFFLNGVPLTLNSVLSTEQLADACVNFGFDFKVETEITHDNI
FT                   ISNIKFDDDPTQLSPRPPIVTIMGHVDHGKTSLLDAIRQTNTAAKEFGGITQKIGAYQV
FT                   KNQEGKTITFIDTPGHEAFTGMRARGAQVTDIVVLVVAGDDGLKQQTEEAISHAKSAKT
FT                   PIIVFINKMDKPTANPDMVIQQLNKFDLVPEEWGGDTIFVKGSALTKEGIQELLDSILL
FT                   VAEVEDYKANFNAHSSGYAIEVQTTKGLGPTATIIVKRGTLKIGDIVVLGPAWGKVRTM
FT                   QDENGVHLQEAMPSKPVQISGFDIVPVAGEKFIVFDDEKDAKLIANKFREQQKQKLNTT
FT                   QINEVLKQKIKSKEIKVLNLIFKVDSDGSLAAIKQAMQSIDVPGMSVNIIHSGVGLISE
FT                   NDIMLAKASGALLFSLNLGLSQVVKNIASLQGVKVDVHYHIPKLAEEIENILKGQLEPV
FT                   YEDVELGRAEVLQLWYHSKVGHIAGTLVKTGKVKRGALCKLLRRNETIYEGRVDSLKSE
FT                   KNPVNQMEAGKNCGIVINGCEDIQVCDIILVYEKQEVKSKS"
FT   gene            207811..208161
FT                   /gene="rbfA"
FT                   /locus_tag="MPNE_0184"
FT   CDS_pept        207811..208161
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rbfA"
FT                   /locus_tag="MPNE_0184"
FT                   /product="ribosome-binding factor A"
FT                   /note="identified by match to protein family HMM PF02033;
FT                   match to protein family HMM TIGR00082"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86785"
FT                   /db_xref="GOA:A0A0H3DLZ5"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLZ5"
FT                   /protein_id="ADK86785.1"
FT                   /translation="MASYKKERLENDIIRLINRTVIHEIYNETVKTGHVTHVKLSDDLL
FT                   HVTVYLDCYNREQIDRVVGAFNQAKGVFSRVLAHNLYLAKAVQIHFVKDKAIDNAMRIE
FT                   SIINSLKKSKPN"
FT   gene            208177..208998
FT                   /pseudo
FT                   /locus_tag="MPNE_0185"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            209015..209386
FT                   /pseudo
FT                   /locus_tag="MPNE_0186"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            209399..210208
FT                   /gene="ribF"
FT                   /locus_tag="MPNE_0187"
FT   CDS_pept        209399..210208
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ribF"
FT                   /locus_tag="MPNE_0187"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /note="identified by match to protein family HMM PF01687;
FT                   match to protein family HMM PF06574; match to protein
FT                   family HMM TIGR00083"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87064"
FT                   /db_xref="GOA:A0A0H3DKZ9"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKZ9"
FT                   /protein_id="ADK87064.1"
FT                   /translation="MQQTLIIGAFDGLHKGHQLLAQAASGPVVALLIANIPSLQSDWLY
FT                   EPKQRQVQLQQHFQSVVHSYDVIEHNISAQAFFDQIISPLRCQQLVVGADFCFGKDNQN
FT                   ADFLRRLFPNTTIIPKDSQTLSSSTIRQWLKQGQIEQANAVLLEPYFREGVVIRGNQQA
FT                   RFLGWPTANITLKPYMVPLRCGSYVITVTYHQTNYPGVGFISYKNDQLVCETHLIGFSG
FT                   DLYGKQLRFTFNQFIRPQQKFSGVQALQKAISGDLKQAQKWFAQSTN"
FT   gene            210234..211508
FT                   /locus_tag="MPNE_0188"
FT   CDS_pept        210234..211508
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01595"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87031"
FT                   /db_xref="GOA:A0A0H3DMP0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMP0"
FT                   /protein_id="ADK87031.1"
FT                   /translation="MESAPSGGLLALIIISIILLACISAVVSAYETAITSITSYKWSNY
FT                   VKTHNKQKKLTTKIVNHFQKNYSACLITILVANNIVAILVSNILFLALDQSIKNPAISS
FT                   ALNLLISGVLLLMLCEITPKTLARINIIRVLVYFAVVVYFFYILFWPITKLASIIFAKY
FT                   EKAPPVSRRDVYFFIDEIEQNGLFTKEDGQLIKRTLIFDQVLVDQIMIKWNRVVYCYEG
FT                   DPVKTIKEKFLHGQFSRMPVLDQTSNEVVGFIHLKDLFSSLEKSNEPFVLQELLYPAVL
FT                   VSNTTPIKQALRQMRLHRAHLAVVQDKHHHTIGIVSMEDIIEELVGEIYDEHDEVEAVQ
FT                   TLDNNTWLVLPNVKAAFFFNKWIKRDLVKSKNMTIQRYLASFENDGLNTQNKLETPWFI
FT                   AEAIVDSENPEQIRYEIRKKSDVVD"
FT   gene            211495..212628
FT                   /locus_tag="MPNE_0189"
FT   CDS_pept        211495..212628
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0189"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87285"
FT                   /db_xref="GOA:A0A0H3DLL1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLL1"
FT                   /protein_id="ADK87285.1"
FT                   /translation="MLWTRALILELKTNKQSRLLWLLAIPLLISLTLLTYGLVLFSSSG
FT                   RIDHGDHFHLRERFVLTTEELVTFVVASVVFALTVALFGLGCWKLLQGPKVDRTNIKLA
FT                   NSNPAPQAVVLQADCDHFQVGDHCVFSAEKQHFKQQFKQDFLGKSKFSFRNELYRFCLI
FT                   GVLISLNLALSMVEIPGIVLPWGSSIQFRFFNTAILFIAIRFVGLLSTSLIAIITPWIH
FT                   LLLHPVHTPISTVFYMGNDLVVLWIFYFFYYHIFKAEVKQTTTVVNNKEFSQLVNTHKT
FT                   KVAKALALIPVNLICGFIEGLGFYVGYFLILGKFGSVGHKIFYDSQANRDLINSANVIY
FT                   FLLTTTTIFSLKYLFELLFFYSVEKGILNISRHFGLY"
FT   gene            212782..214119
FT                   /locus_tag="MPNE_0190"
FT   CDS_pept        212782..214119
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86761"
FT                   /db_xref="InterPro:IPR019219"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM07"
FT                   /protein_id="ADK86761.1"
FT                   /translation="MSDVKYLQVEIVDKNTIRLQEDGKKGQQIRLDQIIKVDQSNILNT
FT                   LEQAQREAYEREAQSRYQTKLAKELSEKDNTFLKQEAAWNQAHNTQIQQLYQQITNLEN
FT                   QVNNIKRETESKKDNEYQQQIVKLETQLQSIKKETESQKDLEYERKANKTKEENQQELE
FT                   RQRQYFLEQLEQAQKDIEELKTREERFSKWAIAKKGKELEKWCWEAYKNYEELFQNCVF
FT                   APYSELVKGAKKSIGVEDDESNINEKADFIFQVFNPNNDKEPFFSICCEMKTEFTESKS
FT                   RTKNEDHVKKLIADAKRAKCQYGFLVSELELNTENDVQVQRMHTSNSEVEVYLVRPMFF
FT                   IVMLRLFYFLAKKMFAQVDVNSEYLDKEALNASFSDLKKSLLEKTFTDLNKVFQNNIDE
FT                   LEKIEGLVTKLKAANEKALNSRLNNWEEKIRKFEFKLNKDIVKKLE"
FT   gene            214241..215203
FT                   /locus_tag="MPNE_0191"
FT   CDS_pept        214241..215203
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0191"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87135"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL75"
FT                   /protein_id="ADK87135.1"
FT                   /translation="MKLNLRFPSYFLPVVAASAFLVSCATPNTYEVQRAALIQLVEEDE
FT                   RQNYIQKGSIGANAVMTAAKAETKTAEKTATSTKAASIELKKTDTDIKTTTTTENKSAS
FT                   GYKLDTLFGDYILWVVDHLSGLLFSPKTNNSTTTQKIQLITEDKVILDGGNLTVEKNHE
FT                   HGHTHKNGETHEHDHDHHEGEEEVIVGRALSFANGLFLVVDLKEEKHEEKKEAKSEMSM
FT                   NSKDMVMMTKTEMMSKEMKSEQKMEKKEEHEHHHKKLSLSTTAYKFGQSFNILEFTGAM
FT                   HHKTAHNNETEFKNLGKKYGGMTEYTIVDFDFNPPKPTK"
FT   gene            215402..215788
FT                   /locus_tag="MPNE_0192"
FT   CDS_pept        215402..215788
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86910"
FT                   /db_xref="GOA:A0A0H3DMB4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMB4"
FT                   /protein_id="ADK86910.1"
FT                   /translation="MEKDKELVSSIVTAKSMIDRFFWSILSFLLTNLVFLFVAFLILII
FT                   YLISEITQQFAFAFIATIVFIIFYNILFLSYLLTMYIKGLKQIEQKSRYLLLVLDVKAD
FT                   ELLPFSFLGSLRKSHMLEEMLLEQ"
FT   gene            215882..216118
FT                   /pseudo
FT                   /gene="rpsJ"
FT                   /locus_tag="MPNE_0193"
FT                   /note="ribosomal protein S10; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00338; match to
FT                   protein family HMM TIGR01049"
FT   gene            216221..217084
FT                   /gene="rplC"
FT                   /locus_tag="MPNE_0194"
FT   CDS_pept        216221..217084
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplC"
FT                   /locus_tag="MPNE_0194"
FT                   /product="50S ribosomal protein L3"
FT                   /note="identified by match to protein family HMM PF00297;
FT                   match to protein family HMM TIGR03625"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86699"
FT                   /db_xref="GOA:A0A0H3DLP6"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLP6"
FT                   /protein_id="ADK86699.1"
FT                   /translation="MEIRGIFGVKVGMSQVFTTNNERLPITVIYCEPNQVAGVKNEAKD
FT                   KYSATLLSFDTVENKKLNKPQQGFFEKNNLKPTKHLQEIRNMTGFEMGQQITPQNLFQV
FT                   GEYVDVSAISKGRGFTGAIKRWNFKIGPLGHGAGYPHRFQGSVQAGRGGASAQRVFKGK
FT                   KMSGHYGHEKVTVQNLRIVGFDEANMLVLVSGAIAGPEGGVVFIRTAKKKPGVVKPIEL
FT                   AVQTEKAPEAKPAKLSKKKQAKELAKAQAANQQTVEAKVDTPVVEPKPTEVKKAAPVVE
FT                   KKGEDK"
FT   gene            217084..217722
FT                   /gene="rplD"
FT                   /locus_tag="MPNE_0195"
FT   CDS_pept        217084..217722
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplD"
FT                   /locus_tag="MPNE_0195"
FT                   /product="50S ribosomal protein L4"
FT                   /note="identified by match to protein family HMM PF00573;
FT                   match to protein family HMM TIGR03953"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87003"
FT                   /db_xref="GOA:A0A0H3DP65"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP65"
FT                   /protein_id="ADK87003.1"
FT                   /translation="MAKLKLIKIDGSFETEPVKLSPGLIAKELKQQPVFDAVLVEQASW
FT                   RQGTHSILTKGEVRGGGKKPYKQKHTGKARQGSTRNPHFVGGGIVFGPKPNRNYSLKLN
FT                   KKAHTAALHTVWSEKLASDNTHLVDQNLFNKTEGKTKVMVQFLKSAKLLDKNVLFVVNT
FT                   LNTNLEQSTSNIKNVQVKHLDKVSVRDLMLANALLVEKEVLKALEGKFK"
FT   gene            217725..218438
FT                   /gene="rplW"
FT                   /locus_tag="MPNE_0196"
FT   CDS_pept        217725..218438
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplW"
FT                   /locus_tag="MPNE_0196"
FT                   /product="ribosomal protein L23"
FT                   /note="identified by match to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86872"
FT                   /db_xref="GOA:A0A0H3DNT8"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNT8"
FT                   /protein_id="ADK86872.1"
FT                   /translation="MDVTNVLLKPVLTEKVYFNQMGETKKYVFVVNPKASKTRVKLAFE
FT                   LVYGIKPLKVNTLIRKPTTIRGGSRFPGLSKLEKLAVITLPKGIAISVTGEAPEKTDKP
FT                   ADKTTLKESTVKEIKDTKNSPEAVVKTAVEALQIKPTAAPVTTAPLQTVAVKVAKEVKE
FT                   VKVEKPVKVEKPTKPAKVAKEAKTTKVAKETKAEKSVQTTKVAKETKTEKSAKTTKTTA
FT                   TKTTKTKTTKKEVKK"
FT   gene            218438..219301
FT                   /gene="rplB"
FT                   /locus_tag="MPNE_0197"
FT   CDS_pept        218438..219301
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplB"
FT                   /locus_tag="MPNE_0197"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by match to protein family HMM PF00181;
FT                   match to protein family HMM PF03947; match to protein
FT                   family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87182"
FT                   /db_xref="GOA:A0A0H3DN83"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN83"
FT                   /protein_id="ADK87182.1"
FT                   /translation="MPIKKIISRSNSGIHHSTVIDYKKLLTTNKNKPEKSLLVTLKKHG
FT                   GRNNQGKITVRHQGGRNKRKYRIIDFKRTHYDNIEATVKSIEYDPNRSCFVSLITYANG
FT                   AKSYIISPDGIKVGDKILASEHPIDIKPGFSMPLAFIPEGTQVHNIELHPKGGGQIARS
FT                   AGSYARILGQDETGKYVILQLLSGETRKFLKECRATVGVVSNLDHNLVVIGKAGRNRHR
FT                   GIRPTVRGSAMNPNDHPHGGGEGRSPVGRDAPRTPWGKRHMGVKTRNMKKASTNLIIRN
FT                   RKGEQY"
FT   gene            219301..219564
FT                   /gene="rpsS"
FT                   /locus_tag="MPNE_0198"
FT   CDS_pept        219301..219564
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsS"
FT                   /locus_tag="MPNE_0198"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by match to protein family HMM PF00203;
FT                   match to protein family HMM TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87264"
FT                   /db_xref="GOA:A0A0H3DQ21"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ21"
FT                   /protein_id="ADK87264.1"
FT                   /translation="MSRSAKKGAFVDAHLLKKVIDMNKQEKKRPIKTWSRRSTIFPEFV
FT                   GNTFAVHNGKTFINVYVTDDMVGHKLGEFSPTRNFKQHTANR"
FT   gene            219566..220045
FT                   /gene="rplV"
FT                   /locus_tag="MPNE_0199"
FT   CDS_pept        219566..220045
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplV"
FT                   /locus_tag="MPNE_0199"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86723"
FT                   /db_xref="GOA:A0A0H3DJY8"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DJY8"
FT                   /protein_id="ADK86723.1"
FT                   /translation="MIAFAKQFRVRISPQKARLVCQLIVGKKTADAQNILSNTPKKAAT
FT                   LIAKLLNSAIANATNNHGMNGDALYVFECVANQGPSMKRTIPRAKGSSNMITKRSSNLV
FT                   VKLSDNPNERQELIKQQKALVKKRVEGQQKAKMARQKAVTPVVKAPSKTQGGVQK"
FT   gene            220047..220868
FT                   /gene="rpsC"
FT                   /locus_tag="MPNE_0200"
FT   CDS_pept        220047..220868
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsC"
FT                   /locus_tag="MPNE_0200"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by match to protein family HMM PF00189;
FT                   match to protein family HMM PF00417; match to protein
FT                   family HMM PF07650; match to protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86863"
FT                   /db_xref="GOA:A0A0H3DKF5"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKF5"
FT                   /protein_id="ADK86863.1"
FT                   /translation="MGQKVNSNGLRFGINKNWISRWTANSHAQTAKWLIEDEKIRNLFF
FT                   VNYRNAQVSNVEIERTQATVDVFVYAAQPAFLIGSENKNIQKITKQIKQIIGRTTNLDL
FT                   TINEIGSPMLSARIIARDLANAIEARVPLRTAMRQSLIKVLKAGANGIKVLVSGRLNGA
FT                   EIARDKMYIEGNMPLSTLRADIDYALEKAQTTYGVIGVKVWINRGMIYTKGLNRTPAHI
FT                   LHPQKKQPNRQNQQPRHFNQGQVLSANKLTGSDVETSSIQALTKPNKEDKQ"
FT   gene            220868..221287
FT                   /gene="rplP"
FT                   /locus_tag="MPNE_0201"
FT   CDS_pept        220868..221287
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplP"
FT                   /locus_tag="MPNE_0201"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87106"
FT                   /db_xref="GOA:A0A0H3DLG9"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLG9"
FT                   /protein_id="ADK87106.1"
FT                   /translation="MLQPKRTKYRKPHNVSYEGKAKGNSYVAFGEYGLVATKGNWIDAR
FT                   AIESARIAISKCLGKTGKMWIRIFPHMSKTKKPLEVRMGSGKGNPEFWVAVVKQGTVMF
FT                   EVANIPESQMIKALTRAGHKLPVTWKILKREEVSA"
FT   gene            221287..221622
FT                   /pseudo
FT                   /gene="rpmC"
FT                   /locus_tag="MPNE_0202"
FT                   /note="ribosomal protein L29; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00831; match to
FT                   protein family HMM TIGR00012"
FT   gene            221622..221879
FT                   /gene="rpsQ"
FT                   /locus_tag="MPNE_0203"
FT   CDS_pept        221622..221879
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsQ"
FT                   /locus_tag="MPNE_0203"
FT                   /product="30S ribosomal protein S17"
FT                   /note="identified by match to protein family HMM PF00366;
FT                   match to protein family HMM TIGR03635"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87159"
FT                   /db_xref="GOA:A0A0H3DPP5"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPP5"
FT                   /protein_id="ADK87159.1"
FT                   /translation="MKRNQRKVLIGIVKSTKNAKTATVQVESRFKHPLYHKSVVRHKKY
FT                   QAHNEGEVLAKDGDKVQIVETRPLSATKRFRIAKIIERVK"
FT   gene            221883..222251
FT                   /gene="rplN"
FT                   /locus_tag="MPNE_0204"
FT   CDS_pept        221883..222251
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplN"
FT                   /locus_tag="MPNE_0204"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87143"
FT                   /db_xref="GOA:A0A0H3DN64"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN64"
FT                   /protein_id="ADK87143.1"
FT                   /translation="MVSFMTRLNVADNTGAKQVGIIKVLGSTRKRYAFLGDVVVVSVKD
FT                   AIPSGMVKKGQVLRAVIVRTKKGQQRKDGTHLKFDDNACVLIKEDKSPRGTRIFGPVAR
FT                   ELRERGYNKILSLAVEVV"
FT   gene            222251..222586
FT                   /gene="rplX"
FT                   /locus_tag="MPNE_0205"
FT   CDS_pept        222251..222586
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplX"
FT                   /locus_tag="MPNE_0205"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86742"
FT                   /db_xref="GOA:A0A0H3DNG0"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNG0"
FT                   /protein_id="ADK86742.1"
FT                   /translation="MQRIKKGDKVVVITGKNKGGSGIVLKIMPARQQAIVEGLNKVTRH
FT                   KKKDQTTKRAAKQSTGKVQQEAPIFLSKLALFDQKAKQQTIGKIKYVMDPKTNKKTRVF
FT                   KKSNNTL"
FT   gene            222589..223131
FT                   /gene="rplE"
FT                   /locus_tag="MPNE_0206"
FT   CDS_pept        222589..223131
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplE"
FT                   /locus_tag="MPNE_0206"
FT                   /product="ribosomal protein L5"
FT                   /note="identified by match to protein family HMM PF00281;
FT                   match to protein family HMM PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86675"
FT                   /db_xref="GOA:A0A0H3DLL5"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLL5"
FT                   /protein_id="ADK86675.1"
FT                   /translation="MNNLKAHYQKTIAKELQKSFAFSSIMQVPRLEKIVINMGVGDVIR
FT                   DSKFLESALNELHLISGQKPVATKAKNAISTYKLRAGQLIGCKVTLRGERMWAFLEKLI
FT                   YVALPRVRDFRGLSLKSFDGRGNYTIGIKEQIIFPEIVYDDIKRIRGFDVTLVTSTNKD
FT                   SEALALLRALNLPLVKG"
FT   gene            223133..223318
FT                   /gene="rpsN"
FT                   /locus_tag="MPNE_0207"
FT   CDS_pept        223133..223318
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsN"
FT                   /locus_tag="MPNE_0207"
FT                   /product="ribosomal protein S14p/S29e"
FT                   /note="identified by match to protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86921"
FT                   /db_xref="GOA:A0A0H3DMF4"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMF4"
FT                   /protein_id="ADK86921.1"
FT                   /translation="MAKKSLKVKQTRIPKFAVRAYTRCQRCGRARAVLSHFGVCRLCFR
FT                   ELAYAGAIPGVKKASW"
FT   gene            223312..223740
FT                   /gene="rpsH"
FT                   /locus_tag="MPNE_0208"
FT   CDS_pept        223312..223740
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsH"
FT                   /locus_tag="MPNE_0208"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87107"
FT                   /db_xref="GOA:A0A0H3DMY8"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMY8"
FT                   /protein_id="ADK87107.1"
FT                   /translation="MITTTKPIKAHFDPVADLLTKINNARKAKLMTVTTIASKLKIAIL
FT                   EILVKEGYLANFQVLENKSKTKRIVTFNLKYTQRRIPSINGVKQISKPGLRIYRPFEKL
FT                   PLVLNGLGIAIISTSDGVMTDKVARLKKIGGEILAYVW"
FT   gene            223747..224301
FT                   /gene="rplF"
FT                   /locus_tag="MPNE_0209"
FT   CDS_pept        223747..224301
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplF"
FT                   /locus_tag="MPNE_0209"
FT                   /product="ribosomal protein L6"
FT                   /note="identified by match to protein family HMM PF00347;
FT                   match to protein family HMM TIGR03654"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87044"
FT                   /db_xref="GOA:A0A0H3DKX2"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKX2"
FT                   /protein_id="ADK87044.1"
FT                   /translation="MSKIGNRTITLDPAKVNLNFQKDHIAVKGPLGQIELKLPPNLPLK
FT                   FELKDNNLQITRNNELKQSKIFHGTYNALITNAIIGVTQGFEKKLRLVGVGYRANVEGE
FT                   TLNLQLGYSHPIKEKIPKGLTVKVEKNTEITISGISKELVGQFATEVRKWRKPEPYKGK
FT                   GVLYFDEVIVRKAGKTAEGKK"
FT   gene            224302..224652
FT                   /gene="rplR"
FT                   /locus_tag="MPNE_0210"
FT   CDS_pept        224302..224652
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplR"
FT                   /locus_tag="MPNE_0210"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86776"
FT                   /db_xref="GOA:A0A0H3DM20"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM20"
FT                   /protein_id="ADK86776.1"
FT                   /translation="MKTRTEQRRLRHKRIVKKIRATNHDNRVVLMVIKSLNHISVQAWD
FT                   FSQNIVLASSSSLALKLKNGNKDNAKLVGQDIADKLVKLKLTNVVFDTGGSKYHGRIAA
FT                   LAEAARERGLNF"
FT   gene            224656..225315
FT                   /gene="rpsE"
FT                   /locus_tag="MPNE_0211"
FT   CDS_pept        224656..225315
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsE"
FT                   /locus_tag="MPNE_0211"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by match to protein family HMM PF00333;
FT                   match to protein family HMM PF03719; match to protein
FT                   family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86962"
FT                   /db_xref="GOA:A0A0H3DP25"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP25"
FT                   /protein_id="ADK86962.1"
FT                   /translation="MTDQNQKANQGNGLQTTNLQAHAQRKHNLRPSSEGIKKAVSKKEG
FT                   GGHNRNNQNRRFQKPAFKSEFEERIVKLKRISKTTKGGRNMRFSVLVVVGNRKGKIGYG
FT                   IAKALEVPNAIKKAIKAAHNSLHTIEIHKGSIYHEVIGRSGASRVLLKPAPQGTGIIAG
FT                   GAIRAIIELAGYSDIYTKNLGRNTPINMIHATMDGILKQLSPRRVAILRNKNLNEL"
FT   gene            225319..225774
FT                   /gene="rplO"
FT                   /locus_tag="MPNE_0212"
FT   CDS_pept        225319..225774
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplO"
FT                   /locus_tag="MPNE_0212"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by match to protein family HMM PF00256;
FT                   match to protein family HMM PF01305; match to protein
FT                   family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86710"
FT                   /db_xref="GOA:A0A0H3DLR5"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLR5"
FT                   /protein_id="ADK86710.1"
FT                   /translation="MELNQLKSVPKARNHKTKTLGRGHGSGLGKTSGRGQKGQKARKSG
FT                   LTRPGFEGGQTPLYRRLPKFGNARKGFLKQEWVVLNLNKIAKLKLDKINRASLIEKQVI
FT                   SAKSQLPIKLIGNTKLEKPLHFEVHKVSKQALKAVENANGSVKLLEK"
FT   gene            225774..227207
FT                   /gene="secY"
FT                   /locus_tag="MPNE_0213"
FT   CDS_pept        225774..227207
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="secY"
FT                   /locus_tag="MPNE_0213"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by match to protein family HMM PF00344;
FT                   match to protein family HMM TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87083"
FT                   /db_xref="GOA:A0A0H3DMY1"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMY1"
FT                   /protein_id="ADK87083.1"
FT                   /translation="MQAKPTTAVKQKQNFGQRLFTLLRNRDFMISFLITVVLLVLFRVL
FT                   AIIPLPGIQVNQTGLDQNSNDFFSLFNLLGGGGLNQLSLFAVGISPYISAQIIMQLLST
FT                   DLIPPLSKLVNSGEVGRRKIEMITRIITLPFALVQSFAVIQIATNSGGGSSPITLKNNG
FT                   SDFVAFYIIAMTAGTYLSVFLGDTISKKGIGNGITLLILSGILAQLPEGFIAAYSVLSG
FT                   VVVTINATLTTAISFFIYFMAFLALLFATTFITQATRKIPIQQSGQGLVTESSALPYLP
FT                   IKVNSAGVIPVIFASSIMSIPVTIAQFQPQTESRWFVEDYLSLSKPTGIVLYGILVILF
FT                   SFFYSYIQINPERLAKNFEKSGRFIPGIRPGKDTEKHIARVLVRINFIGAPFLTVIAII
FT                   PYIVSALIHLPNSLSLGGTGIIIIVTAVVEFMSALRSAATATNYQQLRRNLAIEVQKTA
FT                   QQDKEEQLRAETPGIGNLW"
FT   gene            227207..227848
FT                   /locus_tag="MPNE_0214"
FT   CDS_pept        227207..227848
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0214"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="identified by match to protein family HMM PF00406;
FT                   match to protein family HMM PF05191; match to protein
FT                   family HMM TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87047"
FT                   /db_xref="GOA:A0A0H3DMT9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="InterPro:IPR036193"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMT9"
FT                   /protein_id="ADK87047.1"
FT                   /translation="MENKFLFLGAPGVGKGTLAKQVANTTGLFHLSTGDIFRSVMQEQG
FT                   ALSQTLAHYMNQGLYVPDELTNQTFWHFVTTHQNELHKGFILDGYPRTLNQLEFLQSKL
FT                   QLDQVFHLKLSDPQVLVARILNRLVCPSCGSVYNKQSKPPLKANQCDRCHATLQARNDD
FT                   TEAVILKRLTLYEDTVKPLIEAFTKQGILTVIEAQLPLEQQVNLVQQLVH"
FT   gene            227848..228594
FT                   /gene="map"
FT                   /locus_tag="MPNE_0215"
FT   CDS_pept        227848..228594
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="map"
FT                   /locus_tag="MPNE_0215"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM TIGR00500"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87213"
FT                   /db_xref="GOA:A0A0H3DND8"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DND8"
FT                   /protein_id="ADK87213.1"
FT                   /translation="MVYLKSAREVEQIRQACKIFQEAKAYFTIERLLGKSLTAIDQALK
FT                   QFIESKGATCAFHKYQNFPGFNCLSLNETVIHGIADNRVFGVKDKLTLDIGINLNGYIC
FT                   DAAFTVLGPKAPEPMQTLLEVTEACFTAVVEPQLRPNNPTGNVSHAIQTYFESKGYYLL
FT                   KQFGGHGCGIKVHEEPLILNYGKPDTGTKLEPGMVLCIEPMVMTDSDAMVMHNNSWNVL
FT                   TPKSRYNCHVEQMYVITTSGFECLTN"
FT   gene            228594..228830
FT                   /gene="infA"
FT                   /locus_tag="MPNE_0216"
FT   CDS_pept        228594..228830
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="infA"
FT                   /locus_tag="MPNE_0216"
FT                   /product="translation initiation factor IF-1"
FT                   /note="identified by match to protein family HMM PF01176;
FT                   match to protein family HMM TIGR00008"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87140"
FT                   /db_xref="GOA:A0A0H3DL79"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL79"
FT                   /protein_id="ADK87140.1"
FT                   /translation="MQPKFNNQAKQDKLVLTGKILEIIHGDKFRVLLENNVEVDAHLAG
FT                   KMRMRRLRILPGDLVEVEFSPYDLKLGRIIGRK"
FT   gene            228841..228954
FT                   /gene="rpmJ"
FT                   /locus_tag="MPNE_0217"
FT   CDS_pept        228841..228954
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmJ"
FT                   /locus_tag="MPNE_0217"
FT                   /product="ribosomal protein L36"
FT                   /note="identified by match to protein family HMM PF00444;
FT                   match to protein family HMM TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86804"
FT                   /db_xref="GOA:A0A0H3DKN2"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKN2"
FT                   /protein_id="ADK86804.1"
FT                   /translation="MKVRASVKPICKDCKIIKRHQIVRVICKTQKHKQRQG"
FT   gene            228954..229328
FT                   /gene="rpsM"
FT                   /locus_tag="MPNE_0218"
FT   CDS_pept        228954..229328
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsM"
FT                   /locus_tag="MPNE_0218"
FT                   /product="30S ribosomal protein S13"
FT                   /note="identified by match to protein family HMM PF00416;
FT                   match to protein family HMM TIGR03631"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86745"
FT                   /db_xref="GOA:A0A0H3DLV9"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLV9"
FT                   /protein_id="ADK86745.1"
FT                   /translation="MARILGIDIPNQKRIEIALTYIFGIGLSRSQAILKQANINPDKRV
FT                   KDLTEEEFVAIRNVASAYKIEGDLRREIALNIKHLSEIGAWRGLRHRKNLPVRGQRTRT
FT                   NARTRKGPRKTVANKKIESK"
FT   gene            229328..229693
FT                   /gene="rpsK"
FT                   /locus_tag="MPNE_0219"
FT   CDS_pept        229328..229693
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsK"
FT                   /locus_tag="MPNE_0219"
FT                   /product="30S ribosomal protein S11"
FT                   /note="identified by match to protein family HMM PF00411;
FT                   match to protein family HMM TIGR03632"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86660"
FT                   /db_xref="GOA:A0A0H3DLJ7"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLJ7"
FT                   /protein_id="ADK86660.1"
FT                   /translation="MAKKKKINVSSGIIHVSCSPNNTIVSASDPGGNVLCWASSGTMGF
FT                   KGSRKKTPYSAGIAADKVAKTVKEMGMATVKLFVKGTGRGKDTAIRSFANAGLSITEIN
FT                   EKTPIPHNGCKPPKRPR"
FT   gene            229699..230682
FT                   /gene="rpoA"
FT                   /locus_tag="MPNE_0220"
FT   CDS_pept        229699..230682
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpoA"
FT                   /locus_tag="MPNE_0220"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01000;
FT                   match to protein family HMM PF01193; match to protein
FT                   family HMM PF03118; match to protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86748"
FT                   /db_xref="GOA:A0A0H3DK43"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK43"
FT                   /protein_id="ADK86748.1"
FT                   /translation="MEKFLKYEIKVNNEQARANPNYGIFEVGPLESGFGITIGNAMRRV
FT                   LLSCIPGASVFALSISGAKQEFAAVEGMKEDVTEVVLNFKQLVVKISDLLFEDGEMVEP
FT                   PLERWPLLTVTAEKAGPVYAKDLECPAGFEVVNKDLYLFSLQTDKKVTVNVYVKQGRGF
FT                   VTFLENREMINSLGIIATDSNFSPVLHCGYEVQELKTSKQKITDHLTFKIATNGAISAV
FT                   DAFAMAAKILIEHLNPIVNVNESIKALNIIQEKAEERRVRSFAKQIEELDFTVRTFNCL
FT                   KRSGIHTLQELLSKSLADIREIRNLGKKSEREIIKKVHELGLKLRS"
FT   gene            230685..231059
FT                   /gene="rplQ"
FT                   /locus_tag="MPNE_0221"
FT   CDS_pept        230685..231059
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplQ"
FT                   /locus_tag="MPNE_0221"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by match to protein family HMM PF01196;
FT                   match to protein family HMM TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86899"
FT                   /db_xref="GOA:A0A0H3DKY9"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKY9"
FT                   /protein_id="ADK86899.1"
FT                   /translation="MSYINKPGKTSAWRVMTVRQQVSAVLAYGKIETTLKKAKNTQKRL
FT                   DKLITLAKVDNFNNRRQVKKWLLNTNLFDVDQLMDHLFSKVAPKYEKTPGGYSRVLKLG
FT                   PRRGDATEMAILQLTDAKYK"
FT   gene            231043..231867
FT                   /locus_tag="MPNE_0222"
FT   CDS_pept        231043..231867
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0222"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86833"
FT                   /db_xref="GOA:A0A0H3DKC5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKC5"
FT                   /protein_id="ADK86833.1"
FT                   /translation="MLNTNKQAAASFQGVYFSYSELPLIRNLSFDVFEGEYVCIVGHNG
FT                   SGKSTISKLLTGLLKPQAGTIKIFGKTISSENVTYLRNHIGIIFQNPDNQFIGITVEDD
FT                   IAFGLENRRYTREKMKSIIEDVAQQAGITELLQKEPHNLSGGQKQRVAIASVLALNPAI
FT                   IIFDESTSMLDPKAKRTIKQFMVELRNQGKCVISITHDMEEVTKADKVLVMNEGRLIRQ
FT                   GKPKDVFNSAAELQKIRLDIPFSLSLSTKVNGVTSTIDYQQLIEAIGKLWKK"
FT   gene            231855..232766
FT                   /locus_tag="MPNE_0223"
FT   CDS_pept        231855..232766
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0223"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86794"
FT                   /db_xref="GOA:A0A0H3DKM1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKM1"
FT                   /protein_id="ADK86794.1"
FT                   /translation="MKKIVELKNPLRDGEILSVSNLSCFFNEKTVHEVKVIDNFSYTFA
FT                   KNKVYCIIGDSGSGKSTLVNHFNGLIKPAYGDIWVKDIYIGQKQRKIKDFKRLRKTISI
FT                   VFQFPEYQLFKDTVEKDIMFGPIALGQSKNEARQKAAYYLEKMGLKYTFLERNPFELSG
FT                   GQKRRVAIAGILAIEPEVLIFDEPTAGLDPEGEREMMRLIKDAKASGRTVFMITHQMEN
FT                   VLEVADEVLVLSKGQLVKSGDPYEVFMDEAFLAHTTIIMPPVIQVIKDLINLNPKFSCL
FT                   LDFKPRNLDQLADAINNTIAHG"
FT   gene            232759..234063
FT                   /locus_tag="MPNE_0224"
FT   CDS_pept        232759..234063
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0224"
FT                   /product="cobalt transport protein"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86791"
FT                   /db_xref="GOA:A0A0H3DM32"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM32"
FT                   /protein_id="ADK86791.1"
FT                   /translation="MDSFFINGYVPRDTFIHRLHPTTKLLIFLLFVILVFVPIGFVFQS
FT                   VIFVFATVIFFVAKLPGRFYLSSIKSISLLFLLLLFVNWFTFRDPGFYITADQVNTVKP
FT                   HFNGNNFNFWNISLFNYQDNVFSQVFNFNRANMTELNKINFFFKETANANAYTKVTGID
FT                   KLAEMLASKNLFKFNGSTNGIDKNKILGAFLDHKIAVYLGRSWGGDFSGFVIDVSVSDK
FT                   TSTFTIKPFLANSNYVLTLRAIILAFYVTQKILIMIILATVLTSTSSSVELAYGIERLL
FT                   WPLKLLRVPVNVFAMTIAIAIRFVPSLLLESQRILNAQASRGLDFKNGNFFVKMRSLSS
FT                   LVVPMISIAFRNAGELASAMEARGYDPTKKRTTYRKFKIDWVDATALILTALYFVVIIF
FT                   LTVKGAVFLDLGTPEWLLTGKIKEQVERSLSVKSA"
FT   gene            234056..234787
FT                   /gene="truA"
FT                   /locus_tag="MPNE_0225"
FT   CDS_pept        234056..234787
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="truA"
FT                   /locus_tag="MPNE_0225"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="identified by match to protein family HMM PF01416;
FT                   match to protein family HMM TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86864"
FT                   /db_xref="GOA:A0A0H3DKV4"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKV4"
FT                   /protein_id="ADK86864.1"
FT                   /translation="MPRYLAIVAYNGAPFRGWAKQPGYHTVQGQIEQNLALIYQTPINI
FT                   YGSGRTDKGVHAINQTFHVDLPDKLPLKQLIAKLNQLNYPDIFVKALVPVAPRFHARFA
FT                   VKTKVYEYLINTRAFNPAQYHTVWQYNHPLDLAQLEADTTLFLGRKDFWSFSTASQKDT
FT                   QRTISKIIVQQDHTGTVKLTFFGNGFLRNQIRMMVASLVALNNRTLMRETVQQLFDQPQ
FT                   KGGCKVKAPACGLYLKTVLYE"
FT   gene            234780..236615
FT                   /gene="pepF"
FT                   /locus_tag="MPNE_0226"
FT   CDS_pept        234780..236615
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pepF"
FT                   /locus_tag="MPNE_0226"
FT                   /product="oligoendopeptidase F"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01432;
FT                   match to protein family HMM PF08439; match to protein
FT                   family HMM TIGR00181"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86958"
FT                   /db_xref="GOA:A0A0H3DKM4"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKM4"
FT                   /protein_id="ADK86958.1"
FT                   /translation="MNNQYNWNLEVLLNGKSLADNFTELKQLSEQEKALYDGGACFQTK
FT                   AKFTEFLQLQEKIEVLENRYSNFLSNKHAENSLDKTINDALFQYEMFKSEHALVFVDFE
FT                   KNLFKHEKVIRAYLQDPALKQYQRDFELVWRNKKHQIDPASQKLLAQISPALNQADKIF
FT                   NVLSTADLNLQPVVYKGKTYVINAVSDYQSLLENKDRGLREAAYKVWLEIYWPTRNTLS
FT                   VSLVENYIQLETFAKLKKHPNYIAKTAFDDEIDVAFIDFVYEQVASFAPTFKAFQSLRK
FT                   QIYKHVLKLDKAQPWDLSVPLFKASGDYTIEQAQTDALKILAPMGSEYLEVVKEAFRER
FT                   WISWLPDKNKYTGAYSISNVKGLDHYFILMNFDKTRASLNTLVHELGHSVHSWYASKYQ
FT                   TQNLDPTIFYAEIASICNELLLCYHDIINYENRNPQQLIRSLMEQISHFFGATTRQLMF
FT                   SQFEQDTLKLIQQNQKPDFKTLVEIYGKTAIKYQAANADAITKKLKQTKYQKSLAYITS
FT                   IPHFYAGNFYVYKYAIGQVVGTLVGKKLSAGDSNMLAAYKRFLSSGSTLPPLETIKLLG
FT                   IDLTQPEPWQEAHAELKRWIKLVQTAFKQLQHKKR"
FT   gene            236615..237574
FT                   /locus_tag="MPNE_0227"
FT   CDS_pept        236615..237574
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0227"
FT                   /product="adenine-specific DNA modification methylase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87019"
FT                   /db_xref="GOA:A0A0H3DKU3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR025247"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKU3"
FT                   /protein_id="ADK87019.1"
FT                   /translation="MHYFNRAKKAKNNEFYTLFEDIAAEVACYPNAFKGKVVLCNCNDG
FT                   YQSNFWQFFQSQFHALGLKKLVAIAFNPLGNSYQLNFDGKEIKELPLAGNGSFDSAEAI
FT                   VLLKQSDIVVTNPPFSLFQDFVCLLAEHGKQFLVLGHNGAVGYNQIFKLFKEEQLWYGH
FT                   TVNSSMLFQVQSNFKLYDPKSVNFVKKYGQLFQKVPGISWFTNLKKNQQPAWLKTKSRY
FT                   QGNEHKYPKFDWYDAIFVSKVKEIPLDWFGYMGVPLTFLNCFNPKQFELIDCLANPYAT
FT                   LDTLKTNAYVRSHHGDVRNVKGKRRYVRVVIKQRQNVI"
FT   gene            237686..238648
FT                   /pseudo
FT                   /locus_tag="MPNE_0228"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            238864..240102
FT                   /pseudo
FT                   /locus_tag="MPNE_0229"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF03202; match to
FT                   protein family HMM PF03305"
FT   gene            240220..242598
FT                   /pseudo
FT                   /locus_tag="MPNE_0230"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF03202; match to
FT                   protein family HMM PF03305"
FT   gene            242734..243819
FT                   /locus_tag="MPNE_0231"
FT   CDS_pept        242734..243819
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0231"
FT                   /product="type I restriction modification DNA specificity
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87251"
FT                   /db_xref="GOA:A0A0H3DLT5"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLT5"
FT                   /protein_id="ADK87251.1"
FT                   /translation="MEIKTYKIKDICDITRGRVISKLDIKKDPGVFPVYSAATNNDGEF
FT                   GRINSYDFDGEYVTWTADGYGGAVFYRNGKFSITNLCGLLKVKNKEISSKYLAHILKLE
FT                   APKFTNRVFKNRPKLTHKTMAEIPIDFPPLKIQEKIATILDTFTELRARKKQYAFYRDY
FT                   LLNQENIRKIYGANIPFETFQVKDICEIRRGRAITKAYIRNNPGENPVYSAATTNDGEL
FT                   GHIKDCDFDGEYITWTTNGYAGVVFYRNGKFNASQDCGVLKVKNKKICTKFLSLLLKIE
FT                   APKFVHNLASRPKLSQKVMAEIELSFPPLEIQEKIADILFAFEKLCNDLVEGIPAEIEL
FT                   RKKQLDYYQNFLFNWVQKIRN"
FT   gene            243930..244952
FT                   /pseudo
FT                   /locus_tag="MPNE_0232"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF03257"
FT   gene            244958..245311
FT                   /pseudo
FT                   /locus_tag="MPNE_0233"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            245319..245540
FT                   /pseudo
FT                   /locus_tag="MPNE_0234"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            245652..245924
FT                   /locus_tag="MPNE_0235"
FT   CDS_pept        245652..245924
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0235"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86754"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKJ4"
FT                   /protein_id="ADK86754.1"
FT                   /translation="MKLIKLARFHRFLKQDQLQLVSLFSQNFLQVLLTPLNKPVNLFSE
FT                   NTTMKTNKKYAFAALLMQAQAKLPNSFKFFLSKKEVLLNERKNSL"
FT   gene            245902..246348
FT                   /locus_tag="MPNE_0236"
FT   CDS_pept        245902..246348
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86936"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMH5"
FT                   /protein_id="ADK86936.1"
FT                   /translation="MKEKTPFKNEKEFHEMVKKTKKGTFSGWYIIDKDNNSVEFSGKFN
FT                   RQFKLNKPVIPVNTEYVTRKELNEYKDSNDQRLTKIETTLAAQGEQINKLTQTVEKQGE
FT                   QIRELQVEQKAQGEQIKAQGETLKLILQTLQKMSDRLDKIDPSK"
FT   gene            246809..248233
FT                   /locus_tag="MPNE_0237"
FT   CDS_pept        246809..248233
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0237"
FT                   /product="putative adhesin P1"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86827"
FT                   /db_xref="InterPro:IPR022116"
FT                   /db_xref="InterPro:IPR022400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNP5"
FT                   /protein_id="ADK86827.1"
FT                   /translation="MRDNTAKGITAGSGSQQTTYDPARTEATLTTITFALRRYDLAGRA
FT                   LYDLDFSKLNPQTPTRDANGQITFNPFGGFGLSGSAPQQWNEVKNKVPVEVAQDPTDPY
FT                   RFAVLLVPRSVVYYEQLQRGLALPNQGSSSGSGQQNTTIGAYGLKVKNAEADTAKSNEK
FT                   LQGDESKSSNGSSSTSTTTQRGSTNSDTKVKALKIEVKKKSDSEDNGQLQLEKNDLANA
FT                   PIKRGEESGQSVQLKADDFGTAPSSSGSGGNSNPGSPTPWRPWLATEQIHKDLPKWSAS
FT                   ILILYDAPYARNRTAIDRVDHLDPKAMTANYPPSWRTPKWNHHGLWDWKARDVLFQTTG
FT                   FFNPRRHPEWFDQGQAVADNTQTGFDESNTSNTKQGFQKEADSDKSAPIALPFEAYFAN
FT                   IGNLTWFGQALLVFGGNGHVTKSAHTAPLSIWLYIYLVKAVTFRLLLANSLLSKSNIYK
FT                   KQLIKASRAKRLFLLS"
FT   gene            248339..248611
FT                   /locus_tag="MPNE_0238"
FT   CDS_pept        248339..248611
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87104"
FT                   /db_xref="GOA:A0A0H3DPI3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPI3"
FT                   /protein_id="ADK87104.1"
FT                   /translation="MENARVLLIVFGIVLIFVGIGFLFWALRITLKRQKGGEATTSLTT
FT                   NDPALKNFGRPSWWQRNNQLVLFLLATVFLMLGIGGLSSIPSMFK"
FT   gene            248644..251466
FT                   /locus_tag="MPNE_0239"
FT   CDS_pept        248644..251466
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0239"
FT                   /product="putative PTS system glucose-specific EIICBA
FT                   component"
FT                   /note="identified by match to protein family HMM PF00358;
FT                   match to protein family HMM PF00367; match to protein
FT                   family HMM PF02378; match to protein family HMM TIGR00826;
FT                   match to protein family HMM TIGR00830"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87057"
FT                   /db_xref="GOA:A0A0H3DMU9"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMU9"
FT                   /protein_id="ADK87057.1"
FT                   /translation="MQIKAQDTGQQKKSCLLSNIRNKWKNRNRGSFRQWVGKLSNGLMI
FT                   PIAVLPIAGIFLGVGDAIAGNAGDLTGLRYFGLFIKNGGDVVFANLPILFAIAIAITFS
FT                   QDAGVAGFSAFVFWAAMNGFMSSLILPFDKAGKIITDTSTPIAGFKVLYYKSVPVHAIA
FT                   TTLGLRTLSTSVFGGIIVGALTSVLYKKFYAIRLPDVIGFFSGTRFVPIICFVVAIPVA
FT                   LILLMIWPAVSIGLNAIGTGLGFLGGKGYGANSLIFGYIERSLIPFGVHHAFYAPLWYT
FT                   SAGGSLQEIVNQQVWIRPDFHLSDNYVARVIGWVDPNNSSMYIIPGALNGQNGSSTGNT
FT                   MSKDLNGALSAYMSKESTAFLTWKDLVDGLTFKGNFDKMAENGLLDGSNKIWLGLNGSG
FT                   ILGKKLLLSDGNVYTITFKTFANTTPIAWSKGAQAVLPLNASSTIVNNPTALAAATQSN
FT                   NNTNNIKLYPVNSFRVAVESLNPAQYSQGKFPFMLFGIPAAGVAMILAAPKDRRKEAAS
FT                   IVGSAAFTSFLTGITEPFEFTFLFLAPWLFYGVHAVLAAVSFWLMNILGANVGQTFSGS
FT                   FIDFILYGALPDGRRWLANSYLVPIIGLFLAAIYFPTFYFLIKHFNLATPGRGGKLITK
FT                   KEYLASKAAAKAEGVSGVAENFTQTQIEAGILLQAYGGKENIVELGACITKLRVTVKNP
FT                   ELVKEEPIKELGAAGVMRTTPTFFVAVFGTRAAVYKSAMQDIIQGKVNWEALQKVINTD
FT                   QLAVEPKETTPPKEVMPVVQDEIVILSPVNGTLKSLNQVPDETFKQKLVGEGVAIVPSD
FT                   GHFKAPGEAGVKTELAFPGGHAYIFDIDGIKVMLHIGIDTVQINAKKQPGEPLEVFDIK
FT                   TKQGEYTKEKSESVVEVDLKKLSKKYNPITPFVVMKESLENFKLVPIRQRGEIKVGQPI
FT                   FKLVYKKSQA"
FT   gene            252076..252960
FT                   /gene="rpsB"
FT                   /locus_tag="MPNE_0240"
FT   CDS_pept        252076..252960
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsB"
FT                   /locus_tag="MPNE_0240"
FT                   /product="ribosomal protein S2"
FT                   /note="identified by match to protein family HMM PF00318;
FT                   match to protein family HMM TIGR01011"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87275"
FT                   /db_xref="GOA:A0A0H3DLK2"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLK2"
FT                   /protein_id="ADK87275.1"
FT                   /translation="MSELITTPVETTAKAELVSLAKLGEMRTHVGMVKRYWNPKMGFFI
FT                   EPERKHNNDHFVLELQRQSLQTAYNYVKEVAQNNGQILFVGTKNDYVKKLVNNIAKRVH
FT                   VAFITQRWLGGTLTNFKTLSISINKLNKLVEKQAENAADLTKKENLMLSREIERLEKFF
FT                   GGVKSLKRLPNLLIVDDPVYEKNAVAEANSLRIPVVALCNTNTNPELVDFIIPANNHQP
FT                   QSTCLLMNLLADAVAEAKAMPTMFAYKPDEEIQIEIPQKQEAPRQVVNRANSKQITSQR
FT                   LNITRNPEVLTRE"
FT   gene            252953..255571
FT                   /locus_tag="MPNE_0241"
FT   CDS_pept        252953..255571
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0241"
FT                   /product="E1-E2 ATPase"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00690; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87055"
FT                   /db_xref="GOA:A0A0H3DLD0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLD0"
FT                   /protein_id="ADK87055.1"
FT                   /translation="MNKWTGLSAAAVLESRAQHGANLIPTKKLTPFWLLFLEQFKSLVV
FT                   ILLLVATILSLVVAIISGVNANWLFDHNLVIEWTQPFVILITVLANSLIGSIQEFKAQK
FT                   SAHTLKSLTQPFTRVFREEGLVSLPVGEVVVGDIIFLEAGDIIPADGKVLQANHLRCME
FT                   SFLTGESVPVDKSVVNTGGKGLLEQTNLLFSGAQVVFGSGVFEVTAVGLNTQVGQIVKT
FT                   VDSSATKLSPLQQKLEKVGKWFSWFGLGLFVVVFLVQLGLLGFHNFSANWSIALIGAIA
FT                   LVVAIIPEGLVTFINVIFALSVQKLTKQKAIIKYLAAIETLGGVQIICTDKTGTLTQNK
FT                   MKVVDYFCFSNTTQTDLARALCLCNNATVNTNGDSTGDPTEIALLQWLDRDGLELNHYT
FT                   RVYEKAFDSNRKLMSVVVQKDNRFIVIVKGAHDVLLPLCKGLDSNQIKPLIDERASNGL
FT                   RNLAVGLKVLYCFDPENTQTVNELESELDFLGFVSLQDPPRIESKAAIMACHQANITPI
FT                   MITGDHLKTATAIAKELGILTDERQAILGVDLDPAKIMEYRVFARVTPQQKLEIVNAWK
FT                   QAGYTVAVTGDGVNDAPALVTSDVGCCMGQTGVDIAKDAADVIISDDNFATIVNGIEQG
FT                   RKTFLTCKRVLFNLFLTSIAGTIVVLLGLFVLGEVFREQLSKANHNFQVFTPTQLLIIN
FT                   LFVHGFPAVALAIQPVQEKLMLKPFSTKNLFYNRGGFDLIWQSLLLSFLTLLFYSLGMV
FT                   YAINDPELGKSGDLINRAGATCGFMVLGGSAALNSLNLMVDRPLVATNPKHYGIVWLGA
FT                   LSSIFVFLLIIFINPLGLVFSTLKDLTAHPVLIGYSFGGVLLYMTINEVVKLIRLSYGS
FT                   V"
FT   gene            255558..257984
FT                   /gene="secA"
FT                   /locus_tag="MPNE_0242"
FT   CDS_pept        255558..257984
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="secA"
FT                   /locus_tag="MPNE_0242"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF01043; match to protein
FT                   family HMM PF07516; match to protein family HMM PF07517;
FT                   match to protein family HMM TIGR00963"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87241"
FT                   /db_xref="GOA:A0A0H3DLS9"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLS9"
FT                   /protein_id="ADK87241.1"
FT                   /translation="MGLFNFLKLVSPRHRIYHKASKIANEVEGHKNYYRNLTDVQLLEE
FT                   SNKLVDLVTKQNYTILDVAVAALALIREVVYRETGEFAYRVQIIGAYIVLIGDFAEMMT
FT                   GEGKTLTIVLAAYVSALEKRGVHVVTVNEYLAQRDATNATKILKRVGMTVGCNFANLAP
FT                   HLKQAAFACDVTYTTNSELGFDYLRDNMVHRFEDKKIRELHFAIVDEGDSVLIDEARTP
FT                   LIISGPAKNEFAAYVAVDRFVKKLKEDEYKIDPESRAPALTELGIKHAEKNFKTDNLFA
FT                   LENSDLFHKIINALTAVKVFEQGKEYIVRDGKVLIVDHFTGRILEGRSYSNGLHQAVQA
FT                   KEMVEIEPENVIVATITYQSFFRLYNRLSAVSGTAFTESEEFLKIYNMVVVPVPTNRPN
FT                   IRKDRADSVFGTPNIKWLAVVKEVKRIHETGRPILIGTANIDDSELLHNYLQEANIPHE
FT                   VLNAKNHSREAEIVAKAGQKGAVTISTNMAGRGTDIRLGEGVAEMGGLYVLGTERNESR
FT                   RIDNQLRGRAGRQGDRGETKFFISLGDALFKRFAHDRIERAITKLGNDTFDSSFFSKML
FT                   SRTQKRVEAINFDTRKNLIDYDHVLASQRELIYKQRDKFLLATDLSDMIDKMLEKFVEQ
FT                   FCDQYRNPKNQNLVNHIALSEALNLELNMHGVISPKLFENMTFDATVHKTHSLIGEKIT
FT                   NKVKVLTPPIALIRFREIMITAMDKHWIEHLDNVFKLREGVTLRSMEQTSPLNVYIRET
FT                   DILFQTMLQKIARDVIIQIANLATPEEFDEELMKANALKKLQALREAHEKSNQGQ"
FT   gene            257959..259932
FT                   /gene="uvrB"
FT                   /locus_tag="MPNE_0243"
FT   CDS_pept        257959..259932
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="uvrB"
FT                   /locus_tag="MPNE_0243"
FT                   /product="excinuclease ABC, B subunit"
FT                   /EC_number="3.1.25.-"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM TIGR00631"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86990"
FT                   /db_xref="GOA:A0A0H3DMK5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMK5"
FT                   /protein_id="ADK86990.1"
FT                   /translation="MKSPTKDSKLFHLKSNFAPTGDQPAAIAKLAEFQTNEQVLLGATG
FT                   TGKTFTIANVIQKVQLPTVVIAHNKTLAGQLYQELKELFPNNAVEYFISYFDFYQPEAY
FT                   LPAKGVYIEKSATVNEEIKRLRVSTLHSLSTRKDVIVVGSVASIYPTSSPADFAQYSLW
FT                   LVVGKEYGLSELKTQLIHLNYVVNKQQLTPGKFRFQGDVVEVFPGYAQDYVLRLSFFDQ
FT                   QLEQIARIDPLTNKVLETLNSFKLGPADEYIVNQNDLGVALDTIKAELKDRLKYFERLN
FT                   FPERAQRLQTITEHDLADLKAWGVCSGVENYARHLEHRPPHSKPYNIFDYFTKGEWLLV
FT                   VDESHQTLPQIKGMYNTDISRKQSLIEYGFRLPSALDNRPLSYEEFRQGINKVIYVSAT
FT                   PREEEIQLSHNNVVEQLVRPTYLLDPEVIVKPKDNQVEDLVSEIINQRKHNGRTFVTVL
FT                   TIKMAENLTDFLKERNIKVAYIHKDIKALERLILLTDLRKGEYECLVGINLLREGLDVP
FT                   EVSLVAIFDADIPGLPRDERSLIQIIGRAARNVHGRVIMYANTISEQMDKAIKETQRRR
FT                   TIQMAYNEQHHKTPMTVQKPITLNQPIKLKTKSSEQQKAALIKQLTKEMKQAAANQNYE
FT                   LAIEIRDSIFELEKQFRGKIKS"
FT   gene            259935..260342
FT                   /locus_tag="MPNE_0244"
FT   CDS_pept        259935..260342
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86718"
FT                   /db_xref="InterPro:IPR035339"
FT                   /db_xref="UniProtKB/Swiss-Prot:E1QBX4"
FT                   /protein_id="ADK86718.1"
FT                   /translation="MRKLIKLNVIVFVLLYLGELFASLSFKLISCLKTRNQYSLNGYYA
FT                   LFVFVNIIQKMANSFQKLASSVVLFETEINEFLVLFTDTKNKREESEPVRQVSTTQEYH
FT                   QVTLDQQHYFNHKLSDYFRLFKDKTFFFEII"
FT   gene            260447..263539
FT                   /locus_tag="MPNE_0246"
FT   CDS_pept        260447..263539
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0246"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86891"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMC3"
FT                   /protein_id="ADK86891.1"
FT                   /translation="MKLSAIISLSVAGTVGTTAVVVPTTITLVNKTHQVEHESEQSDFQ
FT                   DIRFGLNSVKLPKAQPAAATRITVENGTDKLVNYKSSPQQLFLAKNALKDKLQGEFDKF
FT                   LSDAKAFPALTADLQEWVDQQLFNPNQSFFDLSAPRSNFTLSSDKKASLDFIFRFTNFT
FT                   ESVQLLKLPEGVSVVVDSKQSFDYYVNASAQKLLVLPLSLPDYTLGLNYMFDHITLNGK
FT                   VVNKFSFNPFKTNLNLAFSNVYNGVDVFEAQKNLVGKGKYLNTHVKAEDVKKDVNANIK
FT                   NQFDIAKIIAELMGKALKEFGNQQEGQPLSFLKVMDKVKEDFEKLFNLVRPGLGKFVKD
FT                   LIQSSSQAENKITVYKLIFDNKKTILNLLKELSIPELNSSLGLVDVLFDVITDSDGLYE
FT                   RLQSFKDLIVPAVKTNEKTAALSPLIEELLTQKDTYVFDLIQKHKGILTNLLKNFLADF
FT                   QKSTPFMADQVAIFTELFDNEGAFDLFGEADFVDKIAELFLTKRTVKNGEKIETKDSLL
FT                   VTSLKSLLGEKVAALDDLLDSYIFKNELLNRSVEVAKAEAKDTKGATDYKKEQAKALKK
FT                   LFKHIGENTLSKTNLDKITLKEVKNTENVELEETETTLKVKKLDVEYKVELGNFEIKNG
FT                   LIKAMLEFLPDPKDLETTLDKLLFKGESYKAMKDKYIKEGFPGYGWAKGVVPGAFESIE
FT                   NTFKSAIDKTKSIRDLFGDMLFGNDLSSVKETDSFITLGGSFDIKYGGENLNVLPAYYS
FT                   LINSEIGYQIIGVDTTIDVTKVKVELKNKEYKGKSPAINGQVKLSQSFFNVWTNMFDSI
FT                   TKQIFQKKYEFKDNIQVFARNEDNTSRLELDISDPEQRVIPFAFVDGFGIQLKAVDKNI
FT                   TKEAGNTEPKSPVIQLYEALNKEKDQKQQSKQSPKQLDTKTQLGYLLKLGDNWSKDDYK
FT                   SLIDDTIINNNYLEASFNSKITVDRLGIPIDLWLFKIWPKFNLEIPMQGSLQLYSSSVI
FT                   FPYGIYDTSVQDATKIVKRLNFTDMGFKLNDPKPNFWFVGF"
FT   gene            complement(263536..264000)
FT                   /locus_tag="MPNE_0245"
FT   CDS_pept        complement(263536..264000)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86797"
FT                   /db_xref="GOA:A0A0H3DNL8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNL8"
FT                   /protein_id="ADK86797.1"
FT                   /translation="MLVVQNILQKNDTSKYMLGTQTTNSKPREYGGLIVSTIYIVLFFA
FT                   ILNLTVFFNKTNNINLILKNSCVVSFVVVWLLVCLQGIVRLKTCDGARYEISKFNQYLK
FT                   LGSIYAKPNISFDEYKAKSSSYRKQTRGFWWMNFSLYLLGSLISIVVSLL"
FT   gene            264183..265397
FT                   /locus_tag="MPNE_0247"
FT   CDS_pept        264183..265397
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0247"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86914"
FT                   /db_xref="GOA:A0A0H3DL01"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL01"
FT                   /protein_id="ADK86914.1"
FT                   /translation="MFKYIIKRLGLAVLAMFIVMTIVFFLVNSTGQTPLSATSSKDLEA
FT                   VKTQLDAFGFNDPLIVRYGRYWQTLFSGSLGTYYSSPNQTIDQIVFGRVPNTLYVVLIS
FT                   FFIGSLLGIIFGMISGLFRGKLIDAVINVLVVLFVSIPSFVVGLGLLKAAGLFRLPPRF
FT                   INFDDANFNFGNFLLASIIPILSLVFYTSAAFTYRVRNEVVEVMNQDYIKTARSKGLST
FT                   FAVALYHIFRNSIIPSVPLFVFGISGAFSGGFIIESLFGVQGVSRILIDSVQSNETNLV
FT                   MFNIMFIQGIPLLASVFIELIYVLVDPRIRIASAGGVSLWTKLKFVYLRQAWLRKWRRI
FT                   NHTNSHNVLFNSPQHRQLLELKAIDYKHNTISLTEQQKTTLKIEPTANFVLLGTKCLKI
FT                   ITIHG"
FT   gene            265390..266520
FT                   /locus_tag="MPNE_0248"
FT   CDS_pept        265390..266520
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0248"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87095"
FT                   /db_xref="GOA:A0A0H3DL31"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL31"
FT                   /protein_id="ADK87095.1"
FT                   /translation="MDKHQKFDQSLFQRVDINVLKRSDQLIGKPTTNFVEIMKRLFQNK
FT                   WAILFFLLIVLIILLAIIVPLASPYSAVTPVSNNALAQNLPPRYLWNGAGDIQVEKITA
FT                   RSIAEVAQSSGVLVGKLPEASSNPLATNVKYNIAPYQLAELKNYYPLLGTNGLGVDIWT
FT                   LLWASMAKSLWIAIVVALVSMVFGTIYGAIAGSFVGRAADNIMSRIIEIIDLVPSILWI
FT                   IVLGATFRFGGVKQFDDSVVIFTLIFVFWTWPAATTRIYILKNKDTEYIQAARTLGAKQ
FT                   IRIIFVHMLPVVTGRLAVVFVSLIPAVIGYEASLVFLGLKPATEVGLGALLNQVTSSGN
FT                   IALITSSIVSFAILTVSTRVFANALNDAIDPRVIRR"
FT   gene            266522..269320
FT                   /pseudo
FT                   /locus_tag="MPNE_0249"
FT                   /note="ABC transporter, ATP-binding protein; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00005; match to protein family HMM PF08352; match to
FT                   protein family HMM TIGR01727"
FT   gene            269455..270309
FT                   /pseudo
FT                   /locus_tag="MPNE_0250"
FT                   /note="ABC transporter, ATP-binding protein; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00005; match to protein family HMM PF08352"
FT   gene            270365..270778
FT                   /gene="rplK"
FT                   /locus_tag="MPNE_0251"
FT   CDS_pept        270365..270778
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplK"
FT                   /locus_tag="MPNE_0251"
FT                   /product="ribosomal protein L11"
FT                   /note="identified by match to protein family HMM PF00298;
FT                   match to protein family HMM PF03946; match to protein
FT                   family HMM TIGR01632"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86752"
FT                   /db_xref="GOA:A0A0H3DNG9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNG9"
FT                   /protein_id="ADK86752.1"
FT                   /translation="MAKKTITRIAKINLLGGQAKPGPALASVGINMGEFTKQFNEKTKD
FT                   KQGEMIPCVITAYNDKSFDFILKTTPVSILLKQAAKLEKGAKNAKTIVGKITMAKAKEI
FT                   AQYKLVDLNANTVEAALKMVLGTAKQMGIEVIE"
FT   gene            270778..271458
FT                   /gene="rplA"
FT                   /locus_tag="MPNE_0252"
FT   CDS_pept        270778..271458
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplA"
FT                   /locus_tag="MPNE_0252"
FT                   /product="ribosomal protein L1"
FT                   /note="identified by match to protein family HMM PF00687;
FT                   match to protein family HMM TIGR01169"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86720"
FT                   /db_xref="GOA:A0A0H3DLR7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLR7"
FT                   /protein_id="ADK86720.1"
FT                   /translation="MAKLSKKMKIAVGLVDKTKLYPLQEAVDLVKKTSITKFNGSVDIA
FT                   VSLNLDTTKAEQQLRGAIAFPHSVGKPIRILAITDDEKAALEAGADFVGGIDKINDIKN
FT                   GWLDFDLIITSPKFMAALGKLGKLLGTKGLMPNPKTETVTDDVPAAVRAYKKGKKEYRA
FT                   DSFGNIHMSLGRVDSASNHLVENALALLDLIKSRKPATVKGIYIKNIALTTTMGPSLKV
FT                   KLPD"
FT   gene            271458..272024
FT                   /gene="pth"
FT                   /locus_tag="MPNE_0253"
FT   CDS_pept        271458..272024
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pth"
FT                   /locus_tag="MPNE_0253"
FT                   /product="aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86672"
FT                   /db_xref="GOA:A0A0H3DJT3"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DJT3"
FT                   /protein_id="ADK86672.1"
FT                   /translation="MDKLRLVVGLGNLGKQYAETRHNAGFKVIDRLLSLYHVQLEERNN
FT                   LGEFILLRKHKVVLAKPNTYMNHSGKFVKWACQNWNIKPDKVMVVYDELAFPLGTVRLK
FT                   MQGSANNHNGIKSVIAHLNTEHFNRLRFGIKSDNTSNILHEVVMSEFTPAERNLLETAL
FT                   TKAIEALKGYIDGVTMLKLMEVFNA"
FT   gene            272017..272886
FT                   /gene="tilS"
FT                   /locus_tag="MPNE_0254"
FT   CDS_pept        272017..272886
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tilS"
FT                   /locus_tag="MPNE_0254"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.3.4.-"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM TIGR02432"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87086"
FT                   /db_xref="GOA:A0A0H3DLF6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLF6"
FT                   /protein_id="ADK87086.1"
FT                   /translation="MPKTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQ
FT                   KMVEEYCKQLKVPLIVHTVPEDTVWKKNFQAQARKIRFEQFQKAASLYKVDKLLLAHHR
FT                   DDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGID
FT                   ETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHPDV
FT                   RELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAILDFIQPFQQKHYRLKDEIFLSIKDE
FT                   RLTLLYKS"
FT   gene            272887..273825
FT                   /gene="hprK"
FT                   /locus_tag="MPNE_0255"
FT   CDS_pept        272887..273825
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="hprK"
FT                   /locus_tag="MPNE_0255"
FT                   /product="HPr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF02603;
FT                   match to protein family HMM PF07475; match to protein
FT                   family HMM TIGR00679"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86976"
FT                   /db_xref="GOA:A0A0H3DML8"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DML8"
FT                   /protein_id="ADK86976.1"
FT                   /translation="MKKLLVKELIEQFQDCVNLIDGHTNTSNVIRVPGLKRVVFEMLGL
FT                   FSSQIGSVAILGKREFGFLSQKTLVEQQQILHNLLKLNPPAIILTKSFTDPTVLLQVNQ
FT                   TYQVPILKTDFFSTELSFTVETYINEQFATVAQIHGVLLEVFGVGVLLTGRSGIGKSEC
FT                   ALDLINKNHLFVGDDAIEIYRLGNRLFGRAQEVAKKFMEIRGLGIINVERFYGLQITKQ
FT                   RTEIQLMVNLLSLEKQTTVTFERLGTELKKQRLLGVDLSFYEIPISPGRKTSEIIESAV
FT                   IDFKLKHSGYNSALDFIENQKAILKRKKDES"
FT   gene            273815..274984
FT                   /gene="lgt"
FT                   /locus_tag="MPNE_0256"
FT   CDS_pept        273815..274984
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="lgt"
FT                   /locus_tag="MPNE_0256"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="identified by match to protein family HMM PF01790;
FT                   match to protein family HMM TIGR00544"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87022"
FT                   /db_xref="GOA:A0A0H3DMR1"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMR1"
FT                   /protein_id="ADK87022.1"
FT                   /translation="MNPSVSSRPPWSTAFYLGPGFPIQWYGIIVAIGIAFGILMFVLKL
FT                   IYFYKIQDNSFYFFIFIAVLTMVLGARAWYFLIEAVDGRSSGSNFFDFRNGGLAIQGGV
FT                   LLTTLAGIIYFNVFLNMKTTKTKTTAKLLNNKNQIKTVYVERNISVFVMLDLIAPCVLI
FT                   GQAIGRWGNFFNAEVYGAALVGSKNDTLSAANTTWGFLRILMPKVWDGMFINGSFRIPL
FT                   FLIESFFNTIFFVFIYFVMDHIKGIRSGTIGFSYFLATGIVRLILETQRDEAFKYNTSI
FT                   VFSALLILVGIVGIIYCQTLAIKLRGYFWTYFFLYGWYKVAAFFTTLFMKDRTQACSSK
FT                   FAFYEKSLPEKERSFFQLKYYNDVLPPKIYRLYDHEMLMFDKLEAVPEA"
FT   gene            275013..275432
FT                   /gene="rpsL"
FT                   /locus_tag="MPNE_0257"
FT   CDS_pept        275013..275432
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsL"
FT                   /locus_tag="MPNE_0257"
FT                   /product="ribosomal protein S12"
FT                   /note="identified by match to protein family HMM PF00164;
FT                   match to protein family HMM TIGR00981"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87065"
FT                   /db_xref="GOA:A0A0H3DLE0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLE0"
FT                   /protein_id="ADK87065.1"
FT                   /translation="MATIAQLIRKPRKKKKVKSKSPALHYNLNLLNKKVTNVYSPLKRG
FT                   VCTRVGTMTPKKPNSALRKYAKVRLTNGFEVLAYIPGEGHNLQEHSVTLLRGGRVKDLP
FT                   GVRYHIVRGTLDTVGVEKRRQQRSAYGAKKPKAKS"
FT   gene            275486..275953
FT                   /gene="rpsG"
FT                   /locus_tag="MPNE_0258"
FT   CDS_pept        275486..275953
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsG"
FT                   /locus_tag="MPNE_0258"
FT                   /product="ribosomal protein S7"
FT                   /note="identified by match to protein family HMM PF00177;
FT                   match to protein family HMM TIGR01029"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87185"
FT                   /db_xref="GOA:A0A0H3DLC2"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLC2"
FT                   /protein_id="ADK87185.1"
FT                   /translation="MRKNRAPKRTVLPDPVFNNTLVTRIINVIMEDGKKGLAQRILYGA
FT                   FDLIEQRTKEKPLTVFERAVDNVMPRLELRVRRIAGSNYQVPTEVPQDRKIALALRWIA
FT                   MFARKRHEKTMLEKIANEIIDASNNTGAAIKKKDDTHKMAEANKAFAHMRW"
FT   gene            275976..278042
FT                   /gene="fusA"
FT                   /locus_tag="MPNE_0259"
FT   CDS_pept        275976..278042
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="fusA"
FT                   /locus_tag="MPNE_0259"
FT                   /product="translation elongation factor G"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF03764;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86767"
FT                   /db_xref="GOA:A0A0H3DNI5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNI5"
FT                   /protein_id="ADK86767.1"
FT                   /translation="MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHD
FT                   GESVMDWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLDGAIA
FT                   VLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQSIQQRLGVKAVPIQ
FT                   LPIGAENDFNGIIDLIEEKVYFFDGGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFD
FT                   DQLMADYLEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSP
FT                   VDVPQAKAYGEDGNEVLISASDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVK
FT                   NVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETLVDDKIDVQLEAM
FT                   QFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDI
FT                   LVDRMRREFKVEVNVGAPQVSFRETFNKESEVEGKYIKQSGGRGQYGHVKIRFEPNKDK
FT                   GFEFVDKIVGGRIPREYIKPVQAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEM
FT                   AFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMGDISSRRGLIEGTEQRDN
FT                   VQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK"
FT   gene            278099..278746
FT                   /gene="rpsF"
FT                   /locus_tag="MPNE_0260"
FT   CDS_pept        278099..278746
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsF"
FT                   /locus_tag="MPNE_0260"
FT                   /product="ribosomal protein S6"
FT                   /note="identified by match to protein family HMM PF01250;
FT                   match to protein family HMM TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86903"
FT                   /db_xref="GOA:A0A0H3DKI5"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKI5"
FT                   /protein_id="ADK86903.1"
FT                   /translation="MQYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYLGLKEL
FT                   AYPIKKQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASINPKK
FT                   QQLALQKRAKYDEIIARENNPENPDVPVTSGLASTQPRLSRTEKAQKPKEELWDVVQKM
FT                   GNFDSVQANPYRPRFKRFNAEHVNQRQNQQNNNNNRFDRNRNRQHNRFKDKQ"
FT   gene            278746..279246
FT                   /locus_tag="MPNE_0261"
FT   CDS_pept        278746..279246
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0261"
FT                   /product="single-strand binding family protein"
FT                   /note="identified by match to protein family HMM PF00436;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86698"
FT                   /db_xref="GOA:A0A0H3DKC3"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKC3"
FT                   /protein_id="ADK86698.1"
FT                   /translation="MNRVFLFGKLSFDPNKLQTRTNNIGASFSLACIDSSGFNDSKSYI
FT                   RITAWGKVASFVLTLKPGDSVFVEGRLSTYKMNNRSDDPNSKATYALQVIADKVYRPDE
FT                   ENSLEQPVDKATVIDSPFLAAKTNATENELAQAFPISLDDEDDDINPILNNDSQLEEES
FT                   DDE"
FT   gene            279239..279550
FT                   /gene="rpsR"
FT                   /locus_tag="MPNE_0262"
FT   CDS_pept        279239..279550
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsR"
FT                   /locus_tag="MPNE_0262"
FT                   /product="ribosomal protein S18"
FT                   /note="identified by match to protein family HMM PF01084;
FT                   match to protein family HMM TIGR00165"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87142"
FT                   /db_xref="GOA:A0A0H3DN43"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN43"
FT                   /protein_id="ADK87142.1"
FT                   /translation="MNNEHDNFQKEVETTTETTFNREEGKRMVRPLFKRSKKYCRFCAI
FT                   GQLRIDLIDDLEALKRFLSPYAKINPRRITGNCQMHQRHVAKALKRARYLALVPFVKD"
FT   gene            279553..280002
FT                   /gene="rplI"
FT                   /locus_tag="MPNE_0263"
FT   CDS_pept        279553..280002
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplI"
FT                   /locus_tag="MPNE_0263"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by match to protein family HMM PF01281;
FT                   match to protein family HMM PF03948; match to protein
FT                   family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87081"
FT                   /db_xref="GOA:A0A0H3DLF2"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLF2"
FT                   /protein_id="ADK87081.1"
FT                   /translation="MKVILKQDVSNLGKRFDVVDVKDGYAIHFLFPKKLAAPLTKKSLQ
FT                   DRDLFLKKQQEHYEINKALSHKLKEVIEQTELHFSLKEHNGRPYGSIITKQIINQAHTK
FT                   GMALQKFMFKDNVRLGFGDHEITLHIFEDTTAVLKVKVTPDNGVK"
FT   gene            279989..281410
FT                   /gene="dnaB"
FT                   /locus_tag="MPNE_0264"
FT   CDS_pept        279989..281410
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dnaB"
FT                   /locus_tag="MPNE_0264"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00772;
FT                   match to protein family HMM PF03796; match to protein
FT                   family HMM TIGR00665"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87122"
FT                   /db_xref="GOA:A0A0H3DN26"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN26"
FT                   /protein_id="ADK87122.1"
FT                   /translation="MVSNKLEQTFKFANDKNIERAERVLMQALVQDAVGVDLILTKLEP
FT                   KDFFGFPFNFIFQTAQENYSEGNKLFGSALLEAVKFKLDTDSKTQREIEGLFEDVLLKG
FT                   LPFLERDIKVFVDVVKKASIFRQLKQFAKKVEKEEFKVKDDRFEGYLQAIQNDFTKIIH
FT                   SAFVSIPGLSYDEIGREEEELIRKVYRGELTVKGLKSGFYPLDQLTSGWKEGELIVVAA
FT                   RPGRGKTALLINFLQGAVNDSEKFDKNKDVLLFFSLEMRNREIYQRHLMLESQVNYTLT
FT                   SRQRLANVYDDLIKASEVLRDLPIKIFDYSTITLDEIRAQITEVSKTNNVKLVVIDYLQ
FT                   LVNAFKNSYNISRQQEVTMISKSLKSFAKEFNVPIIAAAQLSRRIEERKDSRPILSDLR
FT                   ESGSIEQDADMVLFIHRVKDEDSENQEAIGHNNIFQVELILEKNRSGPTGKVQFDFQSD
FT                   VSTFRVREYNPDGYS"
FT   gene            281414..282778
FT                   /locus_tag="MPNE_0265"
FT   CDS_pept        281414..282778
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKW6"
FT                   /protein_id="ADK87039.1"
FT                   /translation="MKYKTVKSIPLFLLGSIVFTACSTPQSTFHLPVQTTVSAIKKDIS
FT                   GKTATAVKAASSSSSTTTSNDDNNQKGYFLETNRSTGTYDPNNSTRLIKLGESGDFHAA
FT                   DQNKPEEALFERLYGGIASLLNFRIIKPALTYWNTVTPSLKAIGKSSNLITFSQDIDET
FT                   ELQRALANNLIVADDGNNNFWFGLKSLSFNAAKLTDSAQTQMAQKTTQAVTLKSQAQMS
FT                   STNTKNTNKKIDLRDKITLSSTMNTQGSGDNKNPSSGLIQKLVSVENIEAEFSFVKTGF
FT                   NGNEIKFGDFVTENSPTTTQLKQVWKKKWGTELKKTNYKLQLNNFSLLLTYTPEVNKVE
FT                   KGNNGDSNKGTIATPNGFSFLYPANLNETPSSSSSYWTNVTDLTKAATDTENTNLLNDL
FT                   QKSQEQVNQFVAAITQNHLDVSEAALTKKQFGSLSISDFFKAIFKENGKDTKAKS"
FT   gene            282858..284759
FT                   /locus_tag="MPNE_0266"
FT   CDS_pept        282858..284759
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0266"
FT                   /product="MG032/MG096/MG288 family 2"
FT                   /note="identified by match to protein family HMM PF03072;
FT                   match to protein family HMM PF03086"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86982"
FT                   /db_xref="GOA:A0A0H3DP46"
FT                   /db_xref="InterPro:IPR004306"
FT                   /db_xref="InterPro:IPR004319"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP46"
FT                   /protein_id="ADK86982.1"
FT                   /translation="MKFPKKRWQKWAFLTGSFTVLPTLIAFFSILPHSSVLEPSHLRFN
FT                   STSQRYQSDNSHLLNLHGEAFSDADLNAVAEHTDWDANFALFQQKFKTKPITVNQLGLV
FT                   DVFNLLSGWKQSLTGVLETIPQLQKEIKAANDIFPVNEQSQIPRVEARLFDFLGSGFFP
FT                   VLNPKGLGLADNVASLFEQFQLASINLSGFEVKLIKTHDIVIKSKVRYSFEVQMQFHAV
FT                   YQNNDTKANLDFALNISTINFATLQELQNSFDLQGSDLTAGLFYKYSVNKLTSGTNDLT
FT                   TIAKTALGENIIQKQVSLTQSIIKPRLEAAKTQYKQDIIAPFAKERQAALAQHLKEIEE
FT                   AKQRAEQLLKEQQEAEKRRQEEVKNVAETQQFNDSLTSAQKFKEYWLKQGKDVTKKVEL
FT                   IQALKSSFFRNQNRTFNFLIAGFRTAIDWYYNQEKNNTTAKNNAFGKNGIQFPVAGFQG
FT                   IYMSQWLRDELSGKTDIKLNLKSLSVQNENKNSSINWNKQKRIEIKQVKPFNYSFEINL
FT                   KYTGSYNVSLWYLIGAAIGGIPTSWSGTMDMKFIVDGDLDSGIVTKQDYPGSKFEFTED
FT                   KLWFTLHVKQQIKVKEQGFMNLLKGQSLDNLDLRTGTTKPPVVDLASYLHFVILTAK"
FT   gene            284784..285506
FT                   /gene="ung"
FT                   /locus_tag="MPNE_0267"
FT   CDS_pept        284784..285506
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ung"
FT                   /locus_tag="MPNE_0267"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by match to protein family HMM PF03167;
FT                   match to protein family HMM TIGR00628"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86818"
FT                   /db_xref="GOA:A0A0H3DKA8"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKA8"
FT                   /protein_id="ADK86818.1"
FT                   /translation="MEQLLDQFLSGVLSEWKAFILQEAKQTYFQELLAKLKNVEQELTP
FT                   KASQVFRPFSFFAPNNTKLIIYGQDPYPNPQHACGLSFASNAPKLPQSLKRMILRLQQE
FT                   YPELAGQNHWTKQLLEGWAQQGILLLNGVFTTNAFQTNAHRNWGWEQFNCHLLDFLLSQ
FT                   KLYVLLVFLGKQTENFVLKKIGGASQFASLSYPHPSPLTGRKFFDHPDALFKQINQWLK
FT                   HHNHTPIDWTNGQVQYQF"
FT   gene            285704..287143
FT                   /gene="gatC"
FT                   /locus_tag="MPNE_0268"
FT   CDS_pept        285704..287143
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gatC"
FT                   /locus_tag="MPNE_0268"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF02686;
FT                   match to protein family HMM TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86733"
FT                   /db_xref="GOA:A0A0H3DK29"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK29"
FT                   /protein_id="ADK86733.1"
FT                   /translation="MDKLINKPQPLTSDISTSGFIYFAVVFVAIMGYLLFKNLLFLFFF
FT                   KRYPKNTTKIGVGNITTIAIIIAVAVSIVLVLMALAGGLAAALFRGYPGFRVTLELILV
FT                   KISGLLFGPIVGIFSAATIDFLTVIFSGGVFNVGYVLGAILTGMIAGILREVLISTALL
FT                   HNRNLSDFAYLVLSIGMVIAAFLITQFFVLGISNNLKEIKGDEEFRLKFNAPPIVFELS
FT                   LTQYANILLYFTIAIVIAMLVLYIVWLVKQRHLSFEHSRFFYRSYKHANHQFTLFVLTK
FT                   ENWFYLILNVITLASTSLLMINIAFIPIFDTQTTGQTYEFWLLARLLFAPVIFLLDIIV
FT                   IYPILLLLTPLMLKGFKTAVSKNQRKTLKQSFTDLQSVVLPIINKRKHQQLRQEELKRL
FT                   ARATHFDLTEGEMEKLLVEFKTITQSFDRVMNIDTTSVEPMYAPFNTSPTPLRKDKVIV
FT                   EKHPEKLLANCKEMSVGFVKV"
FT   gene            287146..288582
FT                   /gene="gatA"
FT                   /locus_tag="MPNE_0269"
FT   CDS_pept        287146..288582
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gatA"
FT                   /locus_tag="MPNE_0269"
FT                   /product="glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, A subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86773"
FT                   /db_xref="GOA:A0A0H3DK64"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK64"
FT                   /protein_id="ADK86773.1"
FT                   /translation="MKSQILKLQQTLTKKPASINPLLQQIDGAINEHWSSNFLLKNTVE
FT                   WAQAQAPKNRSKSPLNNIPFVLKDNIATKGIVTTGGSRFLEDYIPPFSATVFELLNNSG
FT                   ALLVGKANLDEFGLGGTGLHSGFGFVHHPWNETLIPGGSSSGSAYAVARGIVPFSIGTD
FT                   TGDSVRRPASICNIVGFKPTYGLISRNGVYPYAPSLDHVGIFARYVYDVALVSDEIIKH
FT                   DKADFSAQKSPDAGKFTRSLKESFNKQIKIGYLKPLEEWFDIELSKKWNSLKERITLEG
FT                   CELIPFHFPLELLEVIDPVYKLISYSEAVSCYSNLTGIVFGQKLFEPNQASDFSKTITA
FT                   NRDRFFGEQLKRRFIIGAFGTDKNNFTKYFEKAQKIRRVMVDAYLNLFKEADFIVSPSA
FT                   SGFTKTIAAVQKGESFTNLVDDFLQLANFAGNPSITIPWLVKQKDQTIGLSVNANCFHD
FT                   KQLLQVAAWLEELFQIEHDD"
FT   gene            288575..290008
FT                   /gene="gatB"
FT                   /locus_tag="MPNE_0270"
FT   CDS_pept        288575..290008
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gatB"
FT                   /locus_tag="MPNE_0270"
FT                   /product="GatB/GatE catalytic domain protein"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01162;
FT                   match to protein family HMM PF02637; match to protein
FT                   family HMM PF02934; match to protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86854"
FT                   /db_xref="GOA:A0A0H3DKU2"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKU2"
FT                   /protein_id="ADK86854.1"
FT                   /translation="MINFEAIIGIEVHVVLNTATKMFSPAPNQAQNATPNQFINAIDLG
FT                   LPGTMPQVNEQAVQKALILADALNMQRVQPVLVFDRKHYFYQDLPKGFQITQQNFPIAQ
FT                   NGYVEIVENNKAQRIIIERFHLEEDTAKQHFVDGQILLDFNRCGAPLIEVVTAPVIKSA
FT                   KQSKAYLQKLRQILIVNNISNAKLEDGSMRSDCNVSVRLKGQTAFGTKVEIKNINSLNN
FT                   VEKAIDLEIARQVKALIKGEPVQQVTLTYDDKTNTNVFMRKKDNSVDYRYFIEPNIMSS
FT                   NIDELLQKPNKAFNLTEFFTKLKEAGVNEQLNQLVVDDLTLFNAYTKINSVINSPQDTI
FT                   RWLCIELMGQLNKLQKPLKDKTIDHLIILIQMVQKGTVNQKQAKQLIELMLDNGQDPQS
FT                   LAKLHNLEQITDEKQLTQIIQQIFKENEGEILKNLDRVERIQKLIIGQVMQRTHNRANP
FT                   QQVFIIVEKLLHDFSERAS"
FT   gene            289983..290651
FT                   /locus_tag="MPNE_0271"
FT   CDS_pept        289983..290651
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86904"
FT                   /db_xref="GOA:A0A0H3DKZ3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKZ3"
FT                   /protein_id="ADK86904.1"
FT                   /translation="MISAKEQAKKGQIIYRYILLKIQSFKWPAGTRIFSERQLEIRFAS
FT                   SRSLIRTILNTLLGKDLIRHTKGNAGYFVAKNAGFSFFHKTQDNKLPKWAKLSTLMKNH
FT                   LREVDRDVFSSIDSGVDFGNFKGLEAKLFDENKKNFLNLSFFGKDDVLQIFSEQNLQEQ
FT                   FFKDFAYNGIVVERKSSLICVDDETKNLLIYDLFYDDNNKFIVAMRSEYLNPRIKIINA
FT                   "
FT   gene            290644..291591
FT                   /gene="trxB"
FT                   /locus_tag="MPNE_0272"
FT   CDS_pept        290644..291591
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trxB"
FT                   /locus_tag="MPNE_0272"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR01292"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86972"
FT                   /db_xref="GOA:A0A0H3DP36"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP36"
FT                   /protein_id="ADK86972.1"
FT                   /translation="MLKVKSDFLTKDQVIYDVAIVGAGPAGIAAGIYGKRANLNLAIIE
FT                   GSTPGGKVVKTNIVENYPGYKSITGPDLGLEMYNHLIDLEPTFFYANLIKLDKAADTFI
FT                   LYLDDKTVVFAKTVIYATGMLERKLGVAKEDHFYGKGISYCAICDGSLYKDQVVGVVGG
FT                   GNSAIQEALYLAGMAKTVHLIHRREGFRADETALNKLRNLPNVVFHLNYTVKELLGNNT
FT                   LNGIVLQNTLDHSTKQIDLNCVFPYIGFESITKPVEHLNLKLDPQGFLITNEQMETSLK
FT                   GLFAAGDCRSKHFRQIGTAINDGIIAVLTIRDVL"
FT   gene            291581..292423
FT                   /locus_tag="MPNE_0273"
FT   CDS_pept        291581..292423
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02650;
FT                   match to protein family HMM TIGR00647"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87084"
FT                   /db_xref="GOA:A0A0H3DPF4"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPF4"
FT                   /protein_id="ADK87084.1"
FT                   /translation="MSFSVQIKHELATNPLIKTEWSSFLAGYFQNGLKLLATGQWSFKT
FT                   STATLKALFSNALQFSFQIHETSTHCEFSFRASQTEVDQLLAFDATQSDLPLQKAYVIG
FT                   AFLSGGSVSDLLHSSNFHLQISTNNELQIKQLMKLFHPFKQTTKRHQLLVYVKSYQAIC
FT                   DFFKLVEAFDGYLAFEENQLQKNFALEQVRKSNLEIANLMRTLKTSTSTAEQLKILINS
FT                   ADFKKQSLNFQRFCLVKLDHPDWSLEQIAQFFERKYKVQITRSGIQHLNAKLKKLNQN"
FT   gene            292529..292687
FT                   /pseudo
FT                   /locus_tag="MPNE_0274"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            292698..294878
FT                   /gene="rnr"
FT                   /locus_tag="MPNE_0275"
FT   CDS_pept        292698..294878
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rnr"
FT                   /locus_tag="MPNE_0275"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF00773; match to protein
FT                   family HMM PF08206; match to protein family HMM TIGR00358;
FT                   match to protein family HMM TIGR02063"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87230"
FT                   /db_xref="GOA:A0A0H3DLH9"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLH9"
FT                   /protein_id="ADK87230.1"
FT                   /translation="MKVLTDLQKRIFAIVKKENGKPIPPGIVVRMMENQAGFPGKQQVY
FT                   RAIDDLLEWHIFRKSGGATNQLLINYELADPVLDQKFQGILNLGNKNTGFVRPLDDDKT
FT                   VYYIHFSNLAGALDGDLVEFCPLDKPQVGDKFDAAVLKIVKRSRVLYAGNFLIEYSDFG
FT                   QEFRIVADNPRFYLTPIVNKASVPAELESNTKVAFQIDEYDPANNLCKVSIQQILGNND
FT                   EPLINLKAIMLDHSIVFEKNDVVEQQAAKLQFDEKEQSKPYRKDLTELAFVTIDPATSK
FT                   DLDDAIYVKRTDKGFVLYVAIADVAYYVQRNSELDIEARHKTSSIYLPGYYVVPMLPER
FT                   LSNELCSLNPNEKRYVVVCELNFDHEARLNFSEVYPATIVSQRRFAYSEVNDWLEDSDA
FT                   LKDESATVLESLKAGFTLSELIAEQRKKKGTIDLSHSETEVVVDQNYYPIEIRFLTHGK
FT                   AETMIENLMVVANEAVAWTLTNHKVHLPYRVHPRPSKKKLQMLLENIVELKITQPNFVL
FT                   DTVTSTQIAAWLKENKDNPSYDIFVILLLRTLGKAFYIVNPLIHFSIGSHHYTHFTSPI
FT                   RRYADLTVHRLLWMNLFTPERFTDTEREQLNAELEQICETINDTEIKINGCERTANDYL
FT                   TTLYLSKQVGQTFHGFISAITSFGIFMRMDENNFDGLIKITSIPEDFFVFEKDRMVLRG
FT                   KRTNKVFRIGDRLTAKLTEIDTVQKRAILTLV"
FT   gene            294878..295486
FT                   /locus_tag="MPNE_0277"
FT   CDS_pept        294878..295486
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0277"
FT                   /product="conserved hypothetical protein TIGR00159"
FT                   /note="identified by match to protein family HMM PF02457;
FT                   match to protein family HMM TIGR00159"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87204"
FT                   /db_xref="GOA:A0A0H3DPU4"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034693"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPU4"
FT                   /protein_id="ADK87204.1"
FT                   /translation="MMTVEVFSVIILVLLFLILALTLLFVLLNKRTRSFVIRTFTGLFR
FT                   SKHTTSQKNFYDNLTSTLLRLSTDKIGAIIAIENQDSLESYVNIGYRVTSDFSPELLVT
FT                   IFYNKQSPLHDGAVIVRDYQIVSVSSYFPMTRQLIDVSYGSRHRSALGLTEKCDAIVFI
FT                   VSETTGKISVAVRGVIKTLSSNSDRLQDQIIHYLTVKPG"
FT   gene            complement(295455..296036)
FT                   /gene="def"
FT                   /locus_tag="MPNE_0276"
FT   CDS_pept        complement(295455..296036)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="def"
FT                   /locus_tag="MPNE_0276"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87216"
FT                   /db_xref="GOA:A0A0H3DLP5"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLP5"
FT                   /protein_id="ADK87216.1"
FT                   /translation="MELLPTKAWLVLDDVKEINEPTKPVQFPLDQASLDCIAKMMAYVD
FT                   ASYNGDAEKYGIIPGIGIAANQIGYWKQMFYIHLMDGGVEHKCLLINPKIINLSANKSF
FT                   LKSGEGCLSVPKMHQGYVIRHEWITITGFDWLQQKEITITATGLFGMCLQHEFDHLQGR
FT                   FYYHRINPLNPLFTNKEWKVINPALPSDSE"
FT   gene            296077..296646
FT                   /gene="gmk"
FT                   /locus_tag="MPNE_0278"
FT   CDS_pept        296077..296646
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gmk"
FT                   /locus_tag="MPNE_0278"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="identified by match to protein family HMM PF00625;
FT                   match to protein family HMM TIGR03263"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86843"
FT                   /db_xref="GOA:A0A0H3DKD4"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKD4"
FT                   /protein_id="ADK86843.1"
FT                   /translation="MVDTGRIFVITGPSGVGKSSLVRCLIDHFKDKLRYSISATTRKMR
FT                   NSETEGVDYFFKDKAEFEKLIAADAFVEWAMYNDNYYGTLKSQAEQIIHNGGNLVLEIE
FT                   YQGALQVKQKYPNDVVLIFIKPPSMEELLVRLKKRNDEDAITIQNRLKQAEKECQQIGH
FT                   FKYVVTNNEFDKTLAELQAILLAEFN"
FT   gene            296646..297425
FT                   /locus_tag="MPNE_0279"
FT   CDS_pept        296646..297425
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0279"
FT                   /product="protein phosphatase 2C"
FT                   /EC_number="3.1.3.16"
FT                   /note="identified by match to protein family HMM PF00481"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86697"
FT                   /db_xref="GOA:A0A0H3DJW0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DJW0"
FT                   /protein_id="ADK86697.1"
FT                   /translation="MDSTNQNLFASLSKKGPVRKENQDFSVVTFNRFGQLMSLVCDGLG
FT                   GYKGGKMASALVSEVFTKSFTVFDFHSQTERAVKQWFEITLIEARRTLEQYFQTIKRNQ
FT                   VQFARMATTLVLSIISKQNIWTFWVGDSRAYLINSYQSLQITEDHNLYNQLLQMHATPD
FT                   VIASYKDKLLALTATVSKDQERQLKYSFRCDVVNAWDFLLLCSDGLYNFLDPNCFYEVI
FT                   TSAPNLKKAVTQLAKLSLDNASNDNITLNLINLKQWH"
FT   gene            297416..298585
FT                   /locus_tag="MPNE_0280"
FT   CDS_pept        297416..298585
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0280"
FT                   /product="kinase domain protein"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86897"
FT                   /db_xref="GOA:A0A0H3DNW1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNW1"
FT                   /protein_id="ADK86897.1"
FT                   /translation="MALNLKIGDIVQNKYRIEKLINRGGMNSYLFLASNLHVQEFGPLQ
FT                   KRQFTRLVLKVVQRTDKINDNNWKKFLDETITTTRVSHKNLVQTFDVVSPRLSVLSENQ
FT                   VIVLEDTVMIVMEYVDGPSLREMLNQKGYFSVQEVVYYFTKLVKVINYLHSFEHQIIHR
FT                   DLKPENILFTSNLTDIKLLDFGIASAVIRNAEKTEVLTDENSLFGTVSYMTPEVLESTV
FT                   NKEGKRIRKPPTVQYDIYSLGVILFEMLVGRVPFNKSIDPKKERETIQKARNFDVPLMG
FT                   NLRSDVPVSLENIVFKCTAVKRENSKWMYSDTKQLLADLAQWQTEQTLIKPVHERILEG
FT                   QNEMRELMVSNYLPWYLRKGVLIFFSVVLLALLIAVVSFFIITGVVVHS"
FT   gene            298572..299408
FT                   /gene="rsgA"
FT                   /locus_tag="MPNE_0281"
FT   CDS_pept        298572..299408
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rsgA"
FT                   /locus_tag="MPNE_0281"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="identified by match to protein family HMM PF03193;
FT                   match to protein family HMM TIGR00157"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87191"
FT                   /db_xref="GOA:A0A0H3DLM6"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLM6"
FT                   /protein_id="ADK87191.1"
FT                   /translation="MSIRKTGIVFQRFGKQFKVFVENQTLVAFAQKKLQWKRDFKLLVG
FT                   DKVTLENGVIVAVEERKNTLVRPKVVNVDQVVIVQSLIEPKINWQQLFKLLIHFHAQNV
FT                   ARLVLVITKNDLEFEPAEKARLSELTSFGYQLFFTAPNADLPLTLFTELQNRFSVFMGQ
FT                   SGVGKSSLINRLDSQIHQAIQALSAHQFGKNTTTSTVMFPFQNGFICDTPGFNVIDFPN
FT                   LKQLAAQHFVGFASLIGQCHFSNCTHQSEKGCFIVSAVTQKSYSLWLYESYLKLIN"
FT   gene            299430..300722
FT                   /gene="pgi"
FT                   /locus_tag="MPNE_0282"
FT   CDS_pept        299430..300722
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pgi"
FT                   /locus_tag="MPNE_0282"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="identified by match to protein family HMM PF00342"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86829"
FT                   /db_xref="GOA:A0A0H3DKR3"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKR3"
FT                   /protein_id="ADK86829.1"
FT                   /translation="MESKWLTVDTKHLYGFDEAIFIQKYQKKVNQIHQQFLNQQLPDGH
FT                   MNGWYSQPDQDHKGLLKQINTIAKQFNALKVTDIVYLGIGGSYTGIRAILDFLKPEQKA
FT                   NIKVHFVPDISAFNIAAVAKAIKGKSWALVVTSKSGRTLEPAVTFRYFRNLLHKQYKQK
FT                   HALRTVVITDAVKGLLVGMSNQYGYAHLTIPSNIGGRFSTLSPAGLLLAKLCGHDPKQL
FT                   LLGTLTAKQELANSDLNTNSAYYYAALRHWLYTTKKLKIEVTVAYHSAYEYLLLQHRQL
FT                   FGESEGKGGKSLFPTFSLFTTDLHSMGQLYQEGEKNFFETVIQVQTQFHDLELPPSDFN
FT                   NDDQLDYLLAKSMNEISNTALEAVVEAHFQSNVNIIKLTLKERTTFMFGYFYFWLSMAT
FT                   MMSGSLLGHNVFDQPGVEVYKQLMFAKLGRE"
FT   gene            300715..301347
FT                   /locus_tag="MPNE_0283"
FT   CDS_pept        300715..301347
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0283"
FT                   /product="putative ribulose-phosphate 3-epimerase"
FT                   /note="identified by match to protein family HMM PF00834"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86941"
FT                   /db_xref="GOA:A0A0H3DMI3"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMI3"
FT                   /protein_id="ADK86941.1"
FT                   /translation="MNREIAFSLLPLLHQFDRKLLEQFFADGLRLIHYDVMDHFVDNTV
FT                   FQGEHLDELQQIGFQVNVHLMVQALEQILPVYLHHQAVKRISFHVEPFDIPTIKHFIAQ
FT                   IKQAGKQVGLAFKFTTPLVNYERLVQQLDFVTLMSVPPGKGGQAFNSAVFNNLKQAHKY
FT                   HCSIEIDGGIKLDNIHQIQDDVNFIVMGSGFIKLERWQRQQLLKTNQ"
FT   gene            301354..302721
FT                   /gene="asnS"
FT                   /locus_tag="MPNE_0284"
FT   CDS_pept        301354..302721
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="asnS"
FT                   /locus_tag="MPNE_0284"
FT                   /product="asparagine--tRNA ligase"
FT                   /EC_number="6.1.1.22"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00457"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86778"
FT                   /db_xref="GOA:A0A0H3DK69"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK69"
FT                   /protein_id="ADK86778.1"
FT                   /translation="MSATAISDLFEKPAQFKNKKIKLTGWLKNKRTSANIIFLEVNDGS
FT                   TLLNLQAVVKQDQPELFALAESISLASAVSVSGTVALTPKSKQPLELVVKQINVLSTAR
FT                   ADYPLQKKEHSLEFFRNNAYLRVRARTYFAIMKVRSLLSQAIFDYFFKNDFVLVHSPIL
FT                   TSNDCEGAGETFELKQGKEFFNKTTYLTVSGQFGAECYAQAFKKVFTFGPTFRAEKSHT
FT                   SRHLSEFWMIEPEVAFANLKDLIKLIESTVKTVIKQVMQKAKQELDFLEKQFDVKLMER
FT                   LKQITSTKNFHVLEYIKALEILKTAQASGQANFEVQDFNFGLDLKTEHERFLCEQHFHN
FT                   QPVFVINYPKDLKAFYMKQNADGRTVGAVDLLFPQIGEICGGSEREGNLEKLVERCQAM
FT                   QIDTQTLNWYLDMRKWGYFASAGFGLGFDRLLAYICGLENIRDAIPFPRAHGSINY"
FT   gene            302702..303361
FT                   /gene="pgsA"
FT                   /locus_tag="MPNE_0285"
FT   CDS_pept        302702..303361
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pgsA"
FT                   /locus_tag="MPNE_0285"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /note="identified by match to protein family HMM PF01066;
FT                   match to protein family HMM TIGR00560"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86839"
FT                   /db_xref="GOA:A0A0H3DKS3"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKS3"
FT                   /protein_id="ADK86839.1"
FT                   /translation="MVPLTIKTWQKKLPNWLTIYRIFIAVPTIIFLGLNHLLGSVASFT
FT                   VLGNVTIHLQVSLFIGGVLFITAVISDYLDGYWARKWRVVSNFGKLWDPLADKVIINGV
FT                   LIVLVAYGYFHFSFLIVIVLRDLVLDGLRFYAQEKQLIIPANQWGKWKTTWQMIAILMS
FT                   CFVFSFSLKETNSANTKIFYWAIVHLPYYLATAFSLVSFGIYAQQIYKTIKVKVKL"
FT   gene            303383..303856
FT                   /locus_tag="MPNE_0286"
FT   CDS_pept        303383..303856
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0286"
FT                   /product="competence/damage-inducible protein CinA
FT                   C-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF02464;
FT                   match to protein family HMM TIGR00199"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86948"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKL5"
FT                   /protein_id="ADK86948.1"
FT                   /translation="MYARLIAEKLLNHKLTIATAESVTGGLLSSSLTDIAGASRFFKGA
FT                   IVAYSNELKKSLLNVKQSTLINHGAVSRYCVREMALGLMQKFNVDIAVACSGLAGPDAL
FT                   ENQAVGSLFFCVIVANKAYDFETKLPAGSRNELRQLFVQKILQTVEHILSEIS"
FT   gene            303882..304637
FT                   /locus_tag="MPNE_0287"
FT   CDS_pept        303882..304637
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86881"
FT                   /db_xref="GOA:A0A0H3DMB3"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMB3"
FT                   /protein_id="ADK86881.1"
FT                   /translation="MQRTLNVGVILCESFISNAQNPVNSYIKIYENVRMFEFAIKLLQE
FT                   SRINFQKILLYVLEEQIPLVEKVVAKYENCWVFRSKHNEVEDIYEAKGFIEDKYKIGLK
FT                   SSKNQASSYYDNCCFVVLEACRPLTSKKVVKNVYEKAMIDGAAVAVLPFERQLVCGDNT
FT                   KAVRQLKDKGNMNYWRQSSTWELQFPQAYTLNKLNQYHKNLFMKARNMLDLMNISAKNP
FT                   LSIVDGSAYSFRVVTSLDFEILLGILRNG"
FT   gene            304630..305301
FT                   /locus_tag="MPNE_0288"
FT   CDS_pept        304630..305301
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87048"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPB0"
FT                   /protein_id="ADK87048.1"
FT                   /translation="MDRKIVQLIHNFSGTEKLKAAVFSHDEQCFFDFVSFDELNSKLTG
FT                   FLLFDSLEKLFKLVETIQQKRSWLYVDELWLINTATDNQQLNEVSVWLVKKELAQVGVL
FT                   TQLDTSLVKLLMASKNTDSALYNTYIKPVELQQFTQTPAPDNVNAEQSHLTLESTTDLN
FT                   NSQLANTPALWEVEQTTQELLPTMDFSKFIDELDQITKNFSDLELEPLSFNEGFDEWNQ
FT                   E"
FT   gene            305282..306298
FT                   /gene="galE"
FT                   /locus_tag="MPNE_0289"
FT   CDS_pept        305282..306298
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="galE"
FT                   /locus_tag="MPNE_0289"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF04321; match to protein family HMM PF07993;
FT                   match to protein family HMM TIGR01179"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87102"
FT                   /db_xref="GOA:A0A0H3DMX7"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMX7"
FT                   /protein_id="ADK87102.1"
FT                   /translation="MSETKSKVLVLGGLGYIGSCFIDQLLKQYPDVTVSVIDINHTSLA
FT                   LQLLPRQVNVHFVNLLDRAQLTDTIAQINPDVVFHFAAKTSVKESTEQPLTYFDHNLVG
FT                   TLNLLHALKELQKPIQLFFSSTAAVFGSASTLPIPENLVLEETLASNPYGISKFLSEIV
FT                   LQTLTRSPHFQVIALRYFNVAGASNPFGNFNKNTTLLIPNLIKAFMEKRTFFLYGDDYD
FT                   TKDGSCIRDYIHVVDLCDAHLLAWKWLQANPKVRFESFNLGSGQGFSNWEVINTAQAIF
FT                   APEQLQLKIESRKAGDPPVLVVDCTKAKRLLNFQPTRSLHKMLSDETIFYRDFYNRL"
FT   gene            306334..308031
FT                   /locus_tag="MPNE_0290"
FT   CDS_pept        306334..308031
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0290"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87171"
FT                   /db_xref="GOA:A0A0H3DLK8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLK8"
FT                   /protein_id="ADK87171.1"
FT                   /translation="MENICKSFDNGRVKANVDVNLTVYENTVHTLLGENGAGKSTLTSI
FT                   LFGLYQPDSGKIFIGEEEVHFKSSKDAVQHKIGMVHQHFKLVDNYTVLDNIILGNESSF
FT                   SIPFTNGKLKLPLLHRKASEAKIQAMMERYDLHVNLHQKVSRLTVGQQQRVEILKVLFR
FT                   DSDILIFDEPTAVLSDQEIKSFLNIIKNFKKMGKTIVLISHKLNEIKEVAETATILRQG
FT                   HSVGTFQIKDTSIDEMARLMMGKELKKTKNNTQFTAKGEPVLKVENLHLYLNQNWFYKL
FT                   IARWNQKRINQLQKQGKPAKTLWLKSWLEGLAAIEKTPRFIRGIVNNLGFGSQQVFDKG
FT                   ISFEIHKGEIFAIAGVEGNGQNQLIDLICGLEKAAPKKVFFNGFDISRYSIRKRINAGI
FT                   GFVLEDRHKYGLILDQTVRFNAVNNQIDRKQFSSWNFLNQMQIAVYTNQIVDKFDVRGA
FT                   VQGTAIVRLLSGGNQQKLIIGRELTKQNELLVFAQVTRGLDVGAISFIHQKILDAKKQN
FT                   NAILLVSYELDEILAIADTIGVINKGNLLEVNKRDVMTRERIGKLIMQ"
FT   gene            308048..309601
FT                   /locus_tag="MPNE_0291"
FT   CDS_pept        308048..309601
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0291"
FT                   /product="amino acid or sugar ABC transport system,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86823"
FT                   /db_xref="GOA:A0A0H3DKB4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKB4"
FT                   /protein_id="ADK86823.1"
FT                   /translation="MNALNYLKHRFLFSKDKFWYAPFKQKQRRSIYSTFSLIVLSFIVS
FT                   FFLIVAIPGIKGGTFLEIFTRLFKDRVNIENFARQIAIYTLAALAFSFCMSVGVFNIGI
FT                   SGQMMAGANFGFMMILKVFPESFRPAFGGQIITILLMILGSVTVAMVVAALKVFFKVNE
FT                   VVSAIMLNWVIVLVSAYLVGTYIKPEKTDTSQFYSIELPDAFALYNFSDVQQKYGWLTS
FT                   LVIAIAAAIFIAVLMKFTVFGHKLKSTGLSVTGSQAAGYIVKKYQFLSFVISGILSGLL
FT                   AAVVYTASFEKQLTFSDVGDFGITSVPITGFDGIAIGLIALNSPARIVIVSTIISFVTI
FT                   GAKPAGLNAATASLVLGIMMYFAAIYNLMIYIKPWRMIVKLNIGKMNEAAYDEFQNEMA
FT                   ANLETLSFQRFLDKQKRKHDKERMVWFDTKRFEEYQKKKQATLQTFHENSSQNLLQYWK
FT                   QQLLVADVKRLTFKWDFLTFKHQQKYILRWYKGKNKKQTALENEFASLNEAISQKLEEK
FT                   "
FT   gene            309601..310536
FT                   /locus_tag="MPNE_0292"
FT   CDS_pept        309601..310536
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0292"
FT                   /product="amino acid or sugar ABC transport system,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86768"
FT                   /db_xref="GOA:A0A0H3DK60"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK60"
FT                   /protein_id="ADK86768.1"
FT                   /translation="MSQSLISFSNLDNWLFVAPALLLAVLSGYLSERVGIVNIAINGGM
FT                   VFGGMFLSLMSYAFVPNANDSAPSWSLAISIPLSVIFASAVGFLFGIAAIKLKADHVIV
FT                   GTGVNLLGTGINFFVAQNARSLLNDTDLRVRYSFVRTGNSVSIEGIAIFAFAIIFVLLV
FT                   WYLMNFTKTGLRYRAVGENPNVIDTQGISVYKYQWFGVMASTMVAALAGCCFALSPQVP
FT                   SFSSGDVSGFGFIAIAIMIISMWRIIPSIVISPLFALAYVLTTGVVGNANNTYLLRTIP
FT                   FIISLLVMMVFGYLNVGPKNVGKHFDKGLR"
FT   gene            310573..312708
FT                   /gene="topA"
FT                   /locus_tag="MPNE_0293"
FT   CDS_pept        310573..312708
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="topA"
FT                   /locus_tag="MPNE_0293"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="identified by match to protein family HMM PF01131;
FT                   match to protein family HMM PF01396; match to protein
FT                   family HMM PF01751; match to protein family HMM TIGR01051"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86690"
FT                   /db_xref="GOA:A0A0H3DLN8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLN8"
FT                   /protein_id="ADK86690.1"
FT                   /translation="MSKNLVVIESPNKVKTLQKYLPNDFEIVSTIGHIREMVHKNFGFN
FT                   EADYSPVWEDWTKSKKKFSSLSFKGNLKGKKLLSKYDIIKSIKEKASKATNIYLATDPD
FT                   REGEAISWHVYDVLDEKDKSKCQRITFNEITKNAVLDALKNPREIDQSWVQSQFARQIL
FT                   DRMIGFRLSRLLNNYLSAKSAGRVQSVALRFLEEREQEIRSFVPRFWWTLDVLLNPKAE
FT                   GVREACANRSIPIVLREINPALRAGLKFEEEKSVSGIDFLDEASAKKFGEQLKGVFEVY
FT                   NIDETKHYSSSPNSAYTTASLQKDAINKLGWSSKKVTLIAQHLYEGVSINGEQTALISY
FT                   PRTDSTRLSAQFQQSCKEYILNHYGEKYLSNRIVSAKGKKGEKIIQDAHEAIHPTDMNI
FT                   TPEMVKNAIKKDEFLLYRLIWIRTVASLMADCKKSHTHIRFINDGNKFYASSKSLVFDG
FT                   YRKIYEHFENKESNDLYIDLDKIRVGDRFMAKDIKITARQTHPAARYTQASLIEALEKS
FT                   NIGRPSTYNTMASVNLDRGYASLNKHAFHVTQLGEQVNEELSNHFGKIINKEFTKNMEK
FT                   SLDEIAENKKNYQEFLRDFWSNFKEEVKLAEGSIQRVKKEKEFVGRDCPSCASPLLYRY
FT                   TKRGNEKFVGCSNFPNCKYNEFSQNKPNLTLEKLEELCPECNSQLVKRRTKFNPNKTFV
FT                   GCSNFPRCRYIKKDNAS"
FT   gene            312698..314125
FT                   /locus_tag="MPNE_0294"
FT   CDS_pept        312698..314125
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87040"
FT                   /db_xref="GOA:A0A0H3DLB5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLB5"
FT                   /protein_id="ADK87040.1"
FT                   /translation="MLASLTSRSATSFSIILALVSAILILSILIWLIITIFFAWNLHLK
FT                   NNKKRTKYHLEPEQIKHKIIQNKTKLGKMLDFYQQQINTTATELKWLDGQFQQIDETDK
FT                   KKAHQITIRLARNQLLQQLSVKLDQKQFSQRANNELQKLKLSNLESFTDQKIKWDQEGM
FT                   KSAVSRVTINEWTFNHFAGKNRVYWDYFKQVCDVDCSIKPLKDQLEITFSSWSLLKRLQ
FT                   AKNLFNKLIAQSSSVKMSEKLINNALQLVQDNLALQASESGNKLLKEFELSCTNTQLVQ
FT                   LLGFQQFYFGTNLLSLLDLSRSIAVLVRFLNEHCKWELNERLLVETALFNNLQWVNNND
FT                   FFLKSHNDLKQLHLSAEQLAIIEQQNRPFYIDAYALLIAGVKQMLMEHDAVEPKQIHFH
FT                   NAKKVMESFQLFGIDQLALIEYNNCLYGFVTTKLYEIKQLDDLALFKVLFKSFLNKHLK
FT                   QKFATISLFVNTQTLMI"
FT   gene            314191..314499
FT                   /gene="trxA"
FT                   /locus_tag="MPNE_0295"
FT   CDS_pept        314191..314499
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trxA"
FT                   /locus_tag="MPNE_0295"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86813"
FT                   /db_xref="GOA:A0A0H3DKA4"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKA4"
FT                   /protein_id="ADK86813.1"
FT                   /translation="MVTEIKSLKQLGELFASNNKVIIDFWAEWCGPCKITGPEFAKAAS
FT                   EVSTVAFAKVNVDEQTDIAAAYKITSLPTIVLFEKGQEKHRAIGFMPKAKIVQLVSQ"
FT   gene            314511..315356
FT                   /locus_tag="MPNE_0296"
FT   CDS_pept        314511..315356
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0296"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87195"
FT                   /db_xref="GOA:A0A0H3DLD1"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLD1"
FT                   /protein_id="ADK87195.1"
FT                   /translation="MIDLLGLDLDGTLLSRTRQINDPTKQALANLIQKKPSLKVMILTG
FT                   RSLFSTLKYVQELNELCKKPLVEYFCCYGGAKLYQLNNNQPQEQYKFLIDSRQVKTVFE
FT                   IVEQHKGLFLAYLDKPKAPYIILGANQFYAWLIKQFWYKQRCEYFKNDHLTDGILKINV
FT                   YFACPLRLKKVYQIIKRQFQDTLNVVSFSKHLIEITHKDGNKGYAIEAIAKKQGLSLKR
FT                   MAVIGDSLNDRSMFEKVQYSFAMSKSPDELKLLATEIGTKTNRFRFSSLVDLITEKIIN
FT                   "
FT   gene            complement(315364..316401)
FT                   /gene="trpS"
FT                   /locus_tag="MPNE_0297"
FT   CDS_pept        complement(315364..316401)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trpS"
FT                   /locus_tag="MPNE_0297"
FT                   /product="tryptophan--tRNA ligase"
FT                   /EC_number="6.1.1.2"
FT                   /note="identified by match to protein family HMM PF00579;
FT                   match to protein family HMM TIGR00233"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86998"
FT                   /db_xref="GOA:A0A0H3DKR9"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKR9"
FT                   /protein_id="ADK86998.1"
FT                   /translation="MKRALTGIQASGKQHLGNYLGVMQSLIELQEQCQLFVFVADLHSI
FT                   TVDFQPQALKQNNFDLVRTLLAVGLDPQKACLFLQSDLLEHSMMGYLMMVQSNLGELQR
FT                   MTQFKAKKAEQTRNPNGTLNIPTGLLTYPALMAGDILLYQPDIVPVGNDQKQHLELTRD
FT                   LAQRIQKKFKLKLRLPQFVQNKDTNRIMDLFDPTKKMSKSSKNQNGVIYLDDPKEVVVK
FT                   KIRQATTDSFNKIRFASKTQPGVTNMLTILKALLKEPVNQSLTNQLGNDLEAYFSTKSY
FT                   LDLKNALTEATVNLLVNIQRKREQISREQVFNCLQAGKNQAQATARTTLALFYDGFGLG
FT                   SQNIK"
FT   gene            316461..316898
FT                   /pseudo
FT                   /locus_tag="MPNE_0298"
FT                   /note="transcriptional regulator, Spx/MgsR family; this
FT                   gene contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF03960; match to protein family HMM TIGR01617"
FT   gene            316898..317677
FT                   /locus_tag="MPNE_0299"
FT   CDS_pept        316898..317677
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0299"
FT                   /product="NAD(+)/NADH kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF01513"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87163"
FT                   /db_xref="GOA:A0A0H3DN87"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN87"
FT                   /protein_id="ADK87163.1"
FT                   /translation="MKYKIFASTTPQTEPVLQKLKQVLKGCEAVEKGFDYLFVLGGDGF
FT                   FVSTVANYNCHNCRVVGINTGHLGFYTSFNEKDLDDNFLQKLQQCHFQRISLLEVSVNG
FT                   QQHLVLNELAVYTNTAYPINIFIDGEAWEFYRGSGLLIGPRTGSTALAKSAKGAVIFPG
FT                   IDVLQIIEMNPLLHPNQVTIQSPIILPKETQVEFVVKKAFNPQQFPTFYCDGRKLELPN
FT                   ADTTLALKLVQSTPMFNISLKTQDFINKLKSTFIKQS"
FT   gene            317677..318030
FT                   /locus_tag="MPNE_0300"
FT   CDS_pept        317677..318030
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86866"
FT                   /db_xref="GOA:A0A0H3DM98"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM98"
FT                   /protein_id="ADK86866.1"
FT                   /translation="MKVLLWIGYVLSFGLLYLYLVKRAKRAALQLNNKLVESHTIPFAV
FT                   RDFIAACGGRTNFVSLRTSPTQLIVSFAKPELVQIAALQKLGIKGINKSQNQYRFVLGN
FT                   FVNQLKQQIENER"
FT   gene            318020..319501
FT                   /locus_tag="MPNE_0301"
FT   CDS_pept        318020..319501
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0301"
FT                   /product="HDIG domain protein"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM TIGR00277"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87033"
FT                   /db_xref="GOA:A0A0H3DP93"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP93"
FT                   /protein_id="ADK87033.1"
FT                   /translation="MSAKLTLESIAKTFAETSIFAILFLIIVILNLGLLVFLAYQYRVY
FT                   KKKQRANLTKQTYNNDYGQIVNLKQQNAAKIKELANLKDQLSELGQKFNTTLSEIINKP
FT                   LVNVIDEYLDEQFKQAANFREAELNAVLDSNDQKTVFHKRLFNKFHFGVDKLANINVKN
FT                   PLNLCWVDSASFTVIESDFRKLNGVGGINKKLLIEKLRIEDIIFTNIDKKYYEVQILSD
FT                   SPVKVQKTVLTIRNILINDYVDNEKIESYAREANGYFNDHCKLIGKQVLERLNIFEISP
FT                   KLHKFFGLLAFRYSFGQNVLSHCLETGFLTAYLALLVNFKPDVALKCGLYHDIGKADDE
FT                   NGKKNHTVTGAKIGDEFYFENDVKYTIANHHNKNVDNVYCRLTQIGDKLSAGRLGARSD
FT                   SSVLFNQLKQELKQIVEETLAQFKTTILLGQSGRRLVIWLETNQHNNIIDNQQLTDLAT
FT                   TIKSKIVQNNITNRFPIKVVLRYNFEHSFDTKDKN"
FT   gene            319504..319791
FT                   /locus_tag="MPNE_0302"
FT   CDS_pept        319504..319791
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87035"
FT                   /db_xref="GOA:A0A0H3DLB0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLB0"
FT                   /protein_id="ADK87035.1"
FT                   /translation="MQYTVLIPLFIFIGAMVLFGFSFQKKQPQRRIVQILFLAYCVDFL
FT                   ALIIAVMMLTFLSYDDLMLGVLIPVLILSIIMFFVMIIAHYPLMKRLFGH"
FT   gene            320053..320292
FT                   /pseudo
FT                   /locus_tag="MPNE_0303"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            320286..320750
FT                   /pseudo
FT                   /locus_tag="MPNE_0304"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(321826..322215)
FT                   /pseudo
FT                   /locus_tag="MPNE_0305"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            322513..322794
FT                   /locus_tag="MPNE_0307"
FT   CDS_pept        322513..322794
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87246"
FT                   /db_xref="GOA:A0A0H3DLT3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLT3"
FT                   /protein_id="ADK87246.1"
FT                   /translation="MNRPTPNFEAIDKKISAFVTNHDNLLDKLLKQQTELLTSEITTNF
FT                   EVTQQIQEEVAKKTKQHSKNYKWLATVVLANGVVSLFLLGGLIYLFSK"
FT   gene            complement(322771..323205)
FT                   /locus_tag="MPNE_0306"
FT   CDS_pept        complement(322771..323205)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0306"
FT                   /product="histidine triad domain protein"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86746"
FT                   /db_xref="GOA:A0A0H3DLZ0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLZ0"
FT                   /protein_id="ADK86746.1"
FT                   /translation="MVQKQSMANNNCIFCGIVEGNVKSFKVGENEHAVAFLDAFPVADG
FT                   HTLVIPKKHAVNYSSTDDESLKAVSLLAKEMALKLQQRLQPAGLNYVVNEGAKAGQEVF
FT                   HYHMHVVPKYETGLGFCYNVKKTNNRSIEANWELLTKEVD"
FT   gene            complement(323174..323974)
FT                   /locus_tag="MPNE_0308"
FT   CDS_pept        complement(323174..323974)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87164"
FT                   /db_xref="GOA:A0A0H3DPQ0"
FT                   /db_xref="InterPro:IPR011631"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPQ0"
FT                   /protein_id="ADK87164.1"
FT                   /translation="MKKTIGLAYRFFYLNNNCDFYLLFLAPFSLFNLGVMVASAVISVV
FT                   YNNQPQLIWFTNFDTFTYQSNTIAAVCVLMYLCKRRCKLFDNNALFLSAAGYLVFTVIF
FT                   FNLYVLSRVTGFVNVEEHVKGWFSTITSEMPYSFSGNPLTDWISFAQLFLHVIYPASFF
FT                   GFIWIFFKTYKMREPLHELGKFLLKAGVYPSLYAFYLQTVPFLKIWDNGHDSYSVYGFF
FT                   SQTKYNSYVWFWSIPIFASMFLILWGLFVINNRYYGAKTKYGKQ"
FT   gene            323996..324298
FT                   /locus_tag="MPNE_0310"
FT   CDS_pept        323996..324298
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0310"
FT                   /product="DNA-binding protein, YbaB/EbfC family"
FT                   /note="identified by match to protein family HMM PF02575;
FT                   match to protein family HMM TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87097"
FT                   /db_xref="GOA:A0A0H3DMW6"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMW6"
FT                   /protein_id="ADK87097.1"
FT                   /translation="MSFKKITEMMRQAERQSKQKALDFEQKLFEYSYKNAAIKIIIFGN
FT                   LTIKSITIDPALIDPEDKVTLEEMITEAVNEAVGDVKAKYDQLMEEAMPQMPGLF"
FT   gene            complement(324270..325127)
FT                   /locus_tag="MPNE_0309"
FT   CDS_pept        complement(324270..325127)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0309"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87087"
FT                   /db_xref="GOA:A0A0H3DMV6"
FT                   /db_xref="InterPro:IPR035319"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMV6"
FT                   /protein_id="ADK87087.1"
FT                   /translation="MQSLNYLVVILTVAGVLVILGFTPLIRKLKIQFYCLQVFAAILFL
FT                   YVFFGRQIIYIFPDIYGTAAKAKNAVANVPLDSLRLSRIFLLDLCPFFALIGPIFIFLR
FT                   QKKVAGVLAIFGFYGAAITLFGELIFTPLKQEEIVKFLFVGLENNQVYFMMHFLSFLLS
FT                   LAVFLWDDGFSLISFFYIHVFALAYLSYVALMVNIFKGQITGNTTGILAEDWLSGEYKN
FT                   VAVFLKLDPKNADLIFGVSFGLSYFAIVLLTVLVNIPTFIQLTKDKQMVKLALQLKKAQ
FT                   ASVA"
FT   gene            325172..325492
FT                   /pseudo
FT                   /locus_tag="MPNE_0311"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            325477..326640
FT                   /pseudo
FT                   /gene="lysS"
FT                   /locus_tag="MPNE_0312"
FT                   /note="lysine--tRNA ligase; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00152; match to
FT                   protein family HMM PF00587; match to protein family HMM
FT                   TIGR00499"
FT   gene            326627..327799
FT                   /gene="glf"
FT                   /locus_tag="MPNE_0313"
FT   CDS_pept        326627..327799
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="glf"
FT                   /locus_tag="MPNE_0313"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="identified by match to protein family HMM PF03275;
FT                   match to protein family HMM TIGR00031"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87148"
FT                   /db_xref="GOA:A0A0H3DN70"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN70"
FT                   /protein_id="ADK87148.1"
FT                   /translation="MNWNKFDFIVLGAGISGIVLSHVLAQHGKSVLLLEKRNQLGGNCY
FT                   DKLDETTGLLFHQYGPHIFHTDNQKVMDFIQPFFELNNYQHRVGLQLDNNLDLTLPFDF
FT                   SQMRKLLDTKTASSLINFFQQHFPAEKHLTLMQLQTINFAPVQQLYQFLKTKVYGPYSV
FT                   KMWGMPLEQIDPSVLGRVKISLSENSSYFPTATIQGLPKGGYTKAFTKMVDHPLIDLRL
FT                   NCPANLISVNNNQLLFANQPITKPVVYCGLIDQLFGYCFGRLQYRSLHFEWKRYAVKQH
FT                   QAYPVMNWPLHPTITRQVEYKQLTQEGLESNQTIVSCETPGAFREGDPRFMEPYYPLND
FT                   VSNNALFARYLKLANAIPNIHLLGRLALYQYIDMDRAIAQSLAKAEQLLQ"
FT   gene            327799..329595
FT                   /gene="lepA"
FT                   /locus_tag="MPNE_0314"
FT   CDS_pept        327799..329595
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="lepA"
FT                   /locus_tag="MPNE_0314"
FT                   /product="GTP-binding protein LepA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF06421;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR01393"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86706"
FT                   /db_xref="GOA:A0A0H3DNB3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNB3"
FT                   /protein_id="ADK86706.1"
FT                   /translation="MEQQKIRNFSIIAHIDHGKSTLSDRLIERSIGFEKRLLQAQMLDT
FT                   MAIERERGITIKLNAVQLKMAQGNQQYLFHLVDTPGHVDFTYEVSRSLAACEGVLLLVD
FT                   ATQGIQAQTISNTYLALENNLEIIPVINKVDMESADVEKTKQAFHQLLGVDPNTIPLVS
FT                   AKTGLGIDRLITTIIEKVPPPKGDESKPLKALLFDSYYDPYKGVVCFIRIFEGSLKLND
FT                   KIRFARSNSVYQIVELGIKNPFFEKQDVLKAGEIGWFSAGIKKLRDVTVGDTIVHAEDT
FT                   TTPPLPGYKKVLPMIYCGLYPIDNNDYQNLKMAMEKIILSDAALEYEYETSQALGFGVR
FT                   CGFLGLLHMDVIKERLEREYNLKLISAPPSVRYKVLLTNGEELELDNPSLLPERSRIKS
FT                   ISEPFVRVYIDLPDHYLGTVIDLCQNFRGQYEKLEEIDIDRKRLVYLMPLGEIIYSFFD
FT                   KLKSITKGYASLNYEFDQYQVSQLAKVEIMLNKQKVDALSFIAHHDFAFQRAKKFCVKL
FT                   KELIPKHLFEIPIQATIGSKVIARETIKAVRKDVTAKLYGGDVTRKKKLLEKQKEGKKR
FT                   LKAIGSVELPQELFSHLLKDED"
FT   gene            329674..331383
FT                   /locus_tag="MPNE_0315"
FT   CDS_pept        329674..331383
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0315"
FT                   /product="putative ribonuclease J 1"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM PF07521"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86959"
FT                   /db_xref="GOA:A0A0H3DL44"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL44"
FT                   /protein_id="ADK86959.1"
FT                   /translation="MIKDFDPSEFVGKTPTKIFAFGGIQEVGKNMYGIEYDDEIIIIDC
FT                   GIKFASDDLLGIDGIIPSFEYLIENQAKVKALFITHGHEDHIGGVPYLLKQVDVPVIYA
FT                   PRIAASLILKKVNEHKDAKLNKVVVYDDFSNFETKHFKIDFYRVNHSIPDAFGVCVQTP
FT                   NGNIVESGDFRFDFAAGGEMLDVHKVVKIAERNVHVFMCETTNAEIPGFSQSEKLIYRN
FT                   INKIIKEARGRVILTTFASNITRINEIIEIAVNNKRKVCLLGKSMDVNVNISRKIGLMD
FT                   IDSNDIVEVRDIKNYPDRSILILCTGSQGEDSAALNTMARGKHNWVSLKSTDTIIMSSN
FT                   PIPGNYAAVENLLNELSKYGVTIFENSPNMKLHASGHATQQELQLMLNLVFPRYLIPIH
FT                   GEYKMMRTIKNIAQECGINGDDVGLLANGQVMYLIDGKLYYSGEVINADPIYIESRNSS
FT                   PDLARVIKQRQILSREGMFAVIVVFDKNNNILGMPTLITRGCFFALDSSPLMTKITHSI
FT                   KRGLENVIQNKRFNTREQMIKELKRVCKETVSYFIWKNKSRNPLISTVLSWV"
FT   gene            331421..331636
FT                   /locus_tag="MPNE_0316"
FT   CDS_pept        331421..331636
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0316"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86892"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNV5"
FT                   /protein_id="ADK86892.1"
FT                   /translation="MEINTFIRLFLPVVGFSFVCSWDLINAYKKPLIAQKSDSFYFLKN
FT                   IFLRFAIFFRLGRWNLSMERLFWAVF"
FT   gene            331594..332727
FT                   /locus_tag="MPNE_0317"
FT   CDS_pept        331594..332727
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03305"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87126"
FT                   /db_xref="InterPro:IPR004984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLH6"
FT                   /protein_id="ADK87126.1"
FT                   /translation="MKFKYGTVVLGSFLGLSVVLAACGARGKFDQFDDGKIKLASSLTS
FT                   KAAANALQTIIEKYNIVKSGKDYPIEITQIAGGYDGGRTDLQTRVSVKDKTNFYNLILN
FT                   YPDLVSVLARSGMELLFDKVNVDKLEPNFLKFNEQISGVAKSGNYGIPVSLSTDILVLN
FT                   GPVLHYILNSAKKEEANSQVKSQIKTSQIQAKGSLTIDTDENTKSLWEKIQNSAKANGE
FT                   TNQKGRKAAKSNKTALVQLKNGADTTTNEENKDTKTSDDKVKQTWGDYVEKDDGLKNYT
FT                   FRASVFENWHDFLDFSTRVAKSFTEKVSNITNKKGTDIQGVLGVDSSPNVLFASVFAAG
FT                   GGNYENFFYKVKDGRADFSNFKNKGSSYQNLQSVFKD"
FT   gene            332872..333582
FT                   /pseudo
FT                   /locus_tag="MPNE_0318"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            333573..333953
FT                   /pseudo
FT                   /locus_tag="MPNE_0319"
FT                   /note="putative mycoplasma lipoprotein, C-terminal domain
FT                   protein; this gene contains a frame shift which may be the
FT                   result of a sequencing error; identified by match to
FT                   protein family HMM PF03202"
FT   gene            complement(333982..334098)
FT                   /locus_tag="MPNE_0320"
FT   CDS_pept        complement(333982..334098)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0320"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN57"
FT                   /protein_id="ADK87157.1"
FT                   /translation="MFFIKTLFLRTGFIETLFDELKFSLIYLLVFPLNKLID"
FT   gene            334478..334795
FT                   /locus_tag="MPNE_0321"
FT   CDS_pept        334478..334795
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0321"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86989"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL71"
FT                   /protein_id="ADK86989.1"
FT                   /translation="MKLFCHIYFLGNLDHEYRKSIRFIKLTRYHLFLKQAQSQLVSLFN
FT                   QNFLQVLLAFLNKSFNLFSDDTKINMLNFLNKSTMVLIPVGSSAPSSSSFLNHLKKEGI
FT                   A"
FT   gene            334795..335142
FT                   /locus_tag="MPNE_0322"
FT   CDS_pept        334795..335142
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86771"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM16"
FT                   /protein_id="ADK86771.1"
FT                   /translation="MKEKISKKEYNALIRKTGEKHFDGEKEEYGDGTVGLWTYELRKYK
FT                   LKPPVKVKYVTQEEFGEFKDATNQRLTKIENALVAQGEQIRAQGEQLSQLIKVVLLQGK
FT                   QIKSQGEQIKS"
FT   gene            335652..335828
FT                   /locus_tag="MPNE_0323"
FT   CDS_pept        335652..335828
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0323"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ25"
FT                   /protein_id="ADK87269.1"
FT                   /translation="MKFDFSCYYLPDGTNETLIRIFFQEKVSSSVVTKDKNSLRLDEYL
FT                   KDFISFLKTQRKN"
FT   gene            336092..338470
FT                   /locus_tag="MPNE_0324"
FT   CDS_pept        336092..338470
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03202;
FT                   match to protein family HMM PF03305"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86934"
FT                   /db_xref="InterPro:IPR004890"
FT                   /db_xref="InterPro:IPR004984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL20"
FT                   /protein_id="ADK86934.1"
FT                   /translation="MKYGTIIFSGLLGVSAILAACGARGKFDQIDDGKIVLASSLTSKG
FT                   AANALQTIVKKYNEVKNIDDYPIEIIQIAGGYDGGRGNLQTKLSVKDKNSFYNLILNYP
FT                   DVVSVLGRVGMELPFDKVRTDKLSPRFLDFNKRISAISKQGIYGIPVSLSTEVLVLNGP
FT                   VLHYILSSAKGSSDKTQVSQTSSGLNQQKTLQKPLKIDTSDSSTSSLWTQIENAAKNNG
FT                   KKANNSKSNRRSTDQSTQTHNDQGDASESDKKIKESWGDYEEVDGGLKGFTFKASIFDN
FT                   WHDLLDFSTRAAKSFKKIKDNNTKKGTDIQGILGVDSSANSLFTSVFAAGNGDYDNFFY
FT                   KVANGRADFSNFKNRGSSFQNLQSVFNDYKGLIDQNGLFVNKGGSYSSNFQKFHQLAYS
FT                   ISSTSGFYYSFAGNSAKRLKFGDNSFIEYPQYTVPIKAPSKNGDGNSTNSNSDLLGTFT
FT                   LSSGKKSTDKSKSDSQQNQGKKVEGTPNQGKKAEGAQNQGKKENNSTTIEIYKNKIPDG
FT                   KNAGKDAILIKDNNLIKQLEDAAKKNGAESNQKQGGESNGQKEQIIGYTTTGNVREDGN
FT                   HIFRVDKINDEQYDRKIIVGVTVETLEQSSTLQSEEAIVLAAPGKYKSTDKKKVTITQG
FT                   PNIIGIHANEKENAETQKFVDWFLNTEVDWPAKENSSNKQDQQNSTKKQTAAEFFVESA
FT                   SYILPLKEIFENKEKKENTSNSDKNKSSSQRKNTYAEKALELFQQISKDEIVSYSDPSD
FT                   FRSGKFRDGIGSNFNAAVSSKADFNKFVKGFIATLGSEI"
FT   gene            338560..339849
FT                   /locus_tag="MPNE_0325"
FT   CDS_pept        338560..339849
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0325"
FT                   /product="type I restriction modification DNA specificity
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86880"
FT                   /db_xref="GOA:A0A0H3DM86"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM86"
FT                   /protein_id="ADK86880.1"
FT                   /translation="MEIKTYKIKDICDIKRGRVISKLDIKKDPGVFPVYSAATNNDGEF
FT                   GRINSYDFDGEYVTWTADGYGGAVFYRNGKFSITNLCGLLKVKNKEISSKYLAHILKLE
FT                   APKFTNRVFKNRPKLTHKTMAEIPIDFPPLKIQEKIATILDTFTELSAELSAELSAELS
FT                   AELSAELSAELSAELSAELSAELSAELSAELSAELSAELSAELSAELRERRKQYDFYRD
FT                   YLLNQENIRKIYGANIPFETFQIRDICEINRGREINEKYLRENPGEFPVYSSATTNGGL
FT                   IGKINDYDFHGEYVTWTTGGAHAGNVFYRNEKFSCSQNCGLLEVKNKNKFSSKFLCFAL
FT                   KLQSKKFVNYASAIPVLTIKRIAEIELSFPPLEIQEKIADILFAFEKLCNDLTEGIPAE
FT                   IELRKKQLDYYQNFLFNWVQNKKLESLKSL"
FT   gene            339952..341592
FT                   /pseudo
FT                   /locus_tag="MPNE_0326"
FT                   /note="adhesin P1 domain protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF03257"
FT   gene            complement(341884..342018)
FT                   /locus_tag="MPNE_0327"
FT   CDS_pept        complement(341884..342018)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0327"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKW1"
FT                   /protein_id="ADK87034.1"
FT                   /translation="MSLFLNKVSEIVRLMVKTSFIINWKNVKVFKEVGSNRSLDYLAI"
FT   gene            341999..342436
FT                   /locus_tag="MPNE_0328"
FT   CDS_pept        341999..342436
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87136"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLI0"
FT                   /protein_id="ADK87136.1"
FT                   /translation="MFKKRLNKDKINNCHVWEEELPDGSYDMGFSDNLNHMEKRKSGYV
FT                   TQKQFSEFKDANNQRLIKIETTLATQGEQLNQLIKVVILQGEQIKELQVEQKAQGEQIK
FT                   AKGEQIKAQSEQIKTQGETLKLILQALGGINKRLDKVDPPK"
FT   gene            343033..344475
FT                   /pseudo
FT                   /locus_tag="MPNE_0329"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF03305"
FT   gene            344429..345397
FT                   /pseudo
FT                   /locus_tag="MPNE_0330"
FT                   /note="putative mycoplasma lipoprotein, C-terminal domain
FT                   protein; this gene contains a frame shift which may be the
FT                   result of a sequencing error; identified by match to
FT                   protein family HMM PF03202"
FT   gene            345487..346050
FT                   /locus_tag="MPNE_0331"
FT   CDS_pept        345487..346050
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0331"
FT                   /product="type I restriction modification DNA specificity
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87247"
FT                   /db_xref="GOA:A0A0H3DNG8"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNG8"
FT                   /protein_id="ADK87247.1"
FT                   /translation="MQIKTYKIKDICDIKRGRVISKLYIKNNPGEFPVYSSATVNNGEI
FT                   GRIKDCDLKGEYVTWTTDGAQAGSVFYRNGQFNATNVCGILKVNNDEIYPKFLAYALRL
FT                   KAPKFVNYACPIPKLMQGTLAEIELDFPSKKIQEKIATILDTFTELSAELSAELSAELS
FT                   AELRERKKQYVFYSDYLLNPKNWK"
FT   gene            346189..346626
FT                   /locus_tag="MPNE_0333"
FT   CDS_pept        346189..346626
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0333"
FT                   /product="type I restriction modification DNA specificity
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87069"
FT                   /db_xref="GOA:A0A0H3DL04"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL04"
FT                   /protein_id="ADK87069.1"
FT                   /translation="MGYSKTFRVEEKSITVSARGTIGVVFYRDFAYLPAVSLICFVPKE
FT                   EFDIRFLFHALRAIKFKKQGSATGQLTVAQFKEYGIHVPSLKKQKEITAILDPLYSFFT
FT                   DLNEGLPAEIELRKKQLDYYQNFLFNWIQKQKELVEQASTN"
FT   gene            complement(346619..347209)
FT                   /gene="yeaZ"
FT                   /locus_tag="MPNE_0332"
FT   CDS_pept        complement(346619..347209)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="yeaZ"
FT                   /locus_tag="MPNE_0332"
FT                   /product="universal bacterial protein YeaZ"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR03725"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87017"
FT                   /db_xref="GOA:A0A0H3DMQ6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMQ6"
FT                   /protein_id="ADK87017.1"
FT                   /translation="MRFFNKYKLFLDCAYKHLNIVLLDFKTNTVVDQLTIPVQQNLTEL
FT                   AVYHLEKLLKKNKVRNNTVRQFYVTTGPGSFTGQRVGAIIAKTWCTVNPNCQLFALNSL
FT                   RLQIPYGCGISKISAGNEKNYCGLFTETTSEIALLAKPDFVKLCKANTELPLYENFENI
FT                   DSIEELFLNNIERFELVENPQNLELLYLKDPVN"
FT   gene            complement(347193..348122)
FT                   /locus_tag="MPNE_0334"
FT   CDS_pept        complement(347193..348122)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0334"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="5.4.99.-"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00005"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87037"
FT                   /db_xref="GOA:A0A0H3DMS8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMS8"
FT                   /protein_id="ADK87037.1"
FT                   /translation="MEQTFSVTTAQRLDTFLATLLNLSRVKVAKLIVDGLVSVNGKKIT
FT                   KNGWLVQPEDRVHVNWSEELFEKVPVEVQPYDFPLDILYEDEQIMVVNKPNGLISHPTS
FT                   FNESESLLGAALFHCNHQPVFLVHRLDRDTSGVIMLAKNQSSLLHLQKQLQQRVMKRYY
FT                   LALVHFPLDSLSGTISAPLERVGNNKVMWKVGNSSNKAKNAFTKFTVLNQNEKAALIKC
FT                   ELLTGRTHQIRVHLQFIKHPVYNDPLYGLKGEQATEYGQYLHAQQISFIHPTLNKEMGF
FT                   EAQLDKTFSDKLDNLNLKIANSLYALFQ"
FT   gene            complement(348122..348676)
FT                   /gene="lspA"
FT                   /locus_tag="MPNE_0335"
FT   CDS_pept        complement(348122..348676)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="lspA"
FT                   /locus_tag="MPNE_0335"
FT                   /product="signal peptidase II"
FT                   /EC_number="3.4.23.36"
FT                   /note="identified by match to protein family HMM PF01252;
FT                   match to protein family HMM TIGR00077"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86957"
FT                   /db_xref="GOA:A0A0H3DP20"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP20"
FT                   /protein_id="ADK86957.1"
FT                   /translation="MAKAPTFFSKLLKQILFANRKPFLYYKLALILFVGFVILFQVFML
FT                   RAALNGEKGINGANGTDVARSSFISIYVIGNKGVGFSLLADQPGLVYFLQGFLSFIALF
FT                   FLVFSTSYNYIFWITTLAFGSLGNFFDRLTSGSGEVLDYFVFSGGNSVFNLADCCITFS
FT                   FIGLFLSFLIQFFKEMKQTKS"
FT   gene            348715..349335
FT                   /locus_tag="MPNE_0336"
FT   CDS_pept        348715..349335
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0336"
FT                   /product="DJ-1/PfpI family protein"
FT                   /note="identified by match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87177"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN80"
FT                   /protein_id="ADK87177.1"
FT                   /translation="MDLLTTANKTPRIAKSRPVRIAIIITQKTNDLHATVPCFLWRKAR
FT                   YAVDLISAEAKASIMLEMGIHVRCDNTLSKTNFNQYTAAFIPHGNTTRLVEIDKLRKDL
FT                   EKFVYKPKGPMRWLFSSGNGACVLKEFDLIAPDQLVTVQNEKEMVKLLGKNFIKQPVHV
FT                   DKNIISCANSCGLTKFSFKVIEELSGIELARKTANLVDHIYKG"
FT   gene            349384..350046
FT                   /locus_tag="MPNE_0337"
FT   CDS_pept        349384..350046
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0337"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87109"
FT                   /db_xref="InterPro:IPR035215"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPJ0"
FT                   /protein_id="ADK87109.1"
FT                   /translation="MNNTKNKSDWQLFLEDYRFYHEKEFDWITYLNHCLNSYPDFDILK
FT                   FIRKYGPECEKSFLSLQSKTKADVYGVFTKQIKAGSVNEVLAQKLVQLDALRTNYLIGA
FT                   LYSTNKTQKKLFKQSWKNAKKQGYTKQEWLMTLVGLPFEKGEYHKQLYAHSRQEILDLV
FT                   EAVKKLYLRPEKDDKLEFADSSKVSESKSIKVTNAVTLPSDDLDKELFEFSGEGGDE"
FT   gene            350046..350228
FT                   /gene="rpsU"
FT                   /locus_tag="MPNE_0338"
FT   CDS_pept        350046..350228
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsU"
FT                   /locus_tag="MPNE_0338"
FT                   /product="ribosomal protein S21"
FT                   /note="identified by match to protein family HMM TIGR00030"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86757"
FT                   /db_xref="GOA:A0A0H3DNH3"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNH3"
FT                   /protein_id="ADK86757.1"
FT                   /translation="MPKIEVKNDDLELALKKFKRVSLEIRRLAQRHEYHLRKGMRLREK
FT                   RKIAQKKRRKFRNMV"
FT   gene            350253..350702
FT                   /locus_tag="MPNE_0339"
FT   CDS_pept        350253..350702
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0339"
FT                   /product="DivIVA domain protein"
FT                   /note="identified by match to protein family HMM TIGR03544"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86687"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DJU9"
FT                   /protein_id="ADK86687.1"
FT                   /translation="MANDKKDKIILSGELTNHRFNFTKDGENGYSAYEVDRFLDQLVHT
FT                   LTHYEAQRNREEEMKTAYEKLFQDRDEILKRCSKLEAELNNFYENGYSNRVLISRVQAL
FT                   ENKIESLPSGQNDRLERIEKLLKRVIKHWTDGEDLSYGDFDDDFF"
FT   gene            350705..351064
FT                   /locus_tag="MPNE_0340"
FT   CDS_pept        350705..351064
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0340"
FT                   /product="putative holo-[acyl-carrier-protein] synthase"
FT                   /note="identified by match to protein family HMM PF01648;
FT                   match to protein family HMM TIGR00556"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87072"
FT                   /db_xref="GOA:A0A0H3DMW4"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMW4"
FT                   /protein_id="ADK87072.1"
FT                   /translation="MILGIGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKD
FT                   SEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYSSN
FT                   NITAICLAQQTPWKN"
FT   gene            351142..351852
FT                   /locus_tag="MPNE_0341"
FT   CDS_pept        351142..351852
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0341"
FT                   /product="acyltransferase"
FT                   /note="identified by match to protein family HMM PF01553;
FT                   match to protein family HMM TIGR00530"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86985"
FT                   /db_xref="GOA:A0A0H3DMK0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMK0"
FT                   /protein_id="ADK86985.1"
FT                   /translation="MLISSLISAKNYESIPENYPPEIRFKKVYRLVSLFLYIKGVKVVI
FT                   VNPENVPKKAVLVVANHKSNLDPLILIKAFGKTEGVPPLTFIAKIELQDTWLFKIMKLI
FT                   DCVFIDRKNLRQMAASLEQQQQIIRQGTALCVFPEGTRVLSRQIGEFKSGALKVAYNAF
FT                   VPIVPLTIVGSMGHMESKKRLQKAQVERDRGYKIQVIFNTPINPINFNQIDSQNVANNV
FT                   WREISQTYAQYCQD"
FT   gene            351853..353373
FT                   /gene="folA_1"
FT                   /locus_tag="MPNE_0342"
FT   CDS_pept        351853..353373
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="folA_1"
FT                   /locus_tag="MPNE_0342"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="identified by match to protein family HMM PF00186;
FT                   match to protein family HMM PF02616"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87281"
FT                   /db_xref="GOA:A0A0H3DLU7"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLU7"
FT                   /protein_id="ADK87281.1"
FT                   /translation="MITLIWCQDKHFGIGRDNTIPWKLTEANQHFYNTTKNQTVVMGYS
FT                   TFQELGDKLTDHNVVVLSKKHFEELQNNTNIKVFNSIEKLLQHHFNRDLYVIGGKQIFH
FT                   HFIELADRLIISVLPVDFKCNLRLKLGLDSFELMQEQQHSQFKVQYWHKKHPERLSFNV
FT                   FLEDYNGTLPNLLELLIDKKFNLHQVDIAKITTQYLHLINTNLNKQAIEPITDYLVITS
FT                   RIVEQKANNLLQINDIALDSDFLDNKLRDKLVAQLVEYKRYRESLDDFEKLRINRLAYF
FT                   SKDNDFNRFIQTVDKSNTEPVKIEDELPNYVSVLKLHHAMNKLMQRWRAQFLANKNISI
FT                   QELSIEQVQAEILATIKQFGYHSVSLKRVLLKVNHHISLMYFITAFVALLVLINNQIID
FT                   IEQTSFDDELYICLLDSSRIKQLQETPEAMVERAVKQRQEAQELARQVAREKAIANAQK
FT                   REAYLKAKYGKDYLTREQFLKLSPEERAAHVAKMKQLKLVKNDNGRDN"
FT   gene            353357..353983
FT                   /gene="scpB"
FT                   /locus_tag="MPNE_0343"
FT   CDS_pept        353357..353983
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="scpB"
FT                   /locus_tag="MPNE_0343"
FT                   /product="segregation and condensation protein B"
FT                   /note="identified by match to protein family HMM PF04079;
FT                   match to protein family HMM TIGR00281"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86684"
FT                   /db_xref="GOA:A0A0H3DLM5"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLM5"
FT                   /protein_id="ADK86684.1"
FT                   /translation="MDATIKVTKPVLKQKDSSAANLVAAIYGLLFVSGEKGLTLAELNR
FT                   VLRKVGLEKIKAALVQLERKLSLDDESGIEIKKFGHSFRLVTKMEIKDFIHRYLPNKIK
FT                   NPLNSKTMEVLAIIAYNQPCTRPRINEIRGADSFQIVDDLLEKELIVELGRKDTPGRPF
FT                   IYEVSPKFYDLFGINSLDELPKVENFDLDKFRQGSFFDSNRYGDD"
FT   gene            354003..354989
FT                   /locus_tag="MPNE_0344"
FT   CDS_pept        354003..354989
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0344"
FT                   /product="phosphofructokinase"
FT                   /note="identified by match to protein family HMM PF00365"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86750"
FT                   /db_xref="GOA:A0A0H3DLW4"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLW4"
FT                   /protein_id="ADK86750.1"
FT                   /translation="MSPKTTKKIAILTSGGDAPGMNATLVYLTRYATSSEIEVFFVKNG
FT                   YYGLYHDELVPAHQLDLSNSLFSAGTVIGSKRFVEFKELKVREQAAQNLKKRQIDYLVV
FT                   IGGDGSYMGAKLLSELGVNCYCLPGTIDNDINSSEFTIGFLTALESIKVNVQAVYHTTK
FT                   SHERVAIVEVMGRHCGDLAIFGALATNADFVVTPSNKMDLKQLESAVKKILQHQNHCVV
FT                   IVSENIYGFDGYPSLTAIKQHFDANNMKCNLVSLGHTQRGFAPTSLELVQISLMAQHTI
FT                   NLIGQNKVNQVIGNKANVPVNYDFDQAFNMPPVDRSALIAVINKNII"
FT   gene            354995..356521
FT                   /gene="pyk"
FT                   /locus_tag="MPNE_0345"
FT   CDS_pept        354995..356521
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pyk"
FT                   /locus_tag="MPNE_0345"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="identified by match to protein family HMM PF00224;
FT                   match to protein family HMM TIGR01064"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86906"
FT                   /db_xref="GOA:A0A0H3DMD7"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMD7"
FT                   /protein_id="ADK86906.1"
FT                   /translation="MIHHLKRTKIIATCGPALTKKLWTLAMLDDPAYAAMKAEAYANIE
FT                   NIIKNGVTVIRLNFSHGNHEEQAVRIKIVRDVAKKLNLPVSIMLDTNGPEIRVFETAPE
FT                   GLKILKDSEVVINTTTKEVAKNNQFSVSDASGTYNMVNDVKVGQKILVDDGKLSLVVKR
FT                   IDTKNNQVICVAQNDHTIFTKKRLNLPNADYSIPFLSAKDLRDIDFGLTHQIDYIAASF
FT                   VNTTENIKQLRDYLASKNAKHVKLIAKIESNHALNNIDGIIKASDGIMVARGDLGLEIP
FT                   YYKVPYWQRYMIKACRFFNKRVITATQMLDSLEKNIQPTRAEVTDVYFAVDRGNDATML
FT                   SGETANGAFPLNAVYVMKMIDKQSETFFDYQYNLNYYMANSKARHSEFWKQVVLPLAQK
FT                   TAPKRKLINSDFKYDFVVHATNNLNEIYALSNARLAAAVIILTNDPQVYTGHGVDYGIF
FT                   PYLIDQKPQSLSKAEFKSLANVAIKHYQQHGEISQLKQCLGVFHNKIISL"
FT   gene            356561..356637
FT                   /locus_tag="MPNE_0346"
FT   tRNA            356561..356637
FT                   /locus_tag="MPNE_0346"
FT                   /product="tRNA-Cys"
FT   gene            356689..356765
FT                   /locus_tag="MPNE_0347"
FT   tRNA            356689..356765
FT                   /locus_tag="MPNE_0347"
FT                   /product="tRNA-Pro"
FT   gene            356770..356846
FT                   /locus_tag="MPNE_0348"
FT   tRNA            356770..356846
FT                   /locus_tag="MPNE_0348"
FT                   /product="tRNA-Met"
FT   gene            356857..356932
FT                   /locus_tag="MPNE_0349"
FT   tRNA            356857..356932
FT                   /locus_tag="MPNE_0349"
FT                   /product="tRNA-Met"
FT   gene            356973..357063
FT                   /locus_tag="MPNE_0350"
FT   tRNA            356973..357063
FT                   /locus_tag="MPNE_0350"
FT                   /product="tRNA-Ser"
FT   gene            357076..357152
FT                   /locus_tag="MPNE_0351"
FT   tRNA            357076..357152
FT                   /locus_tag="MPNE_0351"
FT                   /product="tRNA-Met"
FT   gene            357154..357227
FT                   /locus_tag="MPNE_0352"
FT   tRNA            357154..357227
FT                   /locus_tag="MPNE_0352"
FT                   /product="tRNA-Asp"
FT   gene            357229..357304
FT                   /locus_tag="MPNE_0353"
FT   tRNA            357229..357304
FT                   /locus_tag="MPNE_0353"
FT                   /product="tRNA-Phe"
FT   gene            357500..358216
FT                   /pseudo
FT                   /locus_tag="MPNE_0354"
FT                   /note="amidinotransferase; this gene contains a frame shift
FT                   which may be the result of a sequencing error; identified
FT                   by match to protein family HMM PF02274"
FT   gene            358168..358713
FT                   /pseudo
FT                   /locus_tag="MPNE_0355"
FT                   /note="amidinotransferase; this gene contains a frame shift
FT                   which may be the result of a sequencing error; identified
FT                   by match to protein family HMM PF02274"
FT   gene            358853..359782
FT                   /pseudo
FT                   /gene="argF"
FT                   /locus_tag="MPNE_0356"
FT                   /note="ornithine carbamoyltransferase; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00185; match to
FT                   protein family HMM PF02729; match to protein family HMM
FT                   TIGR00658"
FT   gene            359785..360714
FT                   /locus_tag="MPNE_0357"
FT   CDS_pept        359785..360714
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0357"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="identified by match to protein family HMM PF00696"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86964"
FT                   /db_xref="GOA:A0A0H3DL48"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL48"
FT                   /protein_id="ADK86964.1"
FT                   /translation="MQKIVIALGGNALGNNPTEQKDLVQLPARQAVALLKQGYQILLGH
FT                   GNGPQVGMIYNAFSAAKQVNPNTPTVPFAESGAMSQGYIGLHLLTALYNELLHQKLPHQ
FT                   AVYFLTQTLVEASDPAFQNPNKPVGPFYNTEETARSANPNSTVVEDAGRGWRKVVASPK
FT                   PVDVLGIDAIKSSFNQGNLVIVGGGGGVPTIKTKSGYATVDGVIDKDLALSEIAIKVEA
FT                   DLFVILTAVDFVYINYGQPNEQKLTCINTKEAKTLMAANQFAKGSMLPKVEACLNFVQS
FT                   GTNKTAIIAQLDQLAAAIAGKIGTKIVK"
FT   gene            360717..362414
FT                   /locus_tag="MPNE_0358"
FT   CDS_pept        360717..362414
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0358"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87131"
FT                   /db_xref="GOA:A0A0H3DLH7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLH7"
FT                   /protein_id="ADK87131.1"
FT                   /translation="MKQQKPKISFIAAMLIVIGSSIGAGIFFKSSTVLENSQASLVLAI
FT                   FNWLVASVAVIAMALALIEIASVRNDNLSIISWVKVFNRRWLYHGCKNFMTYLYLPLTF
FT                   FFMPLYFICSIQDGFRGLLGLETGAHFNTSVDWLIWLALALIITTYFLTIPPLYAKVGN
FT                   IQNMVVSAVKFIPLVFVPIIGFIVAGTGNGELKNVKALVQPPQINGATASFTQLVQAGY
FT                   GITRFTGIGAGMGSFISIAAIFFAYDGFYVTAGLQSEMREPKKTPWALFLGLLITTLFY
FT                   LILAVALSINGGLFSGMEESMGKLFNNKRAGQIVFGVVNLMIGIGVLGIINGFALWAPR
FT                   FVEDLLAQGDLPFWKQVQGRLNPNKPVVGVIYCLVLSLTVQVLFTVIGALAYLPTVADY
FT                   KNYVNTEIDKLNSMQWLYSFSDLMATWTSLFTFAFIACAIFGAIVNRKTKQITIANPKR
FT                   YFLPAAWIAVVVNCISVFVTIIEPFINLFLLFGYDETVAHTVLGNDFIELNELVIGRVM
FT                   LIVVLVFFAIISFLPVYVEDQYHKRKFGSLANYQQYVQQHLAHSTING"
FT   gene            362548..363771
FT                   /locus_tag="MPNE_0359"
FT   CDS_pept        362548..363771
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0359"
FT                   /product="putative proline-rich P65 protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87002"
FT                   /db_xref="GOA:E1QC64"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/Swiss-Prot:E1QC64"
FT                   /protein_id="ADK87002.1"
FT                   /translation="MDINKPGWNQSDQQATAYDPNQQQYYGDGSTYYDPDQAVDPNQAY
FT                   YPDPNTYPDAAAYYGYGQDGQAYPQDYAQDPNQAYYADPNAYQDPNAYTDPNAYVDPNA
FT                   YQDPNAYVDPNNYTDPNAYYGYGQDGQAYPQDYAQDPNQAYYAYVDPNAYQDPNAYTDP
FT                   YYVTSTDHNAYYGQVDNVPALEASDLAYEVTPQEQAAEQELFSEPETKVIREIHEFPFE
FT                   KIRSYFQTDFDSYNSRLTQLKDKLDNAIFSMRKAIDTVKENSANLQIMKQNFERQLKEQ
FT                   QTQRLTSNTDAEKIGAKINQLEERMQRLSRTMESVEWTKKEPRQEQFDPRFVDPRNFNN
FT                   YVNNTDTMMSMFEKVLMMNLLRSTTPVQPPVQYFTPQPLTASPRPVYEEPISASFRRRG
FT                   YRGDEFYE"
FT   gene            363791..368815
FT                   /pseudo
FT                   /locus_tag="MPNE_0360"
FT                   /note="M protein repeat protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            368878..369246
FT                   /pseudo
FT                   /locus_tag="MPNE_0361"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            369261..370334
FT                   /locus_tag="MPNE_0362"
FT   CDS_pept        369261..370334
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ20"
FT                   /protein_id="ADK87259.1"
FT                   /translation="MTNDYQQLNYLVETDDEADIIIANLVKQLNELKEILLSLDNQDLE
FT                   INQVNHRTTVHNTSSNTSNNSTSNNSADGNYNSNFFHNFSKETLQTQAKRGFLLLERCS
FT                   LVGLQQLELEYLNVLGRSFESHQDKINFLVNLRDLTNDHLLDTEKIVSTLEQIFNVIGG
FT                   TEYTPILNSFFNQSLNDPDPIQREIGLKQFVANLRQRFKTLLQKTNNSIQQLEAEIQIP
FT                   TTHIKSDEVMFGPPDMNERLVLNDSETDAILRSIEAELESALQNKKQVVVTAVPPIAAN
FT                   LATDSISQETLEHNLNNTETVNTTTVTVTSASETQVRKPQISLRPIFQGNFPKRLSRED
FT                   IQRYAHQLQELEQSNEG"
FT   gene            370324..370980
FT                   /locus_tag="MPNE_0363"
FT   CDS_pept        370324..370980
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87194"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPT4"
FT                   /protein_id="ADK87194.1"
FT                   /translation="MKDSALTLKRVRIGKFSESMVEERPTLNLFEKVEFNPVPTALVDQ
FT                   LPTEPLVEATLLEKEAITFVDTYATSEAHDQIATFVLEQSMETEVVEKEAIETAIVAPA
FT                   PDLVEEKAVLVEEVLVEPTATEAVTTEENQVSTTSVTKIKTKRSNTKKVTSETLVASKS
FT                   VKTKKLITPNRVSSGNVNITLWQADKKSTNLTKTKTDLFGKKHQFKGPQLISYKK"
FT   gene            complement(371063..371257)
FT                   /locus_tag="MPNE_0364"
FT   CDS_pept        complement(371063..371257)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86801"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM39"
FT                   /protein_id="ADK86801.1"
FT                   /translation="MIVNAFSTLINTALDISEAANANNANGNGSSYSYKRRNSQKDYFS
FT                   TGRFRLGLTPGKSSYSFPV"
FT   gene            371405..371481
FT                   /locus_tag="MPNE_0365"
FT   tRNA            371405..371481
FT                   /locus_tag="MPNE_0365"
FT                   /product="tRNA-Arg"
FT   gene            371735..372160
FT                   /gene="mraZ"
FT                   /locus_tag="MPNE_0366"
FT   CDS_pept        371735..372160
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="mraZ"
FT                   /locus_tag="MPNE_0366"
FT                   /product="protein MraZ"
FT                   /note="identified by match to protein family HMM PF02381;
FT                   match to protein family HMM TIGR00242"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86913"
FT                   /db_xref="GOA:A0A0H3DKJ2"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKJ2"
FT                   /protein_id="ADK86913.1"
FT                   /translation="MLLGTFNITLDAKNRISLPAKLRAFFEGSIVINRGFENCLEVRKP
FT                   QDFQKYFEQFNSFPSTQKDTRTLKRLIFANANFVDVDTAGRVLIPNNLINDAKLDKEIV
FT                   LIGQFDHLEIWDKKLYEDYLANSESLETVAERMKDVK"
FT   gene            372150..373076
FT                   /gene="mraW"
FT                   /locus_tag="MPNE_0367"
FT   CDS_pept        372150..373076
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="mraW"
FT                   /locus_tag="MPNE_0367"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01795;
FT                   match to protein family HMM TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86952"
FT                   /db_xref="GOA:A0A0H3DP16"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP16"
FT                   /protein_id="ADK86952.1"
FT                   /translation="MLSNQPHKSVLLDEVIHNLNIKGDGNYLDLTVGFGGHSQHILEQL
FT                   TTGTLTGNDMDKDSITFCTELFKDKKNVVLVHDNFANFFNHLKQLKVTKFDGILIDLGV
FT                   SSYQLDKPERGFSFKHAGPFDMRMHQSDRVPTALDILERLSEEELTHVLKKFGEIAHPK
FT                   PIAKALKTLINNIKNPTTVEVAETVKAAASNFEKYKSRNYLAKVFQAIRIYLNRELESL
FT                   EIVLQHIPKLLNNKGRFLVIVFHSLEEKLVRNYIFKLTHFVQPPELPVKLTPPFELITK
FT                   KPILPTEQEIKTNPRARSAKLFVIEKK"
FT   gene            373079..374338
FT                   /locus_tag="MPNE_0368"
FT   CDS_pept        373079..374338
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87041"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMQ3"
FT                   /protein_id="ADK87041.1"
FT                   /translation="MYNLKNIYASITLYPHEINLVVSDNNNQFHVLYENSIANDELYTH
FT                   AGITNKAKFKVVLNQLINNANDYLGFKLEKVIVVLAELVDDLEINRFKTDVFFTGYDFN
FT                   HQDMLSSEKNRFLLKNRHINPNEVLDLVALNYRDLTTGKISKNFKYNCSYRANVIYYTT
FT                   KNSLVKELKPFLKRNIIVKIDKIVTHHMVLAHSIKQINKNNLFVYLGEHTTDLMLFMDN
FT                   ALVDLVSEPFGRVNFLESDNDSENKALLEFLVDSTARIGDSGSIGMAYTDGSTYKEIRA
FT                   VTIDDLIQSVNEKTKYLIDFINTNTEIFFQKYGFLPSTLLFYTKSKQLLNNFQLNQNLL
FT                   SNHFKTVTIFKNEVQFVSRKYLLNCQAIALSWRQDQINVNPTSFALPFYSDKIEKQFKK
FT                   SFLMLKVHTQINKLVQKLIK"
FT   gene            374344..375105
FT                   /pseudo
FT                   /gene="ftsZ"
FT                   /locus_tag="MPNE_0369"
FT                   /note="cell division protein FtsZ; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00091; match to
FT                   protein family HMM TIGR00065"
FT   gene            375113..375487
FT                   /pseudo
FT                   /locus_tag="MPNE_0370"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            375530..377005
FT                   /locus_tag="MPNE_0371"
FT   CDS_pept        375530..377005
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0371"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324;
FT                   overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87098"
FT                   /db_xref="GOA:A0A0H3DN16"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN16"
FT                   /protein_id="ADK87098.1"
FT                   /translation="MAVASKKFTERQFLFFVVNYIAGFGFISTALSMFELGPLSWVIFF
FT                   LVSLISLIVTLAFARVSAIDKNNYGGAYLWAKKAFNSERYSHRLFIFFTGWNNFIASPL
FT                   YAAIAPLFILSAFKGIDGIQGNAANTWILIAAGFTFYLLLAFLSTKGTSLNKKLIAVFA
FT                   SIKWAVLLSTLIVALIVIGKNGNGYAINNDIKQGPFKEREITLGAVATVFITFFYSYSG
FT                   AEDISTMTPDVKTTNFRKILIISFIAVFLFYFVGILIFNGLLNVSQSDDDKGKDGRIAS
FT                   VADIFRLAGGLGALIFYGVGALFNNVSTRLSTIIANSRKILPLAQDNYLPTTFSKANSK
FT                   GEFQNAIWFTFGTTIITMTVLFFVPLITSNFDFDKSTEYAASIGSAATLVQYILVFFII
FT                   FRLIYKKEQLYQKNWTRELEQILFGIGVFIILLMLLFYLFPVIDGKTKWQLKNTLTLVV
FT                   YGVLILIGFALFMTQEYKRNKQKESYVTPRAVT"
FT   gene            376980..378491
FT                   /locus_tag="MPNE_0372"
FT   CDS_pept        376980..378491
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0372"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324;
FT                   overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86947"
FT                   /db_xref="GOA:A0A0H3DP11"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP11"
FT                   /protein_id="ADK86947.1"
FT                   /translation="MSHQEQLHKPNRQQFSEKQFIAFAFNYVAGFGFISVVLTMFKLGP
FT                   FSYLILGLAALGILGVMLSFSRLSIICGSKAYGGSYLIAKKALGAKTITARFFTFLSGW
FT                   NVSLTGPFNGLIVPAVLVLSFADIKAVKDNNGALIGLLVGGFVLFGALNFISLFGLKMN
FT                   KNAILFFAIVKWVVVLGGLILGIYLIGTNHGHGFVENNTLGEHIEDLSFLKVISTTVGM
FT                   LVAFAGTEDLTAITPDVKSKNIRKCFLLMFGAVTLLYLIGFVIISGISGLNGYGLDGKE
FT                   KNEKAINTFGSIYFQAGGKYLGIPLLVIFGLGFLLNSLASRLGMTITTARKYVALAQDG
FT                   FLPSFINEQNKHHEYHKAVWASNIMTLAVMVLMIIVPFLPNDENPGKQLVMFDAISVLV
FT                   EVAIELAVLISLIQYFITYIFFFMILAKKEGSASVSWWEIASYGVSFAIITVLLFVNLF
FT                   PITAWKNTNTFKLSILAAFFALGIGFFIHSEIKHKGQLVKSVECN"
FT   gene            378986..379849
FT                   /gene="thyA"
FT                   /locus_tag="MPNE_0373"
FT   CDS_pept        378986..379849
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="thyA"
FT                   /locus_tag="MPNE_0373"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="identified by match to protein family HMM PF00303;
FT                   match to protein family HMM TIGR03284"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87028"
FT                   /db_xref="GOA:A0A0H3DP88"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP88"
FT                   /protein_id="ADK87028.1"
FT                   /translation="MQQYLDLARYVLEHGKYRPNRTDTAGIGVFGYQMHFDISKHFPLL
FT                   TTKKVHWKSIVHELLWFIKGDTNIKYLVDNKVNIWNEWPYESFKKSPHFNGESQKEFIE
FT                   RIRQDAKFAQQFGNLGPVYGKQWRDFNGVDQLKKVIAQIKVNPFSRRLIVSSWNPNEVD
FT                   QMLLPPCHSLYQFYVQDGQLSCQLYQRSGDIFLGIPFNIASYSLLVYLVAKETNLKPGS
FT                   FVHTIGDAHIYENHLEQIKLQLTRQPKPLPKVVLKSDKSIFDYQFDDIELVDYDHHPTI
FT                   KGEVAV"
FT   gene            379851..380333
FT                   /gene="folA_2"
FT                   /locus_tag="MPNE_0374"
FT   CDS_pept        379851..380333
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="folA_2"
FT                   /locus_tag="MPNE_0374"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="identified by match to protein family HMM PF00186"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86789"
FT                   /db_xref="GOA:A0A0H3DKL6"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKL6"
FT                   /protein_id="ADK86789.1"
FT                   /translation="MVKAIWAMDQNGLIGNGNSLPWRIKAELQHFRQTTLHQDVLMGSA
FT                   TYLSLPPVFSERNVYILTRNLNFNPPDKGCLTKVIHEYENFIQPYLHHPDKHLYICGGA
FT                   QVYEQLIPRCDALIVSTIFGKYTGDKYLKVDFSPFELTKEISFAEFKVAYYHKIAR"
FT   gene            380340..381359
FT                   /locus_tag="MPNE_0375"
FT   CDS_pept        380340..381359
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0375"
FT                   /product="ribonucleoside-diphosphate reductase, beta
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by match to protein family HMM PF00268"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86828"
FT                   /db_xref="GOA:A0A0H3DKB9"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKB9"
FT                   /protein_id="ADK86828.1"
FT                   /translation="MANTKKYFLESVSPLEYAQKKFQGNLRSVNWNLVDDEKDLEVWNR
FT                   ITQNFWLPEKIPVSNDIPSWKQLSKEWQDLITKTFTGLTLLDTIQATIGDIKQIDYALT
FT                   DHEQVIYANFAFMVGVHARSYGTIFSTLCTSEQITEAHEWVVKTESLQKRAKALIPYYT
FT                   GKDPLKSKVAAALMPGFLLYGGFYLPFYLSSRKQLPNTSDIIRLILRDKVIHNYYSGYK
FT                   FQRKVEKMSKEKQAEMKRFVFDLMYELIELEKAYLKELYEGFGIVEDAIKFSIYNAGKF
FT                   LQNLGYDSPFTEEETRIKPEIFAQLSARADENHDFFSGNGSSYVMGISEETEDKDWDF"
FT   gene            381362..381823
FT                   /gene="nrdI"
FT                   /locus_tag="MPNE_0376"
FT   CDS_pept        381362..381823
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="nrdI"
FT                   /locus_tag="MPNE_0376"
FT                   /product="NrdI protein"
FT                   /note="identified by match to protein family HMM PF07972;
FT                   match to protein family HMM TIGR00333"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87255"
FT                   /db_xref="GOA:A0A0H3DLJ0"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLJ0"
FT                   /protein_id="ADK87255.1"
FT                   /translation="MHKDIKIVDASAIVKPTGTPYVVYFSSISNNTHRFIEKLGFEHTR
FT                   IPVNLDEQIEVNQEYVLFCPTYSGGGEYTSGAVPKQVIHFLNNKHNRDLCRGVISSGNT
FT                   NFGNTFAIAGPILSKKLNVPLLYQFELLGTKNDVEQVQTIITNFFGKAK"
FT   gene            381847..384012
FT                   /locus_tag="MPNE_0377"
FT   CDS_pept        381847..384012
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0377"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by match to protein family HMM PF00317;
FT                   match to protein family HMM PF02867; match to protein
FT                   family HMM PF08343; match to protein family HMM TIGR02506"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86978"
FT                   /db_xref="GOA:A0A0H3DKP6"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKP6"
FT                   /protein_id="ADK86978.1"
FT                   /translation="MSVKEKIPAFNTQEDLESYISLNAYTKVYGDFKMDLHAVEAYIQE
FT                   HVKPKTKVFHSTKERLDFLVKNDYYDENIINMYSFEQFEEITRKAYAYRFRYANFMGAF
FT                   KFYNAYALKTFDGKWYLENYEDRVVMNVLFLANGNYNKALKLLKQIITNRFQPATPTFL
FT                   NAGRKKRGEFVSCYLLRIEDNMESIGRAITTTLQLSKRDGGVALLLTNIRESGAPIKKI
FT                   ENQSSDIIPIMKLLEDSFSYANQLGQRQGAGAVYLHAHHPDVMQFLDTKRENADEKIRI
FT                   KSLSLGLVIPDITFTLAKNNEEMALFSPYDVYEEYGKPLSDISVTEMYYELLANQRIKK
FT                   TFINARKFFQTVAELHFESGYPYILFDDTVNRRNAHPNRIVMSNLCSEIVQPSTPSEFH
FT                   HDLAFKKVGNDISCNLGSLNIAKAMESGPEFSELVKLAIESLDLVSRVSNLETAPSIQK
FT                   GNSENHALGLGAMNLHGFLATNQIYYNSPEAIDFTNIFFYTVAYHAFKASSELALEKGK
FT                   FKNFENTKFADGSYFDKYIKVEPDFWTPKTERVKALFQKYQVEIPTRENWKELALNIQK
FT                   NGLANSHLLAIAPTGSISYLSSCTPSLQPVVSPVEVRKEGRLGRIYVPAYQLNKDSYPF
FT                   YKDGAYELGPEPIINIAAAAQQHVDQAISLTLFMTDKATTRDLNKAYIYAFKKGCSSIY
FT                   YVRVRQEVLEDSEDHTIQMQQCEACVI"
FT   gene            384159..384461
FT                   /gene="rplU"
FT                   /locus_tag="MPNE_0378"
FT   CDS_pept        384159..384461
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplU"
FT                   /locus_tag="MPNE_0378"
FT                   /product="ribosomal protein L21"
FT                   /note="identified by match to protein family HMM PF00829;
FT                   match to protein family HMM TIGR00061"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86995"
FT                   /db_xref="GOA:A0A0H3DML2"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DML2"
FT                   /protein_id="ADK86995.1"
FT                   /translation="MHAIVVCGSKQYLVHENDTFFVEKLEAPVGKEIQLDKVLMLDEKI
FT                   GAPYLEKARVVCVVEKHGLQRKVNVIKHISQKHHLKKYGHRQPYTKLKVVRFVHD"
FT   gene            384469..384756
FT                   /locus_tag="MPNE_0379"
FT   CDS_pept        384469..384756
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04327"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86902"
FT                   /db_xref="InterPro:IPR007422"
FT                   /db_xref="InterPro:IPR036764"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNW7"
FT                   /protein_id="ADK86902.1"
FT                   /translation="MSHHKLAASGHALFAKKGQDIVCAAVSGIIFGALPWFETNSIAVQ
FT                   EDATVPSLSLELVQPTAKLITGLSVVIMQLKTLAHSYPQFISFEDQRKDE"
FT   gene            384749..385063
FT                   /gene="rpmA"
FT                   /locus_tag="MPNE_0380"
FT   CDS_pept        384749..385063
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmA"
FT                   /locus_tag="MPNE_0380"
FT                   /product="ribosomal protein L27"
FT                   /note="identified by match to protein family HMM PF01016;
FT                   match to protein family HMM TIGR00062"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87189"
FT                   /db_xref="GOA:A0A0H3DPS8"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPS8"
FT                   /protein_id="ADK87189.1"
FT                   /translation="MNNKYFLTKIDLQFFASKKGVGSTKNGRDSHAKRLGAKKADGQMI
FT                   RTGQIIYRQRGTRVCPGVNVGLGSDDTLFALSDGLVKYQKFGPKQGKTRVSVVKHKLDA
FT                   "
FT   gene            385056..385916
FT                   /locus_tag="MPNE_0381"
FT   CDS_pept        385056..385916
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0381"
FT                   /product="apurinic endonuclease (APN1)"
FT                   /note="identified by match to protein family HMM PF01261;
FT                   match to protein family HMM TIGR00587"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87088"
FT                   /db_xref="GOA:A0A0H3DMZ0"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMZ0"
FT                   /protein_id="ADK87088.1"
FT                   /translation="MPKLLGSFISFKSPHYLVGSVRDAVSIKAQAFMIFLGAPHTALRV
FT                   DPNRMQIDEGHTLMEQHNLSKSGMVVHAPYIINCASKDPVKQTFAIDVLTREVKLCHAV
FT                   GAKLIVLHPGSAVEQTQTQALDHLIKVLNTVIANTKEVIICLETMAGKGNEIGRDLDQL
FT                   KYVINHIEQQERIGVCLDTCHFHDSGNDFNNTAEIMETIDTKLGFEFLKVIHLNESKNV
FT                   CGSKKDRHANLGEGMIGFDNLMRFIAQPQIKQIPIVLETPSDKHNYPAVYGAEIERIRA
FT                   WFGAR"
FT   gene            385894..386346
FT                   /locus_tag="MPNE_0382"
FT   CDS_pept        385894..386346
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0382"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86716"
FT                   /db_xref="GOA:A0A0H3DNC5"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNC5"
FT                   /protein_id="ADK86716.1"
FT                   /translation="MLDLEHDNQTLKDYISVFERNKMRLTQSRLMLLQCLVQHRDWHTL
FT                   AELKHHLEQNQQRTTLASIYNNLKIFAKLKLINIFVDTNRFETYYCLRHENHKHIYFFD
FT                   ENQRKFLTLPLQDKEALSLIGHKSKHGKIKLNDFYIVASGTLEDDQ"
FT   gene            386336..387220
FT                   /locus_tag="MPNE_0383"
FT   CDS_pept        386336..387220
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0383"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87284"
FT                   /db_xref="InterPro:IPR023402"
FT                   /db_xref="InterPro:IPR023403"
FT                   /db_xref="InterPro:IPR024503"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ36"
FT                   /protein_id="ADK87284.1"
FT                   /translation="MINKPNQFVNHLSALKKHFASYKELREAFNDYHKHNGDELTTFFL
FT                   HQFDKVMELVKQKDFKTAQSRCEEELAAPYLPKPLVSFFQSLLQLVNHDLLEQQNAALA
FT                   SLPAAKIIELVLQDYPNKLNMIHYLLPKTKAFVKPHLLQRLQFVLTDSELLELKRFSFF
FT                   QALNQIPGFQGEQVEYFNSKLKQKFTLTLGEFEIAQQPDAKAYFEQLITQIQQLFLKEP
FT                   VNAEFANEIIDAFLVSYFPLHPPVPLAQLAAKIYEYVSQIVLNEAVNLKDELIKLIVHT
FT                   LYEQLDRPVGDEN"
FT   gene            387245..388579
FT                   /gene="tig"
FT                   /locus_tag="MPNE_0384"
FT   CDS_pept        387245..388579
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tig"
FT                   /locus_tag="MPNE_0384"
FT                   /product="trigger factor"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254;
FT                   match to protein family HMM PF05697; match to protein
FT                   family HMM PF05698; match to protein family HMM TIGR00115"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86669"
FT                   /db_xref="GOA:A0A0H3DLK6"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLK6"
FT                   /protein_id="ADK86669.1"
FT                   /translation="MKQYKLVNTTQKEKTLCLEIAIDTKLWKETQQKQTQDLTKNMKIK
FT                   GFRKGKVPPTLAKDYLDRAELLQRSAQAVIDAIFQPLQQEAVIADNENVIEDFPTIDFK
FT                   TINENDCVILFDFDLVPQFELPDYKHIKDLSPIVPLKDEEFNKELHNIEKNKGKLVDVS
FT                   DKALANNDIAVIDFVGKVDGKVLESATAKQYELTIGSNSFIDGFESGLIGMKVGDKRQL
FT                   KLKFPKDYHAEELKGKPVEFDIELKAIKQLEITPMDETNFKEYLPAQYQGFNSLKEFKT
FT                   YFHKLVSAKKLEITLQENSVKIRQFFLANTTLPYIPDSLIKLESDRLLRAQKDQAEQYK
FT                   IPFERLLAASKLSLEQLQQRNIKEARDNVTFALVMKRIADVEKIKVDNKKIHSEIESII
FT                   DVEYPFVNAELKKQMFHNMEQQKDFVESIILNRLTTTKIIEYSTH"
FT   gene            388650..391037
FT                   /gene="lon"
FT                   /locus_tag="MPNE_0385"
FT   CDS_pept        388650..391037
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="lon"
FT                   /locus_tag="MPNE_0385"
FT                   /product="endopeptidase La"
FT                   /EC_number="3.4.21.53"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF05362; match to protein
FT                   family HMM PF07728; match to protein family HMM TIGR00763"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86805"
FT                   /db_xref="GOA:A0A0H3DM13"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM13"
FT                   /protein_id="ADK86805.1"
FT                   /translation="MPAVKKPQILVVRNQVIFPYNGFELDVGRERSKKLIKALKNLKTK
FT                   RLVLVTQKNSDQLNPEFDDIYHCGTLCDIDEIIEVPSEDGKTADYKIKGKGLQRVAITS
FT                   FSDADLTKYDHHFLNSTLTENKALDKLLERIFPDKEDFAEILDSLNSFLELQELKKLSK
FT                   VPKDIKRYDIITFKLASLIFKDITLQQAILEENDIEKRLQKIIGSGIEDLGHISEEARA
FT                   KQRESEFDKIDNRITRKVNEQLSRQQRDFYLREKLRVIREEIGMTSKKEDEVSNIRKKL
FT                   EENPYPEHIKKRILSELDHFENSSSSSQESTLTKTYIDTLMNLPWWQESKDNADVKNLI
FT                   KILNKNHSGLDKVKERVVEYLAVQLRTKKLKGPIMCLVGPPGVGKSSLAKSIAEALNKR
FT                   FVKVSLGGVHDESEIRGHRKTYLGSMPGRILKGMARAKVINPLFLLDEIDKMTSSNQGY
FT                   PSGALLEVLDPELNNKFSDNYVEEDYDLSKVMFVATANYIEDIPEALLDRMEVIELTSY
FT                   TEQEKLQITKSHLVKRCLDDAEIKTDDLKFTDEGISYIIKFYTREAGVRQLERLIQQIV
FT                   RKYIVNLQKTGEQQVVVDVDLVKKYLKKEIFDYTVRDEDALPGIVNGMAYTPTGGDLLP
FT                   IEVTHVAGKGDLILTGNLKQTMRESASVALGYVKANAQSFNINPNLFKKVDINIHVPGG
FT                   GIPKDGPSAGAALVTAIISSLTGKKVDPKIAMTGEITLRGKVMTIGGVKEKTISAYRGG
FT                   VRTIFMPEKNERYLDEVPKDIVKDLEIILVKEYKDIYNKIFN"
FT   gene            391232..393259
FT                   /pseudo
FT                   /locus_tag="MPNE_0386"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            393250..393483
FT                   /pseudo
FT                   /locus_tag="MPNE_0387"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            393486..394466
FT                   /locus_tag="MPNE_0388"
FT   CDS_pept        393486..394466
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0388"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86722"
FT                   /db_xref="GOA:A0A0H3DNC8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNC8"
FT                   /protein_id="ADK86722.1"
FT                   /translation="MSVTPIVEVKHLEKEFGFWRKNRILKDVNFAIMPGEFHAFIGQNG
FT                   AGKTTTIKCLISSYQRFKDEINIDGISNKNAKSKGVISYIPEYAVFPKHLNTHEYLYTL
FT                   GKLSGCSLQTIKEKVDYWLARFQIEHLRFKKPNDFSSGQKKKVLLIQALFNDPKLLIMD
FT                   EPTANLDPKTRNEFMDVCYELNVRNKMAVFVSSHILAELENYCDSLTVIHEGQILFNGK
FT                   TKNIAKDNFGYRLKVNHSDSLRKWLKAQKIAYKYFPATDDFQVDLKQEQSNKFAVELYQ
FT                   QPDFEVFIFARQGNSLQNIYNNLIEQYEYDQAQRAVAIREQDEAV"
FT   gene            394453..396678
FT                   /locus_tag="MPNE_0389"
FT   CDS_pept        394453..396678
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86983"
FT                   /db_xref="GOA:A0A0H3DKQ1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKQ1"
FT                   /protein_id="ADK86983.1"
FT                   /translation="MKLFKNWSDVNNVKQRQLLLAYFRFILKQTVKSWLLWVTAGLVLF
FT                   LLALVLLIIPAFTKQDPLFLWSHPVVQMSSLIIPFIALFATIITFQVFINGYYNGLEIL
FT                   LITRFFTRGRLFFARLAVLFIWITGTAFLSGLFVSLTATLGATSQTVTDLVLSVFFGVL
FT                   LLSLLFSCVLIIIAQFLNRTQSMLLLLLGVSLASFTTVILAFSIKPPSENLRDNSYQPL
FT                   NLSLISKSKSKGVENVFTIIDSSNVSDPRNKKKSIVKTNPQAIWDEYGESSFFQSQYYW
FT                   NVGYWINSLFRLNSLSDYRNFDVNLYFLNTKLNFDREVDTDKMVDFVSFRDQRHLYFLS
FT                   YSFFINTHNLPTQPLPRILTYDNNGAFLEKIVPSFDDIKLDPPRVKKVYKFFSDTIIQS
FT                   FRDYEAEEKERQEKEEKEKAEKDNGNGQDSNKVNSVSTEPNNKNSSDADSKDNNDSSDS
FT                   QGKDSSKSKPKFRPRLPQFFDRVSINYSKFSSSFNTQLKHIHQGLSTRDEAMEIFKDKV
FT                   ALFYALSMAYDNFTFQKDSGIIDNTSLNKFKTEFNKKQKELTEKNKQKQDGKDQKSQRM
FT                   TQGADKAVTVEPKAMQSEIGMTDQTNDQSSSETKDSMDSSDSSDTVDNTDESEDKQSEE
FT                   EEKFDEEIENAKKMPKAEDAFFNTASIWLSSPFLFFENGAKREQRYEIHLLNSNTQVNN
FT                   EIIKTNSFYYVSGEPIVGQEVIIAMVLVVTLGLLVGSFFAYQKRDIK"
FT   gene            complement(396679..397728)
FT                   /gene="nadD"
FT                   /locus_tag="MPNE_0390"
FT   CDS_pept        complement(396679..397728)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="nadD"
FT                   /locus_tag="MPNE_0390"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM PF01966; match to protein
FT                   family HMM TIGR00125; match to protein family HMM
FT                   TIGR00482; match to protein family HMM TIGR00488"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86884"
FT                   /db_xref="GOA:A0A0H3DKX5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKX5"
FT                   /protein_id="ADK86884.1"
FT                   /translation="MRKKIVIFGGAFDPLHQAHIYIAKRAVQAIKAQKLYFVPTAKAFF
FT                   KSPIKASNQARLAMLRVALKALPQMAVSNFDIKAQNGFSFNTVQHFKQRFPNAELYFLI
FT                   GSDKLSELAKWHNIEQLQKLCRFVCYERFGYPIDEQLVQQFNVRLLGKCPLDLASSEMF
FT                   GSHKFRQIPAKVLHYIHQHNIYLKTILQTLLDEPRMQHCLRVGQLAKTLAVANKLDGKT
FT                   AYTAGAYHDLAKQLPQAQLEKLAKVAGVNDYPSWKVLHSYVGAYILKHWYGLNNSAVFS
FT                   AIWNHTVPPQKMSQLDMIIYLADKLEPMRVHEEWAKGIDITALVKLAKKDLKLAYQITL
FT                   KYVRSLQKN"
FT   gene            397798..399663
FT                   /locus_tag="MPNE_0391"
FT   CDS_pept        397798..399663
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87132"
FT                   /db_xref="GOA:A0A0H3DN33"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN33"
FT                   /protein_id="ADK87132.1"
FT                   /translation="MVKKELEIYNLYTFQIDLDKKLLFEKADNQQNYSKIRARYFKNSA
FT                   RNQQAVFLNKNLIKNTFNKALLNFSDFLSGSGVESIFKQVIDDQPEVLNYLKQVKKEDS
FT                   CDGHSEASQLVFNVVINPKNTLANFFEELTIYLHFNEENSTVVGSFSLKWNIKRADLFS
FT                   ETKNIAINNLIHTFCKNNLNEVSFIQIIKCFAKTLINKQGQIVLESCAFKQKWQNIVEQ
FT                   KYPFSTIHKNLKIVNSDFFDAFFVILLLICHLNNNLLWLCEKTEHFEWKLNSKISNFKE
FT                   DNTEVYLSKMLLFLKDWYFENQAVTNEDIEKVDEVEDIGKLVEKYSANQPQKLSSNSTV
FT                   YVFEPDKKQCFLKNDDFFNTNEAKLLFLITMQPNVFGLDDTAIANDLNLREIGDFFKEI
FT                   DFTDSDVLNDFQQQKETLLVRRTFNQLLFMNSNTDVLSIVNNKFKSAIHNIVWTITYSK
FT                   AIMLKAFDYSKIFEQNRTNDPSLLRSNLNSINRLRYLSEYFRTASVKYDQLYTKVKEYM
FT                   QLDQFLVDMINQVNHEDEIFGKYKERVYLSLGIVTAVVFGIIEFFNCVWTVLTVSQQTA
FT                   EKSLADPRNTVIIGIGTILVLTLLITILTFMTRRLYLFEFNKKHK"
FT   gene            399729..401564
FT                   /locus_tag="MPNE_0392"
FT   CDS_pept        399729..401564
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87123"
FT                   /db_xref="GOA:A0A0H3DN44"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN44"
FT                   /protein_id="ADK87123.1"
FT                   /translation="MFFESINQHPSRDFVNNILQKIKSTLSEEELEKLNTIEEVTKDEK
FT                   ILIMLNHVLKKIVSKTGSSSCDLFQIVKHDRFNEPVYIQSVNAFENNLINNEFAERRYD
FT                   YLIEINKHSYLRKYVNAIRISFFLDLRAQILSGSFTLDVINKQLEHQNKEELFQAIYLR
FT                   SLIKHFISNQPYPISLNSFIFGDKNRENKTVENDKLSVLKNNWNQIFFSKYFDFVAKNK
FT                   EERVVDNNCDELFYATMNTLLIMLIIIEELRVYFNSKEPALILKLLDNKVSLREDPDQN
FT                   PETDLHELIKFAEKNYLEKEKTSRWHKKRVKSLEELLEEIKQINLETKNESLAYPDEIV
FT                   ELELDNVHNFVSTKQVFRHQLDLQTLHGIVINPERYGIGMWSNHFVDWEEFKDLIEQIT
FT                   DAENGSDLYGFEKDLDESICQVNKKYLTFISSDSSSFLIIKNDQTKVISNYVWAQLYFE
FT                   TRRWIINDIEYDLYEKGFDKSHFASNIALLESLNFNWLDPFYGLTSIKEIMQKIDSKSN
FT                   LKTSIAEMVAKFKHEQRISKKDNERVLMIFAYVAAAVVGFINFFSMVFTILTVSDLNAG
FT                   LTPANIVVIAIASLLALFLIVIAVLFRFRWKYIKH"
FT   gene            401564..402238
FT                   /locus_tag="MPNE_0393"
FT   CDS_pept        401564..402238
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0393"
FT                   /product="RDD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87046"
FT                   /db_xref="GOA:A0A0H3DMQ9"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMQ9"
FT                   /protein_id="ADK87046.1"
FT                   /translation="MQVKVIDENSNTTAVLNCAKAKTRALAWLCDTVLLAILLAIIYGI
FT                   SSIFIKEQSSVFLIMTVSQAVLWLTYFVILPGLWKGKTLFRALLGLSLLIFKKRFWNLL
FT                   VHELFLWVWYSVIFLALAIYFFVNRDDPKILQAFFDNQNSNLSWIFVKILLSVISVLQL
FT                   VFVVYFCFSSQKQALQDLLSKSFMVQKTIKVKDCKSELKSTNTIKTHSDLPGDIDLEQL
FT                   GD"
FT   gene            402242..403831
FT                   /locus_tag="MPNE_0394"
FT   CDS_pept        402242..403831
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0394"
FT                   /product="UvrD/REP helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86808"
FT                   /db_xref="GOA:A0A0H3DK98"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK98"
FT                   /protein_id="ADK86808.1"
FT                   /translation="MEHLNQEQKAAVTCDNGVNVVYSGAGTGKTTVIAERFAYLVNEKG
FT                   VNPQSILAFTFTDKAASEMRQRIIKLIPQKSLQDLHIYTFHSFANRFLQKHGKSDFAIL
FT                   RDSNRFFSDYEMGDQLQTVVEIYKNKVVDLELDNLEYNSAFRDACTDTFNEDFSTISNG
FT                   QFRKRAATALRAYQNYLITNNLFDFSDLIIETCHLLKGNSELLQAFTESVHYILVDEFQ
FT                   DTNLAQYELVKLLATTHPNLFLVGDSNQMIYGWRGAVVEIFELLKNDFQTVKEFYTTQN
FT                   YRSSQAVLAVANDVLTAIARKERKALVLLHSSIDSKAVPVHYKANSLKNQDQWIIYQMK
FT                   QLHLNNGVPYDQMAVLFRKNKHLDAFSQTVLEDGDLPLAKLNLLTIHAAKGLEFEAVFV
FT                   YGLVERAFPSLHWDGSDKHKLLEEMKLFYVAITRAKQFLFLVSVSVESFNAYYEPSRFL
FT                   KLIEKEHLQTQKAAYFKEQLKTQPKPVNLYTETENAENLQKATDSKKWIILGAILLIIV
FT                   IITAVLKLFVEN"
FT   gene            403893..406040
FT                   /locus_tag="MPNE_0395"
FT   CDS_pept        403893..406040
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0395"
FT                   /product="UvrD/REP helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87173"
FT                   /db_xref="GOA:A0A0H3DN99"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN99"
FT                   /protein_id="ADK87173.1"
FT                   /translation="MAFNISTQLNKEQRAAVTCGKGVNIVYSGAGTGKTTIISQRFAYL
FT                   FNQKRINPSNILALTYTRKAASEMKQRILELLPEKYHKDVNIYTFHSFCSRFLREEGQK
FT                   NFVIDDDLSNFLKDFLKESELKSQKVLQIIDGFKNAYFDFDTNSLKDDERLVELCEFHL
FT                   DPQERNFQLFKETAIAAFVEYEKGKQQNNKIDFADLLIKTCTLLSKDHKLLRKWSKKFQ
FT                   YILGDEFQDTNQIQYELIKMLASHHQNLFLVGDNNQMIYRWRGAVSDIIDSLKSDFKVR
FT                   PENEFYITQNYRCDQNILTVANSILGTIYAKENQPDSTKGFLFSAIKSNRLPVYFQASS
FT                   VEGQHSWIINKIKNLHKNHGIQYKDMAILFRTNRNMDSMTEALEADGSIPLKQNKGFFK
FT                   QLETFKKVLVALITRSNYDIKLALKSLRVWPNVLNKSLTVNEQVNLDKILQNLEQAIFL
FT                   DEHTRGELTEAAKVFTRLIKFVEEQQFEALLAFTFEALNTDQFVCNFIFRTLQKLQTEN
FT                   KNFTITDFINELRFQQDELKQSKDNVINLITVHSAKGLEFEAVFIYGINQDNFPLKSKN
FT                   QIIDLQRELDELRLFYVALTRAKKYLFLLSVYQMSGEIIYPSKFIRFINKEDRLEIATI
FT                   NHKVHQDDEFFDSSKTEDYQKKYLTENTDFVNGDSVSHRTYGKGVVVEVREDAVCVAFK
FT                   NSKYGQRWIVKNHRDLVKAVY"
FT   gene            406181..407812
FT                   /gene="hsdM"
FT                   /locus_tag="MPNE_0396"
FT   CDS_pept        406181..407812
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="hsdM"
FT                   /locus_tag="MPNE_0396"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /EC_number="2.1.1.72"
FT                   /note="identified by match to protein family HMM PF02384;
FT                   match to protein family HMM TIGR00497"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86709"
FT                   /db_xref="GOA:A0A0H3DLQ8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLQ8"
FT                   /protein_id="ADK86709.1"
FT                   /translation="MEKKRTEQRNGVEKKIWEIADKLRGTIDGWDFKSYVLIGLFYRFL
FT                   SENLCKYFNDSERRNNPDFSYENLTDDYEAIDALKDAAIASKGFFIKPSQLFQNVVKSI
FT                   RENKNNEDLNTTLRDIFDDIEKSTELGDGRSKESFKGLFKDFNVSEVKLGSTLTIRTEK
FT                   LKELLTSIDTMELDEFEKNSIDAFGDAYEFLISMYAQNAGKSGGEFFTPQDVSELLARI
FT                   AIGKKDTVDDVYDMACGSGSLLLQVIKVLGKEKTSLVSYYGQEINHTTYNLCRMNMILH
FT                   NIDYANFNIINADTLTTKEWEKHYVNCSNENGFEVVVSNPPYSISWAGDKKSNLVSDVR
FT                   FKDAGTLAPNSKADLAFVLHALYVLGQEGTAAIVCFPGILYREGKEQTIRKYLVDQNFV
FT                   DAVIQLPSNLFSTTSIATSILVLKKNRDKKDPIFFIDGSNEFVREKKNNRLSPKNIEKI
FT                   VDCFNSKKEEANFAKAVERDKIRESNYDLTVGKYVNSEAEKEELDIKVLNHSIDEIVDK
FT                   QKDLRTKIKDIIQDIKVDFDNIDINN"
FT   gene            407882..409003
FT                   /locus_tag="MPNE_0397"
FT   CDS_pept        407882..409003
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0397"
FT                   /product="type I restriction modification DNA specificity
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87151"
FT                   /db_xref="GOA:A0A0H3DLI9"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLI9"
FT                   /protein_id="ADK87151.1"
FT                   /translation="MQIKTYKIKDICEISRGKAITKKYIKDNPGQYPVYSSTTANNGEI
FT                   GRIKDYDLDGEYVTWTTDGIYAGTVFYRNEKFNASQHCGVLKLKNNEISAKFLTYALGM
FT                   EAPKFVNNACPIPNLNLSRTEEIELDFPPLQIQQKIATILDTFTELSAELRERKKQYAF
FT                   YRDYLLNQENIRKIYGANIPFETFQVKDICEIRRGRAITKAYIRNNPGENPVYSAATTN
FT                   DGELGRIKDCDFDGEYITWTTNGYAGVVFYRNGKFNASQDCGVLKVKNKKICTKFLSFL
FT                   LKIEAPKFVHNLASRPKLSQKVMAEIELSFPPLEIQEKIADILFAFEKLCNDLVEGIPA
FT                   EIELRKKQLDYYQNFLFNWVQEQKKNSLSTNLN"
FT   gene            409226..409876
FT                   /locus_tag="MPNE_0398"
FT   CDS_pept        409226..409876
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87184"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPS3"
FT                   /protein_id="ADK87184.1"
FT                   /translation="MPKIISKREFNILRKTKEEIFSQIVYTKKRNGLHKAAKEYYFKDK
FT                   DFTIIEDQQDRPDKPEELDTPDIPKPPKPPKGPDQPEEPGQPGGPDDPNSGNKKMPKPD
FT                   EFVTHRQLQEFKKDLLVELHEIFPTKPELKRVEEKVDVLFELQKAQGEQIRIQGEQIKE
FT                   LKVEQKAQGETLQLILQTLQKMNDRLDKIEGKMDKMESRMDKMETRLDKLESK"
FT   gene            410118..411440
FT                   /locus_tag="MPNE_0399"
FT   CDS_pept        410118..411440
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0399"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /note="identified by match to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87010"
FT                   /db_xref="GOA:A0A0H3DL89"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL89"
FT                   /protein_id="ADK87010.1"
FT                   /translation="MEKLDFLKIKKDWTVPVEYQPSDQKIEWQSSRKIVQNLKNKLLSL
FT                   GYEDISKGFDEIPKFLEKNLRNQLSLLNDFQFSDREWSDFLNNFIFQLGDGKKGRIEKI
FT                   QKGELYELKDENDRIIKNVRLVNKRELSKNKLQFICQDERNEVIIFINGLPFVLISIFE
FT                   FNSPLQSSFQAWKIINSLIDDEKFKKFSDYLHLFVWTNAKETRYCSITTWDNLKEKRKS
FT                   VRGLSNSSFKSLMRWSDSENNKIDYIEDFATHFLNKNALLNVICKFCVFRSNSDLWVMR
FT                   PYQICATERILEKIKEDNRNSKNSKNASKGGCIWHSTGSGKTLTSFKAVQLASEIDFVD
FT                   KVLFVVDRKDLDNQTIEEYEKFQAGSVSETENTNDLKEKILDDSTATRAIVTTIHKLKR
FT                   LIDQRSKLKDEDLKKKNIVLIFDECHRSQFGKMKQEIDEFF"
FT   gene            411570..411917
FT                   /pseudo
FT                   /locus_tag="MPNE_0400"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            412124..413254
FT                   /locus_tag="MPNE_0401"
FT   CDS_pept        412124..413254
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86816"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM53"
FT                   /protein_id="ADK86816.1"
FT                   /translation="MFLTGFDAPTLNTLWVDKNLSEHTLIQAFSRTNRCFGETKKFGNI
FT                   FSFRDIRENFDQALKMYADKRGLKDIRSNMVMREFEEVFEKFKDWTEKIKQKYPNPDEI
FT                   LNLEKEEKWDFSDLFGEFLGDYRTVKSYHEFDKDNPYLPSDEFNKYFAAFSQIQEEIRK
FT                   EKAEKKALEVQEEDLSNEVRKEPQIFSWEYGEGIQANLDYIFHLIKDLYNCDNEQDRQK
FT                   VLDKIKTAIRTNPEIQVNEDILNEFIEDLGKSFEKEKLEEVWKTEGKLRECLKDFCKKK
FT                   EESNKKKIINDFLVKGVFLVEWVADKQLNTAKKKGEYSPSWSDTEKLIWKEKSTNLPTM
FT                   TEKDEDGNFKWRKLITDISEAFKNHFERFIRFVEIR"
FT   gene            413300..413434
FT                   /locus_tag="MPNE_0402"
FT   CDS_pept        413300..413434
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0402"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKW5"
FT                   /protein_id="ADK86874.1"
FT                   /translation="MEKKNKKNTATVPTKEQLDGMFKSLEKEENYDVFVQVIKALGKM"
FT   gene            413437..414171
FT                   /locus_tag="MPNE_0403"
FT   CDS_pept        413437..414171
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0403"
FT                   /product="death-on-curing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL54"
FT                   /protein_id="ADK87115.1"
FT                   /translation="MREINVYYLSNDSKSDKDDIDYLIEELLVEGSRFKNSLVTFLEKE
FT                   KDCQSCICLFKSKLSSSFEIRVKFNELNLDASDEKTKEFLRYIVSKSINNAKFLSSEDF
FT                   DDKKEDEILSIIENTFNSYCYKSDLLSPSLYCKEGRLNIIDLINDIFCKVLTFHKLSNG
FT                   NKRLATALLVNFLYTFGYYFKWTIPLKKEEYFKYAHMIKNFVVSFEEHKRENRDEFLAK
FT                   QTKKFIMDNILLALNFWETKLN"
FT   gene            414209..414703
FT                   /locus_tag="MPNE_0404"
FT   CDS_pept        414209..414703
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0404"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /note="identified by match to protein family HMM PF01812;
FT                   match to protein family HMM TIGR02727"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87026"
FT                   /db_xref="GOA:A0A0H3DMN6"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMN6"
FT                   /protein_id="ADK87026.1"
FT                   /translation="MDKNALRKQILQKRMALSTIEKSHLDQKINQKLVAFLTPKPCIKT
FT                   IALYEPIKNEVTFVDFFFEFLKINQIRAVYPKVISDTEIIFIDQETNTFEPNQIDCFLI
FT                   PLVGFNKDNYRLGFGKGYYDRYLMQLTRQQPKIGIAYSFQKGDFLADPWDVQLDLIIND
FT                   E"
FT   gene            414693..415538
FT                   /locus_tag="MPNE_0406"
FT   CDS_pept        414693..415538
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0406"
FT                   /product="putative metallophosphoesterase"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00282"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87260"
FT                   /db_xref="GOA:A0A0H3DLJ2"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLJ2"
FT                   /protein_id="ADK87260.1"
FT                   /translation="MMNSIKFIFLGDVYGKAGRNIIKNNLAQLKSKYQADLVIVNAENT
FT                   THGKGLSLKHYEFLKEAGVNYITMGNHTWFQKLDLAVVINKKDLVRPLNLDTSFAFHNL
FT                   GQGSLVFEFNKAKIRITNLLGTSVPLPFKTTNPFKVLKELILKRDCDLHIVDFHAETTS
FT                   EKNAFCMAFDGYVTTIFGTHTHVPSADLRITPKGSAYITDVGMCGPGFGSVIGANPEQS
FT                   IRLFCAGSREHFEVSKCGAQLNGVFFEVDVNTKKVIKTEAIRIVEDDPRYLKQDYFNLI
FT                   "
FT   gene            complement(415530..416249)
FT                   /gene="plsY"
FT                   /locus_tag="MPNE_0405"
FT   CDS_pept        complement(415530..416249)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="plsY"
FT                   /locus_tag="MPNE_0405"
FT                   /product="acyl-phosphate glycerol 3-phosphate
FT                   acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF02660;
FT                   match to protein family HMM TIGR00023"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87252"
FT                   /db_xref="GOA:A0A0H3DNH2"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNH2"
FT                   /protein_id="ADK87252.1"
FT                   /translation="MNAASAIALLIVFSLVIGYLMGSVMFADVFGKILNKDVRKLGSKN
FT                   PGATNSIRVFGLKIGFLVGLCDALKGFLAFVFSFLIFSFWLQQYLNVNQYQKVYYLTYL
FT                   SCFAATIGHIFPLYFKFKGGKAIATTGGSLLAISLWWFVICLVLWLLVTLITKYVSLAS
FT                   LVTFFILAIIILVPWLDYLYFFKPNPINAISYQNDWYIILFFVLWYWPLTIAVFWLHRK
FT                   NIHRLLNKTENKVTQLN"
FT   gene            complement(416236..416895)
FT                   /locus_tag="MPNE_0407"
FT   CDS_pept        complement(416236..416895)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04816"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87222"
FT                   /db_xref="GOA:A0A0H3DND1"
FT                   /db_xref="InterPro:IPR006901"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DND1"
FT                   /protein_id="ADK87222.1"
FT                   /translation="MKRRISTIANLVLQQKPKAFYDIGCGHGYLARELVQQNPSLVGVN
FT                   SDISANALGAAKGLLKDHTNMHFITSDGFDLLPNLNLDPAVGVIAGLGGLKIMQILAQH
FT                   NNFLKHFVLQPQSNIIELRRFLSANQWTITTETLVEERGFIYLVLAVDKTKAQTQYLTE
FT                   EQMILGPHLVNFTDKQMLVKYYNGLLKNFTARLNPSQFDSQVIHVLNKIIKAYERS"
FT   gene            complement(416879..418378)
FT                   /gene="rpoD"
FT                   /locus_tag="MPNE_0408"
FT   CDS_pept        complement(416879..418378)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpoD"
FT                   /locus_tag="MPNE_0408"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /note="identified by match to protein family HMM PF04539;
FT                   match to protein family HMM PF04542; match to protein
FT                   family HMM TIGR02393; match to protein family HMM
FT                   TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86862"
FT                   /db_xref="GOA:A0A0H3DNT0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNT0"
FT                   /protein_id="ADK86862.1"
FT                   /translation="MSSPKKNFKKPQPKTENQKQALNEERIAELKKSRILGKNRPFKKM
FT                   IYVDTKAQRKQKHENVAFLKTLQENKESDVPKKRRGRKPKHAPLKEKNNLKLFDILEGS
FT                   LKSHTENDDTNKVISLLVEVWEKKNKKKDNNSLSNKDIVNVLSKFELPDDEIIFVLDEL
FT                   RDKGIELPHDVEEHIHEFRANQDLSIIDEDIEELTTKNISNRDKVDDNVRFFLGSLDSS
FT                   KMLDFESEQRIAKVLNSTDEESRKYAINQLVTSNLRLVVSIAKKHLERGLDFNDLIQEG
FT                   NLGLLKAISKFNWSLGNKFSTYATWWIKQAITRAIADQARTVRIPVHMVETINRLAKAE
FT                   RALNQELGREPTAEELAEKMGGQAEGFTVKKIAEIKRLSLDPVSLDKTVGHDEESQFGD
FT                   FVRDTDAQMPDEFTESRSNYEKIDELLNNCLSEQEELIVRMRIGMPPYNETKTLDEVSQ
FT                   KIKIPREKIRQIETKAIRKLRQAVRNNHMSLSFMRGNEKKD"
FT   gene            complement(418431..420293)
FT                   /gene="dnaG"
FT                   /locus_tag="MPNE_0409"
FT   CDS_pept        complement(418431..420293)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dnaG"
FT                   /locus_tag="MPNE_0409"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF01807; match to protein
FT                   family HMM PF08275; match to protein family HMM TIGR01391"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86764"
FT                   /db_xref="GOA:A0A0H3DKK0"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKK0"
FT                   /protein_id="ADK86764.1"
FT                   /translation="MTSPTSLDQLKQQIKIAPIVEHYAIKLKKKGKDFVALCPFHADQN
FT                   PSMTVSVAKNIFKCFSCQVGGNGIAFIQKIDQVDWKTALNKALSILNLDSQYAVNFHLK
FT                   EVDPKLKRYWDLHSALVDYYQTRLKLEPKEQGLTYLTETRKLSPQVIERFQLGLAFTLE
FT                   DQYFLPSLLNYPWISPAIEKAELCFATEKFPEALGFFNQQTHYATFKSRIMIPIHDLKG
FT                   NPVGFSGRALQKTEKIKYKNSAEHQWFKKSELLFNFHRIDKNTLKLYLVEGYFDVFALT
FT                   SAGIGDVVGLMGLALSESHIIAFQQQLKALETVVLALDNDTAGHDATFKLLQELNAHGI
FT                   IVEVVDWNQAAYKDWDELFLAEGSDAVKAKTHRVLNLVEYLVAYFKTKGFDERITVNKV
FT                   IDIIAQNQKVTADTSFSRFLCQKLQQLLQYSDVETLFTQLQQQKLKVKVNKTTTFTQRA
FT                   PIYESVVGVVDNSFRNESQPVAITKEFLVENNWKETKERVFHAEIFAYVLLDKQFLVEL
FT                   KQSDLDELFASLQTPLFDVALFIDKARLYWAKVQEPDWAVFNSILGEQQAMFPTTFLAQ
FT                   IKEFFLNKSLSYDPEDYEEDLQFFRQLIVKQKELLKYFKSMVEH"
FT   gene            complement(420277..421626)
FT                   /gene="glyS"
FT                   /locus_tag="MPNE_0410"
FT   CDS_pept        complement(420277..421626)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="glyS"
FT                   /locus_tag="MPNE_0410"
FT                   /product="glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM TIGR00389"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87020"
FT                   /db_xref="GOA:A0A0H3DL97"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL97"
FT                   /protein_id="ADK87020.1"
FT                   /translation="MAQVYSQEVYVQYLKRYGFVFQSSELYNGLANSWDFGPLGAVLKQ
FT                   QIKTALYNFFIKNKRDVLLIDTPIILNEQIWKASGHLANFTDALVDCKSCKLRFRVDHL
FT                   DEQIKSATQWNPKQVNCPNCKANNWSEVRDFNLLFQTEIGVVNSEKRLVYLRPETAQGI
FT                   FINFKQLLQLKKRPLPFGVAQFGKSFRNEVTPGNFLFRVREFEQFEMEWFCNPQASLSV
FT                   FESQQQAIAHFLFKVLQLNPALVKQYEYDKNELAHYANKTVDFLFQFPHGLRELWGLAD
FT                   RGTFDLEQHQKYAKKPLDFFDGENNEHFIPAVVEPSVGIERLFYALIVSSYQQEQLEGE
FT                   MREVLRLPFHLCPEQIVVLPLVNKLKETAQTLFEALSQTHWRIGFESAGSIGKRYRKAD
FT                   AIGTKFAITFDFESLEDQAVTIRERDSLKQVRVPIKELKAWFAQHDDQSH"
FT   gene            complement(421648..422367)
FT                   /locus_tag="MPNE_0411"
FT   CDS_pept        complement(421648..422367)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0411"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032; match to protein
FT                   family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87112"
FT                   /db_xref="GOA:A0A0H3DN00"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN00"
FT                   /protein_id="ADK87112.1"
FT                   /translation="MQETSFLFGSKAFLEALDNQLQIKKVNLSDKHQKLLGLIKKRGLR
FT                   YEMHSSQWFHQQFRHINHQEFVCVINPNQMLKTIEQLIQITDSKSTSTLVMLDEIQDLH
FT                   NFGAILRTCMAAEVDGIIFKKHNQAPINSTVIRTSMGTVFYQNLVQVTNLSYAITTLQK
FT                   HGFWTVATTLDERLKPKDYRQVDFDKRILLVGNEDKGLNALLLKNADLKVKIPMNPKLN
FT                   SLNVSVAVGIILFGWKS"
FT   gene            complement(422379..423692)
FT                   /gene="cysS"
FT                   /locus_tag="MPNE_0412"
FT   CDS_pept        complement(422379..423692)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="cysS"
FT                   /locus_tag="MPNE_0412"
FT                   /product="cysteine--tRNA ligase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86838"
FT                   /db_xref="GOA:A0A0H3DKC9"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKC9"
FT                   /protein_id="ADK86838.1"
FT                   /translation="MNQFEPKFTLIDTVSNQSVVLEQKQINIYLCGPTVYNDLHLGNTR
FT                   PLIVFDVLQRVLQAAQYKVQFVQNITDIDDKIIKIAQQQEISEAQLCKQQITAYKSLLK
FT                   KLNILPIKHLQVTDKIDKMPGYIARLVQMGFAYVSPLGNTYFSVSQLPQYGILANRVVE
FT                   TIEDEATDKRNKLDFVLWKQTTAGVKWNSPWGWGRPGWHVECAFLIDYSFKDQLTIHGG
FT                   GVDLKFPHHENENAMHMALYDKPLTQHWMHIGHLMFENQKMSKSLQNFLLAVDFLTIHD
FT                   FRILRWLFYQKHYYHPLDLSQSLIEQACSDIKRIQKAVNVCRTWFVYSEQSAIPAPKQF
FT                   EPVFKALLNNLNFANAITHIWKLVKQINHDVSKQNLSGLKEHLSHLEWALNILGIGFKS
FT                   IHTKLNVQLIKKWASLRKNGQLDKADEVRQKLIKKGLL"
FT   gene            complement(423673..425649)
FT                   /gene="ligA"
FT                   /locus_tag="MPNE_0413"
FT   CDS_pept        complement(423673..425649)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ligA"
FT                   /locus_tag="MPNE_0413"
FT                   /product="DNA ligase (NAD(+))"
FT                   /EC_number="6.5.1.2"
FT                   /note="identified by match to protein family HMM PF01653;
FT                   match to protein family HMM PF03119; match to protein
FT                   family HMM PF03120; match to protein family HMM TIGR00575"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87023"
FT                   /db_xref="GOA:A0A0H3DP81"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP81"
FT                   /protein_id="ADK87023.1"
FT                   /translation="MAKVAQIRAIVEQLKRYDYHYYVLDDPLVSDFEYDQLYKQLQALE
FT                   QAHPELIQPDSPTQRVGGIVVEAFNKFPHQNPMLSLDNAFDTATIASFIANINNLTGVQ
FT                   NRFVVEPKIDGVSISLTYENGLLTRALTRGDGLVGEDVLSNVKTIKSIPLTIPFHKQVE
FT                   IRGEIFVDKKTFAQINENLAKPFANARNLAAGTLRNLNSEVSAKRKLKAFFYFVPNALT
FT                   LGCRSQSAVLAQLKQWNFPVSKAVASFDRPEALIEYLDQFDQTRDQLNFQVDGLVVKLD
FT                   NFHFYDQLGFTSKFPRWALAYKFKPKFVQTKLRGVLVTVGRTGKINYTAQLDPVNLEGT
FT                   VVSAATLHNFDYIKEKDIRLNDTVIIYKAGEIIPKVLEVCLPLRTAANQPIPEQTHCPA
FT                   CQAPLVQYKDEVDQYCTNERCDQRNLEAINYFVSKTAMDIQGLSIQTISKLYENNLVRS
FT                   VVDLYHLKEHKAAVLALELKIGEVLFNKLISSIEQSKTKGMARLLTGLGIKHVGQVLAK
FT                   SLTKHFENIDALQSASMETLLELPDVGPTVAESLFNWFHNDNNLQLLAALKAVGVQMDA
FT                   LKSNTNFDTASIYFQKSFVITGSFPISRDTIKNLLANKYDCRFTNNVTSKVDFVLAGIK
FT                   ATPRKLEQAKALNIPIINEPIWT"
FT   gene            complement(425713..425786)
FT                   /locus_tag="MPNE_0414"
FT   tRNA            complement(425713..425786)
FT                   /locus_tag="MPNE_0414"
FT                   /product="tRNA-Gly"
FT   gene            425817..427421
FT                   /locus_tag="MPNE_0415"
FT   CDS_pept        425817..427421
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0415"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87172"
FT                   /db_xref="GOA:A0A0H3DN75"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN75"
FT                   /protein_id="ADK87172.1"
FT                   /translation="METQNQIETLRYIFNQLNNQDKPQIIWFSGEGEDEKINFLIRLDN
FT                   YFQPTFVQDLTINFLPAFVKRNKKNPPNTLAKGNFVNIANKLLAVLARSLSWKQLNKPQ
FT                   QKWLLWLLVPFLLLRQLWLKKKVSKIFQFVNERGILSFIKEQWPILTTLVTVGTTLGTP
FT                   IFSITISQQKAILENAGHGAFVFLVIFSVFAIALGLVSSLIFLVSSLFSIRQKKSLQQL
FT                   HQILSRLINKYFCLANSEQNQTGRYQLKNTGVCFFYGFDFEEKEYITQAMNLLLLLKQT
FT                   NCFVLVGCKESNMLLIKNKVEPDINLKQSSLYLDLKSQISPLAQISKYNLLFEELALDA
FT                   DMFYLEDFFALLKTPRQIVNFLFRIKQNLKEFHQPQTLWFDYLALWALVIATDFEFNNV
FT                   LWSFNDYLSLTNKQKEDYASVNLTAFFNRSLKNHKDNSLLFKPELFNTHAYIPETYTQV
FT                   TLENIDSDKRAQLVALNWFSQQKFSDFIEEKINFWQTQQAENKVFYLTLGERIFFLVLV
FT                   NKKFKQIKLEAALKYLN"
FT   gene            427422..427496
FT                   /locus_tag="MPNE_0416"
FT   tRNA            427422..427496
FT                   /locus_tag="MPNE_0416"
FT                   /product="tRNA-Arg"
FT   gene            427570..427643
FT                   /locus_tag="MPNE_0417"
FT   tRNA            427570..427643
FT                   /locus_tag="MPNE_0417"
FT                   /product="tRNA-Trp"
FT   gene            427651..428427
FT                   /locus_tag="MPNE_0418"
FT   CDS_pept        427651..428427
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87138"
FT                   /db_xref="GOA:A0A0H3DN58"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN58"
FT                   /protein_id="ADK87138.1"
FT                   /translation="MHYSYSFKEYIERFAKKVNSIDSEYFEFSSYIERMRTVFGLLIAL
FT                   ICFSNVLCFLFIATWFSTKGFGQHYRALIFTLFIPFVTSLLANIIFINLNRAFREYFKI
FT                   SSKSRSFLVICAFSSLPIVNIWLMLWWVAMIKRFTSNYAFAIFDKYNGLTSGVFIFDFA
FT                   DNVNFEGKLVSFDNTKDTNRDFVHFYSEAKLKRDKITLQTNPIPHERMYVNRMYYQQKL
FT                   SMGANQNSPSTAFANLKRYVEHKQQKIIKIKQFILT"
FT   gene            428472..428765
FT                   /gene="rpmE"
FT                   /locus_tag="MPNE_0419"
FT   CDS_pept        428472..428765
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmE"
FT                   /locus_tag="MPNE_0419"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by match to protein family HMM PF01197;
FT                   match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86703"
FT                   /db_xref="GOA:A0A0H3DKC8"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKC8"
FT                   /protein_id="ADK86703.1"
FT                   /translation="MKKDFHFPSQSVSFKCASCSNSFTIESTLKQKEITIDICGKCHPF
FT                   YIGELTKQTVHGRAEKLSGKFNAGKAFLENKTPKKAKGKTEEYTKHRSLNEL"
FT   gene            428766..429845
FT                   /gene="prfA"
FT                   /locus_tag="MPNE_0420"
FT   CDS_pept        428766..429845
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="prfA"
FT                   /locus_tag="MPNE_0420"
FT                   /product="peptide chain release factor 1"
FT                   /note="identified by match to protein family HMM PF00472;
FT                   match to protein family HMM PF03462; match to protein
FT                   family HMM TIGR00019"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86893"
FT                   /db_xref="GOA:A0A0H3DKH7"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKH7"
FT                   /protein_id="ADK86893.1"
FT                   /translation="MEFDKQFFSSVEKIVELAEQLEKDLNKPDLTFEQIKAINKELKHK
FT                   QPLVVKFKEFKRLIDQALEAEAILENNELKELHDEAKKELERVRSVVPEYEEALKLLLL
FT                   PIDENNQKNVIVELRPAAGGDESCIFLADLFNMYRNFCTNKGWKLQINEMIPSSVGLNF
FT                   VSFEVNGVDVFAKLKFESGVHRVQRVPATESKGRVHTSTVTVAVLPQLEAVEVHINPAD
FT                   LRVDTYRASGAGGQHVNRTESAVRITHLPTGIVVSCQEGKSQFTNRDTAMKMLRAKLWE
FT                   KAQNEQLSTQAGLRKSQVGSGDRAEKIRTYNYPQNRVTDHRIKLTVNKLNTIILGDLDE
FT                   IIEALQADEKKQQLENFFS"
FT   gene            429845..431206
FT                   /locus_tag="MPNE_0421"
FT   CDS_pept        429845..431206
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0421"
FT                   /product="methyltransferase, HemK family"
FT                   /note="identified by match to protein family HMM PF01170;
FT                   match to protein family HMM PF05175; match to protein
FT                   family HMM TIGR00536"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87235"
FT                   /db_xref="GOA:A0A0H3DLI1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLI1"
FT                   /protein_id="ADK87235.1"
FT                   /translation="MNLYELFLNQKLLYGTDPHFNGVFLTLLEKFGLHFKDLTALWKHA
FT                   KTITDFDEQGIVNALKAYFVDQLPLPYITGSVKLGSLTFKTQPGVFIPRADSLALLKVV
FT                   KAQNLKTAVDLCCGSGTLAIALKKRFPHLNVYGSDLNPQALQLAAQNARLNMVEVQWIE
FT                   ADFLAALAQVNTPIDLIITNPPYLNESQLDQTLNHEPRNSLVADGNGILFYQKLYNFLL
FT                   GNRQVKQVILECSPTQKKEFLALFSIFKTSEIYTSHKQFIGLSIDNTKLPVLKIAQTKQ
FT                   IKALLDKGMTAIIPTDTQIGLMSYCQQDLDHIKQRDPNKHYVQFLAPSQINQLPKQLQK
FT                   LAKLFWPGAYTFIVDGQSYRLPNSPQLLKLLKTVGLIYCTSANQAKQKPFGKLSAYQND
FT                   PYWVQQNCFIVQNSFKSNNEPSLIYNLDTKQIVRGSSTQLQRFQALLAKHKLRH"
FT   gene            431337..433718
FT                   /locus_tag="MPNE_0422"
FT   CDS_pept        431337..433718
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03202;
FT                   match to protein family HMM PF03305"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86996"
FT                   /db_xref="InterPro:IPR004890"
FT                   /db_xref="InterPro:IPR004984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMN4"
FT                   /protein_id="ADK86996.1"
FT                   /translation="MKFKYGATLFSGFLGLSAILAACGAKGKFDQVDDGKIVLASSLTS
FT                   KNAANALQAVVEKYNQVKGGNDYPIEITQITGGYDGGRGNLQTKLSVKDKTTFYNLILN
FT                   YPDLVSTLGRVGMELPLDNVDLSKLSPNFLKFNERISGVAKKANYAIPVSLSTEVLALN
FT                   GPVLHYILNSAKGGNETAVTQRTASTNQQNTLQNSLKINESDPITKELWEKIQKAAETN
FT                   GKAKEQGKSKKQGTEKTTTLTLLKTESSQQSNTTKDGKATSDEAIKKTWGDYQKVENGL
FT                   KGYTFKASVFENWHELLDFSARIARSFTNIHTKETKKGTDIQGVLGIDSTPNALFTSVF
FT                   AAGGGNYDNFFYKVQDGRADFSNFKNKETSYQNLQKVFSDYKELIDKNGLFVNKGGSYS
FT                   SNFQKFHQLAYSISSTSGFFYSFAGNSAKRLKFDDGNFIEFPRFTQPVKAPNKTTQSGG
FT                   ENNNKSENNLLGTFEIEDKSKKRESVESSEKSSSGTQSKSKKGKSMKTIYLYKAQIPEG
FT                   KNKGDNAILITNQTVIDKLEKAAKEDGKSGTQVSTVASKSTTKENQENKIIGYTSTDNL
FT                   REDNKNIFDIDDLNDEKYDRKIIVSATEEVLEQSNTLQSEEAVVLPALAKYKASDSTKI
FT                   AITQEPNLIGIHANEKENEETRKFVNWFLNSEQTWESKKYSKNKQNSNEKRTPAQFFAD
FT                   SASYILPLKKTFDNANKKEDQSKANNKTNSQRTNTYIEKALEIFKGISQNQITSYSDPS
FT                   DFRSGRFRDGIGSNFNAVVNSKVDFNKFINNFIASLGFDI"
FT   gene            433756..434703
FT                   /locus_tag="MPNE_0423"
FT   CDS_pept        433756..434703
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0423"
FT                   /product="type I restriction modification DNA specificity
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86725"
FT                   /db_xref="GOA:A0A0H3DLS2"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLS2"
FT                   /protein_id="ADK86725.1"
FT                   /translation="MEIKTYKIKDICEISRGKAITKEYIRANPGEYPVYSGSTLNDGEI
FT                   GRIDECEFDGEYVTWTIDGYAGIVFYRNERFNASQHCGVLKVKSNEICPKFLAYALGME
FT                   APKHVNNACVIPNLTLKKMREIELDFPSKKIQEKIATILDTFTELSAELRERKKQYAFY
FT                   RDYLLNQENIRKIYGANIPFETFQVKDICEIRRGRAITKAYIRNNPGENPVYSAATTND
FT                   GELGRIKDCDFDGEYITWTTNGYAGVVFYRNGKFNASQDCGVLKFKNKKICTKFLSFLL
FT                   KIEAPKFVHNLASRPKLSQKVMAEIELSFPPLEI"
FT   gene            434969..435769
FT                   /pseudo
FT                   /locus_tag="MPNE_0424"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            435778..436842
FT                   /pseudo
FT                   /gene="mgpC_5"
FT                   /locus_tag="MPNE_0425"
FT                   /note="MgpC protein; this gene contains a frame shift which
FT                   may be the result of a sequencing error; identified by
FT                   match to protein family HMM PF05220"
FT   gene            437358..437900
FT                   /locus_tag="MPNE_0426"
FT   CDS_pept        437358..437900
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87244"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ11"
FT                   /protein_id="ADK87244.1"
FT                   /translation="MKEKIPFYNEKEFHYMMKKTKKGTFSGWYIINPENNSVEFSGSFN
FT                   RQFKLNKPVIPVNTEYVTRKEFNEYKDSNDQRLTKIENKIDKLEIKVDKLKKKVDKLEV
FT                   KVDKLVETVNAQGEDLNNFKVEVRGTLQSQGETLQLILQTLQDMSKRLDSVEGRLDSMD
FT                   GRLDSMETRLDKIDPLK"
FT   gene            complement(438032..438793)
FT                   /locus_tag="MPNE_0427"
FT   CDS_pept        complement(438032..438793)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00938"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87178"
FT                   /db_xref="InterPro:IPR001595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNA8"
FT                   /protein_id="ADK87178.1"
FT                   /translation="MRKKKFLSKVSFGSLFLLCGTVLSACTGIQADLRNLIKEATGKDI
FT                   DVYKAIKTTEGKKNMITSLKKSYKVNPKDTTKLLLDAWKQSAEKSELGIPDFDFDDVIY
FT                   PASKDPFTMERKIEYFQMTYQSFKDLSIEAKLSYTFNWFGDYSSGDFTAKKGDKHYFDL
FT                   FLKIKSNSDPGKQFTTEKFLTKEEKIKVNGKEITRNLEWIEFSASLSFSLKGKDDVSEK
FT                   SVNKFLSTFANNTEGYSSDINLFIYLEYLIK"
FT   gene            439072..439188
FT                   /locus_tag="MPNE_0428"
FT   CDS_pept        439072..439188
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0428"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86830"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM34"
FT                   /protein_id="ADK86830.1"
FT                   /translation="MQIFNFLNWSAKRLIPVGNRVASVSYFLKNQKKKERNI"
FT   gene            439440..440234
FT                   /pseudo
FT                   /locus_tag="MPNE_0429"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF03257"
FT   gene            440285..441235
FT                   /pseudo
FT                   /locus_tag="MPNE_0430"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            441309..441653
FT                   /pseudo
FT                   /locus_tag="MPNE_0431"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            441626..442423
FT                   /pseudo
FT                   /locus_tag="MPNE_0432"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            442485..444260
FT                   /locus_tag="MPNE_0433"
FT   CDS_pept        442485..444260
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0433"
FT                   /product="ADP-ribosylating toxin CARDS"
FT                   /EC_number="2.4.2.-"
FT                   /note="identified by match to protein family HMM PF02917"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87256"
FT                   /db_xref="GOA:A0A0H3DLT7"
FT                   /db_xref="InterPro:IPR003898"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLT7"
FT                   /protein_id="ADK87256.1"
FT                   /translation="MPNPVRFVYRVDLRSPEEIFEHGFSTLGDVRNFFEHILSTNFGRS
FT                   YFISTSETPTAAIRFFGSWLREYVPEHPRRAYLYEIRADQHFYNARATGENLLDLMRQR
FT                   QVVFDSGDREMAQMGIRALRTSFAYQREWFTDGPIAAANVRSAWLVDAVPVEPGHAHHP
FT                   AGRVVETTRINEPEMHNPHYQELQTQANDQPWLPTPGIATPVHLSIPQAASVADVSEGT
FT                   SASLSFACPDWSPPSSNGENPLDKCIAEKIDNYNLQSLPQYASSVKELEDTPVYLRGIK
FT                   TQKTFMLQADPQNNNVFLVEVNPKQKSSFPQTIFFWDVYQRICLKDLTGAQISLSLTAF
FT                   TTQYAGQLKVHLSVSAVNAVNQKWKMTPQDSAITQFRVSSELLGQTENGLFWNTKSGGS
FT                   QHDLYVCPLKNPPSDLEELQIIVDECTTHAQFVTMRAASTFFVDVQLGWYWRGYYYTPQ
FT                   LSGWSYQMKTPDGQIFYDLKTSKIFFVQDNQNVFFLHNKLNKQTGYSWDWVEWLKHDMN
FT                   EDKDENFKWYFSRDDLTIPSVEGLNFRHIRCYADNQQLKVIISGSRWGGWYSTYDKVES
FT                   NVEDKILVKDGFDRF"
FT   gene            complement(444271..445506)
FT                   /locus_tag="MPNE_0434"
FT   CDS_pept        complement(444271..445506)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0434"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87240"
FT                   /db_xref="GOA:A0A0H3DLI4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLI4"
FT                   /protein_id="ADK87240.1"
FT                   /translation="MNGNESNGHFYVVVDVTNANNLGNQRRIANPRNYFYYLEGLDKNA
FT                   QSTYIIRFETKDKFYSLDALRFDNNGIYVDNASRDAVIQARQKSKLYFNTSDWRGKLPQ
FT                   NFFQTTTSLSTKNREIVAHFLKSNESSKRGVLSQAASGAVVGYVERLTNKKVFLKDEIK
FT                   FDVEKDGIKLDLKADFSLEQNGSLGLNDPNDVNKLAQEAQSYTVMVSDGGAQTDNNAEG
FT                   GNLRIALTKNAFNPKQSTTVDIPYKIENRSVGNNKEQKTLVFDFSGLNPYEYNMIVGAL
FT                   FTDSSFINDAYAPIQSTFQRQLKEFLQVKYENQVGANGSFDLFKPRSLSSQQLVQGERS
FT                   LDGFTVELNANGGSFNFLTHVDPLVAGLTVAAIASVVAAGAVTYLVVRRYRKRNEFVDK
FT                   IFASNIRAKQWR"
FT   gene            complement(445914..446603)
FT                   /pseudo
FT                   /locus_tag="MPNE_0435"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(446949..447338)
FT                   /locus_tag="MPNE_0436"
FT   CDS_pept        complement(446949..447338)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0436"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87141"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLI2"
FT                   /protein_id="ADK87141.1"
FT                   /translation="MSFGLVGTVNNNGWKSPFRHETKYRAGYDKFKYYKTHYRGAKKAG
FT                   TNDDRWRWTAWFDLDFAHQKIVLIERGELHRQADLKKSDPATNETSKTVWGSIKEKLLQ
FT                   NVNNLHSEKGVFLWFRQSGFTTTRN"
FT   gene            complement(447718..451140)
FT                   /locus_tag="MPNE_0437"
FT   CDS_pept        complement(447718..451140)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0437"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86992"
FT                   /db_xref="GOA:A0A0H3DP55"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP55"
FT                   /protein_id="ADK86992.1"
FT                   /translation="MKRLQYRFLLFGFALGSFGWFVASSAFTSVVKSNNETLSSDGGVH
FT                   MRYLKGKGDVLSILKSKSPAITQRFDLKWNNGKKTEVYLNNVNNYISESLYAQEALKQI
FT                   ERTAQLSIQNGELPDVKVYTNSGASFGLVGWHTDNGRTWAFRHENKYDKNVHFSWNQTY
FT                   YKYSNRERTASNPYYWKWVAWFDLGYANQRIGLVENDEYHIDKRVPEPTPRKWDKNKPL
FT                   WGDIRSKILYSAERLDPDKGIFIWFNQTGFNTKGTKGWANSGFFTDFWDTNNNPNAFTT
FT                   NITSEGGNSNWHSPDWGSHTTDTRFFLKLEPYSKLFYKENGQERLITVSDYIRKAKSTK
FT                   TNYQWVNKNQIKTLVRKTRSIDLGLGSAVRQTYTTKSDIASNQQLKYKLKDSTFSIDTY
FT                   NNFKLDKLLVPKTNEDATAIKNGVFVKQPTLSFDFNPVLTNAIVNIHNLFAQTLDLKEH
FT                   LKSDQPYNESDKAAINKVIEQIKNKEVDYIQVADFIGKLKNWSQNPGSIESKGENTAQW
FT                   YADAKKEFGLNLNDDVNTWTQLSSLIASYFSKDIFANVKLNGAKERRMKVWDGAKFEFI
FT                   PIENTEKQSEQLANENRAEIAVSAIGFQDEGGLRDASFINKVALTPKSSKTKIANGDAS
FT                   KIEKAANEISYKYHYRQNFKQASWDKQNSQTKSIVVQSTDLNDERERFQKDINNYLKVQ
FT                   GISETEIKVNAVHKVDAMLNARKSDDPKLASVQSTANKYGLNLRSNPYTGQFYVVVDVT
FT                   NANDLGNQRRANNAKSYFYYIEGLDKGAQSSYLVRFENKQKLYSLESLAVDSRGLYVKN
FT                   VSKDAIIQAKQNQNLYLDTHNWNAALKANLTNAELTLPTASADNSAKLSTPNAENDEGF
FT                   LSENVSGSILGYVERMTGKKLFLKERVSFNKEDKNNLKLRLTSNFTLDKKGNLEVKDPS
FT                   VINQIVEEAKGYNVLVSEEKGDDPESDKNIFKITLTTNPEQSTVIKLPYWIVTKKSKTN
FT                   KDGTVREQKNLVFDFSNLNNFEYNTVVSLLFTDSSFIKNAYAPLQTEFRKQLKTVLEHK
FT                   YQAPIKTGQLPLLTKVQLANNQKQIDNFTFDLHKNIFNKEDINKINWPLIAITFTGSAA
FT                   LLSTIIASGVVLHRWRKSRKHFWEQMLKARKVK"
FT   gene            complement(451404..451480)
FT                   /locus_tag="MPNE_0438"
FT   tRNA            complement(451404..451480)
FT                   /locus_tag="MPNE_0438"
FT                   /product="tRNA-Arg"
FT   gene            451566..451790
FT                   /locus_tag="MPNE_0439"
FT   CDS_pept        451566..451790
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87075"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLE9"
FT                   /protein_id="ADK87075.1"
FT                   /translation="MSKDKKNKVEQLEPVDLFERTKLEDTQVLNDVELDDIKKLEELKK
FT                   ELENTFDPRTRIEIKREIKELERKLRRNR"
FT   gene            451794..454412
FT                   /locus_tag="MPNE_0440"
FT   CDS_pept        451794..454412
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0440"
FT                   /product="putative DNA polymerase III, alpha subunit"
FT                   /note="identified by match to protein family HMM PF02811;
FT                   match to protein family HMM PF07733; match to protein
FT                   family HMM TIGR00594"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86787"
FT                   /db_xref="GOA:A0A0H3DNK7"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNK7"
FT                   /protein_id="ADK86787.1"
FT                   /translation="MFVNLHTNSYYNFLNSTLSPQKLVDLAVQDQQVAVCLTDPNLFGA
FT                   TEFFLACQKAHIKPLIGLSVTVRHYEQNVNLLVIAQTNRGYQNLMCLALVKDQPDLQLE
FT                   PFLDGNVVIICTQTELRLNTANPVYLAHGLSGRYPKIAVTQKPVKCQNTNKDLTLLLTL
FT                   KQISQINSEHFQPLEWKLSRSLNEIQLDPPLLQQLRHQPFLSQKAAQQIFSEEELGNLQ
FT                   KLVEQSQWDLTKLKASSLQVSHNDAQMLSEQCQLALTEFLKLNPQLNKQLYEERLAKEL
FT                   EIINSLHFAGYFLVVSDLVQFAHNNDILIGPGRGSAVGSLVAFLLKITQIDPVANNLIF
FT                   ERFISRHRQGLPDIDIDIMETKRDLVIDYVMQKYGREQCAQIVTFQKFKTRSALRDVGK
FT                   VFKHIEGAEDLLGKLPKDKSLLELDVNGVTDPVLQLSLKSFRLLWEVAREIINFPRQPS
FT                   IHASGVVIVTEPLITTIPLMVGNNNNYVTQVSMDWLEWYNLNKFDLLGLINLTMIHEVV
FT                   QAVKPKEVSVQQFLQQIPLDDEATFTNLTNQATLGVFQLESFGMKKVLKQIKPHNLHDL
FT                   AIVLALYRPGPQDNINTFIANRNLGFDTSDIDPRILPILKETYGVLIFQEQVINIAKTV
FT                   ANYSLETADSFRRAISKKNLQVIQDNMRSFYEGALANNFSLKAATTIFNYIQRFAGYGF
FT                   NLSHALGYALLSYWTAWLKTHYFEQFNLWWLNHEQGKKEKQKQLLNEFISSGYEICPPL
FT                   INKAKSDFSVQDKKLYLGFKLINGIGDKQAHALEHVQEVLKQNPNLSLIATVNLCLSKT
FT                   VGGLELKDITLLQQAGCFNCFNYTVDFNLAKSFWVQSNHELFPKIPLDQPPVINWKSFG
FT                   F"
FT   gene            454416..455291
FT                   /locus_tag="MPNE_0441"
FT   CDS_pept        454416..455291
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0441"
FT                   /product="5'-3' exonuclease, SAM domain protein"
FT                   /note="identified by match to protein family HMM PF01367;
FT                   match to protein family HMM PF02739"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86859"
FT                   /db_xref="GOA:A0A0H3DKU8"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR038969"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKU8"
FT                   /protein_id="ADK86859.1"
FT                   /translation="MKNAILIDGNSLAYRAYFATWQQVEFAKLHNLPFNNAIRTMLMMC
FT                   WNLLQSKQYDYGVISFDTKAPTFRDQLYSEYKSKRSKTPSELLVQIPVVKESLRHLGFL
FT                   VCEQDGFEADDLIGSYARLMTQNNVAVDIYSSDRDLLQLVDSMTSVWLCVKGTKEMKEY
FT                   NTDNFAEQFFGLTPKQVIEYKGLVGDNSDNLTGIKGIGPKKGIDLLKQYGTIDNIFANF
FT                   DKLSKALQTILQGQIDTAKKFSFLASIKTDIKLNDDIVHAALKPIDKQALLELLDKYGI
FT                   KALAQKFSQL"
FT   gene            455291..456124
FT                   /gene="mutM"
FT                   /locus_tag="MPNE_0442"
FT   CDS_pept        455291..456124
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="mutM"
FT                   /locus_tag="MPNE_0442"
FT                   /product="DNA-formamidopyrimidine glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="identified by match to protein family HMM PF01149;
FT                   match to protein family HMM PF06831; match to protein
FT                   family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87214"
FT                   /db_xref="GOA:A0A0H3DPV4"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPV4"
FT                   /protein_id="ADK87214.1"
FT                   /translation="MPELPEVATVITELKSCVLNKPVKQVKVHLDKVLKNTNVKQLNDA
FT                   LVNHSFVDIKRRGKYIIFCLSNGLFLVSHLRMEGKYFFEAKGSQFDLNHVLVEFLFQDG
FT                   DQLNYHDTRQFGTFHLFNRYQFENARELNKLALDPLDQEFNHQAIFNKGHKSNKKIKTF
FT                   ILDQTNISGIGNIYADEILFASKIHPETLAKNLNLSQYQLICQNATDILKKAVEMKGTT
FT                   IGTFTFKKDHTGGYQHFLKIHGKKGKQCQSCNTTIIKKKINGRGSYICEKCQIQR"
FT   gene            456270..457148
FT                   /locus_tag="MPNE_0443"
FT   CDS_pept        456270..457148
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0443"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF08282;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86665"
FT                   /db_xref="GOA:A0A0H3DLK3"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLK3"
FT                   /protein_id="ADK86665.1"
FT                   /translation="MKNKIKYVYSDLDGTIVSWNPKNQFTHQGKTYKNLHEVSHATVTA
FT                   FKQLQAQGIKIGIVTGRDYCRVRWLEKYLNTDLPTITLDGAIIYFRDEIIRQEVLDKEF
FT                   IHGINQIVKRYPTAAFKLNMGWGNYYTCNPSLIFEGDHAYREHFNADSKFYRKEIDNTV
FT                   DWDINNMKVNQVYFDTFTCPEPMIQELDNLVEKSDVTAKSYRHSLYIIKKGVSKASALQ
FT                   NLQRDFLVEMKPANTIVFGDGDNDIEMMQWADHSVSLTGSDPECYKLAKYHTDSVDDDG
FT                   IAKWINKNLLC"
FT   gene            complement(457674..458522)
FT                   /locus_tag="MPNE_0444"
FT   CDS_pept        complement(457674..458522)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0444"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87220"
FT                   /db_xref="GOA:A0A0H3DLF8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLF8"
FT                   /protein_id="ADK87220.1"
FT                   /translation="MKPKVQNLIFDLDGTLLSWGHEPLPQTVTFLKELQKQGFKITFAT
FT                   GRSHILIRNTTQFIQPDLPVISSNGALIYDFAREKALHMTQLAPQSVVPIMRLLLQLEE
FT                   SFCIYTDKKVFGFEKPGIPCKRLRTTQSKIVEPDITQNNFTINPLTDASKFDFATQNIT
FT                   KILLITEDRGRISKITKHLDAIENISYVSSMTFALDIMHKDVNKAYGLKALEQQTGLDP
FT                   QMTMVFGDGDNDVEIFNAVKYSVAMANGSDLAKQNATFISEFDNDHDGIYHFLQCFLKI
FT                   E"
FT   gene            complement(458525..460906)
FT                   /gene="leuS"
FT                   /locus_tag="MPNE_0445"
FT   CDS_pept        complement(458525..460906)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="leuS"
FT                   /locus_tag="MPNE_0445"
FT                   /product="leucine--tRNA ligase"
FT                   /EC_number="6.1.1.4"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF09334; match to protein
FT                   family HMM TIGR00396"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87121"
FT                   /db_xref="GOA:A0A0H3DLH4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLH4"
FT                   /protein_id="ADK87121.1"
FT                   /translation="MYNHNLLEEKWLQLWKTKQVNRFFDDKTKPKYYILDMFPYPSAAG
FT                   LHLGHVRAYTITDVLSRYHKAKGFNVIHPIGFDAFGLPAEQYAIASNKHPGDWTDKNIT
FT                   NFIEQLTAFGFDYDYQLSLKTTDPRYYQYTQWIFGQLFEAGLAEVKEIDVNWCAELGTV
FT                   LANEEVLIDSNGNAVSERGEFPVTKRKMKQWVLKITAFAESLLNGLAELDWHQSIKEMQ
FT                   TNWIGKSEGVEVTFDIENSKETITIFTTKVQTIFGVTFLALSTSHPLVKEVAKTNPKIA
FT                   QFLQKQAQKTTTVKQPETLHDGVDLKLKAINPATNTAIPLYVANYVVEGYGTDAVMGVP
FT                   AHNENDNFFARKQKLPIITVIDKQERLQHSGQFSGLNSQTANTQITQMLVERQKAKKTT
FT                   VYKLRDWIFSRQRYWGEPFPILFDENNQPHLVKELPVTLPALANYQPDGSTNPPLWRNQ
FT                   EWAKVKQGNQTFTRETSTMPQWAGSCWYYLGYLMLINNENFWPIDSKEAKDLFERYLPV
FT                   DLYVGGAEHAVLHLLYARFWHQFLYQKGIVTTKEPFKKLINQGMVLGPDGKKMSKSKGN
FT                   TINPTPLIDSHGADALRLYLMFMGPISAALTWLDDGLNGMRRWLDRVHNFFHKENIIKE
FT                   TVDQETVYGYNLFLKRSYEHLEKQELNLVISQMMIFLNLLYKTKQLTLAYAKGFLTVLS
FT                   FFAPYLAEELNAKLGMEPFIVHAQLPNVDNSVLETDKVKIILSVNGRFKGTKEFAKGVD
FT                   EQTVLKAFKTDPEFQALFDQPLARVVFVPNRIINVLLKSE"
FT   gene            complement(460907..461251)
FT                   /locus_tag="MPNE_0446"
FT   CDS_pept        complement(460907..461251)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86928"
FT                   /db_xref="GOA:A0A0H3DKK1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKK1"
FT                   /protein_id="ADK86928.1"
FT                   /translation="MLLKRLIKLAIFLFFVAVGFIIFIGSFWLNTYNTKEWANLLAEKD
FT                   ASGLIVQIIPNINQWFKGTVEQQQKLFQTLVHFFIPVGFGLLFGIAVAIIADLFYHLIK
FT                   YLIKRSFKKN"
FT   gene            complement(461286..461975)
FT                   /locus_tag="MPNE_0447"
FT   CDS_pept        complement(461286..461975)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87016"
FT                   /db_xref="GOA:A0A0H3DMM8"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMM8"
FT                   /protein_id="ADK87016.1"
FT                   /translation="MKTPLKPKFQPAKIANAVVVGGMIAFGKTTIAESLAKHLKGSKVI
FT                   YELEEQDQLADLLLAKMYERNDELLYAPLFQLYFTLNRFNKYRKECNNKTPTIFDRSIF
FT                   EDWLFAKQNIHRPSIFTYYNHLWNGIVKELIFKHGIPALYVILEGDWELFEQRLFQRNR
FT                   KVEIDNFAKNKDYFKNLYKIYGEFIKNVCYDFGISHCIVNANQSVESITKQVLEVLKSK
FT                   NLDWEII"
FT   gene            complement(462008..462104)
FT                   /gene="srpB"
FT                   /locus_tag="MPNE_0448"
FT   ncRNA           complement(462008..462104)
FT                   /gene="srpB"
FT                   /locus_tag="MPNE_0448"
FT                   /product="Bacterial signal recognition particle RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            complement(462123..463199)
FT                   /locus_tag="MPNE_0449"
FT   CDS_pept        complement(462123..463199)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86980"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMJ5"
FT                   /protein_id="ADK86980.1"
FT                   /translation="MTNFEYYRDFDDFQRRETINFFLSKFPLASQKQLQDFLEQARQAY
FT                   VQLRQTNPAHLDWNQTLLYLAQKFLPEKQSEKDRLKKILVLQEQLKVRYEGEIKRQSQQ
FT                   NSELLIQLGQRDEEIIQMQQLFKEKERQLEVYQKQLNEAKEYNHKLEEHYNKTLEEALK
FT                   EYEQQCTDAIHRRDEEIQAIFTSKLNEKNSEITQLQTYLQSAVDENEALQKQHKLVLFK
FT                   NQKYEKMVSDLQVDLARIQEINNSLTSEKRDFQRANNDLVKQYNKLKNRLEQKLGEITN
FT                   AQVNGQTHTVSLADTSQQFHRPQEAVIPQTQVISYTLDDMDDDMEVEETPPTTNKDLPR
FT                   GATQPKRNSIKRVSKLID"
FT   gene            complement(463192..463578)
FT                   /locus_tag="MPNE_0450"
FT   CDS_pept        complement(463192..463578)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86714"
FT                   /db_xref="GOA:A0A0H3DLR2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLR2"
FT                   /protein_id="ADK86714.1"
FT                   /translation="MSNFFEKYINGFIETLDQIDAADFQRIQHDFDPNQFPYDWVVERV
FT                   SDVKDYLLNPRDFSDVETFKSTMRAKIKHFYACYSSKIPFFLFTSFVLAIFNSVGQYVK
FT                   YHCDLDFTNPDAVIIFFREKALND"
FT   gene            complement(463571..464590)
FT                   /locus_tag="MPNE_0451"
FT   CDS_pept        complement(463571..464590)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0451"
FT                   /product="lipoyltransferase and lipoate-protein ligase"
FT                   /note="identified by match to protein family HMM PF03099;
FT                   match to protein family HMM TIGR00545"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86737"
FT                   /db_xref="GOA:A0A0H3DNF7"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNF7"
FT                   /protein_id="ADK86737.1"
FT                   /translation="MKTYILTSPKNIPYFNAALEEWLLTEFKKGEEIKVIYFWQNANTI
FT                   VVGRNQNTYAEVNLSEVEKDKVNLFRRFSGGGAVFHDMGNICFSIILPKAKKEMENAYE
FT                   ETTRNVVKFLNSVGVPAQFHGRNDLEIEGKKFSGLAEYLSKDRVLVHGTLLFDTDFTKL
FT                   AKYLNVDKTKMVSKGIESVQKRVVNVKEYLPNLSTPTFLEKMVQFFTETEHAETIHLDE
FT                   SSIKMVEKRAQEHFQSWDWNFGKTADYNFKNKKRFEGAGIFECNVQVDQGKVVDIEFYG
FT                   DFLSVIDITPVTQQLVGQKYDYQIFAKILGNIDNFKEYFGTLTPQQMLEVIFDNKKDE"
FT   gene            complement(464617..465990)
FT                   /gene="lpdA"
FT                   /locus_tag="MPNE_0452"
FT   CDS_pept        complement(464617..465990)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="lpdA"
FT                   /locus_tag="MPNE_0452"
FT                   /product="dihydrolipoyl dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01134; match to protein
FT                   family HMM PF02852; match to protein family HMM PF07992;
FT                   match to protein family HMM TIGR01350"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87170"
FT                   /db_xref="GOA:A0A0H3DLA6"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLA6"
FT                   /protein_id="ADK87170.1"
FT                   /translation="MNYDLIIIGAGPAGYVAAEYAGKHKLKTLVVEKEYFGGVCLNVGC
FT                   IPTKTLLKRAKIVDYLRHAQDYGISINGQVALNWNQLLEQKGKVVSKLVGGVKAIIASA
FT                   KAETVMGEAKVLDPNTVEVAGKTYTTKSIVVATGSRPRYLTLPGFAEARQNGFVIDSTQ
FT                   ALSLEGVPRKLVVVGGGVIGIEFAFLYASLGSEVTILQGVDRILEIFDTEVSDLVAKLL
FT                   QTKNVKIITNAQVTRANNNEVFYSQNGQEGSVVGDRILVSIGRIPNTECLDGLNLQRDE
FT                   RNRIVLNQDLQTSIPNIYIVGDANAQLMLAHFAYQQGRYAVNHILNKKQVKPAQKLTCP
FT                   SCIYTNPEVASVGYTEMELKKQGIPYVKTNLVLAHCGKAIADNETNGFVKMMFDPQTGK
FT                   ILGCCIIAATASDMIAELALAMDAGLTLFDIANSISPHPTINEMIADVCKKALFDHFK"
FT   gene            complement(465991..467199)
FT                   /locus_tag="MPNE_0453"
FT   CDS_pept        complement(465991..467199)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0453"
FT                   /product="putative dihydrolipoyllysine-residue
FT                   acetyltransferase component of pyruvate dehydrogenase
FT                   complex"
FT                   /note="identified by match to protein family HMM PF00198;
FT                   match to protein family HMM PF00364"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87254"
FT                   /db_xref="GOA:A0A0H3DQ17"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ17"
FT                   /protein_id="ADK87254.1"
FT                   /translation="MANEFKFTDVGEGLHEGKVTEILKKVGDTIKVDEALFVVETDKVT
FT                   TELPSPYAGVITAITTNVGDVVHIGQVMAVIDDGAGAAAPAAPQPVSAPAPAPTPTFTP
FT                   TPAPVTTEPVVEEAGASVVGEIKVSNSVFPIFGVQPSAPQPTPAPVVQPTSAPTPTPAP
FT                   ASAAAPSGEETIAITTMRKAIAEAMVKSHENIPATILTFYVNATKLKQYRESVNGLALS
FT                   KYNMKISFFAFFVKAIVNALKKFPVFNGRYDKERNLIVLNKDVNVGIAVDTPDGLIVPN
FT                   IKQAQTKSVVDIAKDIVDLANRARSKQIKLPDLSKGTISVTNFGSLGAAFGTPIIKHPE
FT                   MCIVATGNMEERVVRAEGGVAVHTILPLTIAADHRWVDGADVGRFGKEIAKQIEELIDL
FT                   EVA"
FT   gene            complement(467518..468501)
FT                   /gene="pdhB"
FT                   /locus_tag="MPNE_0454"
FT   CDS_pept        complement(467518..468501)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pdhB"
FT                   /locus_tag="MPNE_0454"
FT                   /product="Pyruvate dehydrogenase E1 component subunit beta"
FT                   /EC_number="1.2.4.1"
FT                   /note="identified by match to protein family HMM PF02779;
FT                   match to protein family HMM PF02780"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87043"
FT                   /db_xref="GOA:A0A0H3DPA4"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPA4"
FT                   /protein_id="ADK87043.1"
FT                   /translation="MSKTIQANNIEALGNAMDLALERDPNVVLYGQDAGFEGGVFRATK
FT                   GLQKKYGEERVWDCPIAEAAMAGIGVGAAIGGLKPIVEIQFSGFSFPAMFQIFTHAARI
FT                   RNRSRGVYTCPIIVRMPMGGGIKALEHHSETLEAIYGQIAGLKTVMPSNPYDTKGLFLA
FT                   AVESPDPVVFFEPKKLYRAFRQEIPADYYTVPIGQANLISQGNNLTIVSYGPTMFDLIN
FT                   MVYGGELKDKGIELIDLRTISPWDKETVFNSVKKTGRLLVVTEAAKTFTTSGEIIASVT
FT                   EELFSYLKAAPQRVTGWDIVVPLARGEHYQFNLNARILEAVNQLLK"
FT   gene            complement(468523..469599)
FT                   /gene="pdhA"
FT                   /locus_tag="MPNE_0455"
FT   CDS_pept        complement(468523..469599)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pdhA"
FT                   /locus_tag="MPNE_0455"
FT                   /product="pyruvate dehydrogenase E1 component, alpha
FT                   subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="identified by match to protein family HMM PF00676;
FT                   match to protein family HMM TIGR03181"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86911"
FT                   /db_xref="GOA:A0A0H3DME2"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DME2"
FT                   /protein_id="ADK86911.1"
FT                   /translation="MAILIKNKVPTTLYQVYDNEGKLMDPNHKITLSNEQLKHAFYLMN
FT                   LSRIMDKKMLVWQRAGKMLNFAPNLGEEALQVGMGMGLNENDWFCPTFRSGALMLYRGV
FT                   KPEQLLLYWNGNENGSKIEAKYKTLPINITIGAQYSHAAGLGYMLHYKKLPNVAVTMIG
FT                   DGGTAEGEFYEAMNIASIHKWNSVFCINNNQFAISTRTKLESAVSDLSTKAIAVNIPRI
FT                   RVDGNDLIASYEAMHEAANYARSGNGPVLIEFFSWRQGPHTTSDDPSIYRTKEEEAEAM
FT                   KSDPVKRLRNFLFDRGILTPQQEEEMVAKIEQEVQAAYEVMVSKTPVTLDEVFDYNYEK
FT                   LTPDLARQKAEAKKYFKD"
FT   gene            complement(469620..471059)
FT                   /locus_tag="MPNE_0456"
FT   CDS_pept        complement(469620..471059)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0456"
FT                   /product="putative NADH oxidase"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86831"
FT                   /db_xref="GOA:A0A0H3DM68"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM68"
FT                   /protein_id="ADK86831.1"
FT                   /translation="MKKVIVIGVNHAGTSFIRTLLSKSKDFQVNAYDRNTNISFLGCGI
FT                   ALAVSGVVKNTEDLFYSTPEELKAMGANVFMAHDVVGLDLDKKQVIVKDLATGKETVDH
FT                   YDQLVVASGAWPICMNVENEVTHTQLQFNHTDKYCGNIKNLISCKLYQHALTLIDSFRH
FT                   DKSIKSVAIVGSGYIGLELAEAAWQCGKQVTVIDMLDKPAGNNFDEEFTNELEKAMKKA
FT                   GINLMMGSAVKGFIVDADKNVVKGVETDKGRVDADLVIQSIGFRPNTQFVPKDRQFEFN
FT                   RNGSIKVNEYLQALNHENVYVIGGAAAIYDAASEQYENIDLATNAVKSGLVAAMHMIGS
FT                   KAVKLESIVGTNALHVFGLNLAATGLTEKRAKMNGFDVGVSIVDDNDRPEFMGTFDKVR
FT                   FKLIYDKKTLRLLGAQLLSWNTNHSEIIFYIALAVQKKMLISELGLVDVYFLPHYNKPF
FT                   NFVLAAVLQALGFSYYTPKNK"
FT   gene            complement(471127..471660)
FT                   /gene="apt"
FT                   /locus_tag="MPNE_0457"
FT   CDS_pept        complement(471127..471660)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="apt"
FT                   /locus_tag="MPNE_0457"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01090"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86842"
FT                   /db_xref="GOA:A0A0H3DNR1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNR1"
FT                   /protein_id="ADK86842.1"
FT                   /translation="MKQKLQALDRAIKRFNDFPTPGILFYDITPIFLNSELFEFVLEQM
FT                   AQFIQEVKADGIVCPEARGFIFGGALASKTKLPLVLVRKPHKLSGELARETYDLEYRQN
FT                   SILEMRVDALENCKRCVIVDDLLATAGTVAAIDKLIASLGSQTVGYCFLIELQKLHGKA
FT                   KLQPNVATKILLHY"
FT   gene            complement(471695..474610)
FT                   /locus_tag="MPNE_0458"
FT   CDS_pept        complement(471695..474610)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87094"
FT                   /db_xref="GOA:A0A0H3DPH3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPH3"
FT                   /protein_id="ADK87094.1"
FT                   /translation="MGLKKRVSFDWLLKIGIILVLAFLGLFGIIFGSYKLLNDSRLGVV
FT                   FNGSTTTTVYFLNHKSKDANKELDPTQKKDGNGNGNNTEMITDVNGFLNNIEKSYANSL
FT                   YAQGFSSVNITKNSHDTSAKELSDKGVFDSSWLVNDGLPSISVTFEQRREEARTRARKR
FT                   QIDAQVKRNALSAIEHNYKLSLETTDGIVLFDSFDKEFIRNSLTAVVPQTTNTNSALTF
FT                   EYKLSKNVITKESLHNDFLDFIKSKSLTDSDYNTGNGQKSVEGSGKWFKDKANGSAQNG
FT                   NKTLVLWKDKEGAVQYVRNIFNVPKGGTDYLTFNEREKNLWDFLHAEGNFSSGDNLFLQ
FT                   KNNNGNSPITKASDITLKNIYYIYAAPTHFSQVATKDNNNKDAADVVTVANSADTRKLR
FT                   SGDATGFSGLFSNYILAEIRTEDPVAKNGDPVKVNATLQSFLDSNNQRLEHGGNIKFQV
FT                   ANFVNNDGSYVPASYLEASRVKVLLSNGFPETATIAAANTKLVNAPLSNTLARDVSNFA
FT                   SSFIALGVIILLATIALGIRYKLLGLYKALALALSAISSLAFFNAVGGVVDVFSFVGIF
FT                   FVVAVNIINLITLAELFLRNIKNNASIVESWKLCLKRSFFTMIETHICWLLSALVVIYL
FT                   SNYQVQQLGTLMAVSAITSYFLNYGLGVILVWLFVSSHSGLEWRFFLYKKDAQALTKTS
FT                   SNCSILTENNDIQTDFFISKNQHDFFGKKKWSLLFIWLTVLAFGVVMLGLYLGAPQLLG
FT                   NFLAADIESSTGIMLGVGVISLLYLLYSLPRYGVAYGISYLIALILLAAGLFGAMYLAN
FT                   FIFRIDQSTIQLIIFVYLFWLFFQARIGQTTIWTYCYWFKRSLKDRVFVKNLFNDNVNS
FT                   QWRLDLIGSSVLILLFIVYAAFNFGGINGTINLVIFYLIAIVALFSVFVNGLPLFSFGL
FT                   INGWLSPYNYVQIHITLRHKKQMFKEVDQIEEQLISGINSF"
FT   gene            474653..476815
FT                   /locus_tag="MPNE_0460"
FT   CDS_pept        474653..476815
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0460"
FT                   /product="RelA/SpoT family protein"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM PF04607; match to protein
FT                   family HMM TIGR00691"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86774"
FT                   /db_xref="GOA:A0A0H3DKK6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKK6"
FT                   /protein_id="ADK86774.1"
FT                   /translation="MATLVEIERDFLQKTAQKFAPEVVALITKALDYSKKWHGEQKRLS
FT                   GEPFFIHPLRTALRLVEWNMDSNTVCAGLLHDIIEDTQVTEADLTAIFGKEITDLVVKV
FT                   TKITSESKKQRQLNRKKEDLNLKSLVNIAMSSQQEVNALVLKLADRLDNISSIEFLAVE
FT                   KQKIIAKETLELYAKIAGRIGMYPVKTQLADLSFKVLDPKNFNNTLSKINQQKVFYDNE
FT                   WDNFKKQLEEMLEQNQIEYRLESRIKGIYSTYQKLTFHEQNIAKIHDLFAIRLIVKSEL
FT                   DCYHLLGLIHLNFTVLMKHFKDYIASPKQNFYQSIHTTVRLKGLNVEIQIRTQRMDHVS
FT                   KYGFASHWIYKEKKEGLLASALQVNYLNSKQMHSRDFFKRIFGTDIIKVNVSSDNEPNI
FT                   VKKLNVESNSKLLDIAYELYPKQFNKLEKIKLDGVEVMSFDVTAENEMVIEFCFGKTNN
FT                   LKRRWLRYMNNPVFRERVKKDLNKLKKAVKYSELPLYEKALEELHLKLADETQIKQRLN
FT                   ALGIKKLTEFLELIEYPHFPKNEHLYFLASNNQKWRELIKPIKFALSQAVFQNSYFEQI
FT                   EGIYITKIVIETCCTKIPDMPEQVIGILMKNILRVHLHDCRELANQKQPKIIPLYWNAH
FT                   QLKMRPRKFRCQINIRGVWSETTVNKIVQTIIEGDSYLERIIPKIDKQKDEFELNITMF
FT                   IDNYHQLITIMEQITTKNISYVWKYL"
FT   gene            complement(476812..477468)
FT                   /locus_tag="MPNE_0459"
FT   CDS_pept        complement(476812..477468)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86861"
FT                   /db_xref="GOA:A0A0H3DM93"
FT                   /db_xref="InterPro:IPR030940"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM93"
FT                   /protein_id="ADK86861.1"
FT                   /translation="MFKFLKKLSTFLIVLIGILLVGGITAAGYFAFENREPINNYYKEG
FT                   YNKVKQYNEEIKKVSKSLSSNELVKTLGDVESSIKEGKELTKLLDDSALESSFNQLEDS
FT                   LSKVNNFSKGSTFTEVKNTIEKINQYVDEILKRFPNPNENDQFKEYVTNISQIVFYVGV
FT                   SIIGTFVVSGALLFIFTKRVYGVRVSRFNPQRLLKKHLVLLLQKNQDVYDEVFES"
FT   gene            complement(477468..478331)
FT                   /locus_tag="MPNE_0461"
FT   CDS_pept        complement(477468..478331)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87237"
FT                   /db_xref="GOA:A0A0H3DNF9"
FT                   /db_xref="InterPro:IPR030940"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNF9"
FT                   /protein_id="ADK87237.1"
FT                   /translation="MLLFINRFAKTIILFFGMLVFLVLLGLGGAALYFKDNAAKLYIDT
FT                   RKSIDSSFDSSQAFIDTYNGSSSKFSVESINKQIEEVKKKVEESTKKLEEYEKQINQAK
FT                   GLNGYLVSPEKLKELQEAKKSLQATKSQIEKYANTLKTANNGKTGQNGTSSSTIPITKI
FT                   SGSTISVSTRDTNGKTNSALKDIQEFSTQANDIIKQYKEIKNKIPTEKQFNEYYTIGAI
FT                   TLVSVSGGVLAVLIVSTVMTFLGSKKLGLRTFSRLTSTDQIADHVNDILDRYPELEDAV
FT                   LEELDQ"
FT   gene            complement(478393..478788)
FT                   /pseudo
FT                   /locus_tag="MPNE_0462"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(478839..480140)
FT                   /pseudo
FT                   /locus_tag="MPNE_0463"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(480428..480501)
FT                   /locus_tag="MPNE_0464"
FT   tRNA            complement(480428..480501)
FT                   /locus_tag="MPNE_0464"
FT                   /product="tRNA-Gly"
FT   gene            complement(480508..480593)
FT                   /locus_tag="MPNE_0465"
FT   tRNA            complement(480508..480593)
FT                   /locus_tag="MPNE_0465"
FT                   /product="tRNA-Leu"
FT   gene            complement(480594..480668)
FT                   /locus_tag="MPNE_0466"
FT   tRNA            complement(480594..480668)
FT                   /locus_tag="MPNE_0466"
FT                   /product="tRNA-Lys"
FT   gene            complement(480712..480786)
FT                   /locus_tag="MPNE_0467"
FT   tRNA            complement(480712..480786)
FT                   /locus_tag="MPNE_0467"
FT                   /product="tRNA-Gln"
FT   gene            complement(480792..480878)
FT                   /locus_tag="MPNE_0468"
FT   tRNA            complement(480792..480878)
FT                   /locus_tag="MPNE_0468"
FT                   /product="tRNA-Tyr"
FT   gene            complement(480908..481390)
FT                   /gene="greA"
FT                   /locus_tag="MPNE_0469"
FT   CDS_pept        complement(480908..481390)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="greA"
FT                   /locus_tag="MPNE_0469"
FT                   /product="transcription elongation factor GreA"
FT                   /note="identified by match to protein family HMM PF01272;
FT                   match to protein family HMM PF03449; match to protein
FT                   family HMM TIGR01462"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87049"
FT                   /db_xref="GOA:A0A0H3DKX9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKX9"
FT                   /protein_id="ADK87049.1"
FT                   /translation="MELNKNYLTEEGLKQLEAELEHLIQVKRPAIIKLLQEARDQGDLS
FT                   ENADYDAAKAQQGEIETRIAEIQDILANVKLINESQTKKANKVTLGSTVEIYDYSSKTH
FT                   EKYTIVGALEANPEEHRISNESPLAHAIYGRLVDDECDVVGIEVPYRVKIVKIING"
FT   gene            481520..481660
FT                   /locus_tag="MPNE_0470"
FT   CDS_pept        481520..481660
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0470"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86960"
FT                   /db_xref="GOA:A0A0H3DMG7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMG7"
FT                   /protein_id="ADK86960.1"
FT                   /translation="MTTKDNSGIKSKRRIRFLALGIIILILVIAVITILFVTGVITRAN
FT                   Q"
FT   gene            481671..483122
FT                   /gene="proS"
FT                   /locus_tag="MPNE_0471"
FT   CDS_pept        481671..483122
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="proS"
FT                   /locus_tag="MPNE_0471"
FT                   /product="proline--tRNA ligase"
FT                   /EC_number="6.1.1.15"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF09180; match to protein family HMM TIGR00408"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86784"
FT                   /db_xref="GOA:A0A0H3DKL2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKL2"
FT                   /protein_id="ADK86784.1"
FT                   /translation="MANKDQNLTLWYDQLLSKAQLVSYGDVKGTNCFLPNSWNLWLQIQ
FT                   RLYNNATALIKLKDKVILKQFIPIEPLPYTVEQVQLPTLSFYSEYQKEKRHVEGFNPEL
FT                   FLIEQIGTKKLHDPLVLRPTSEIAFCNLWKKQSFSYQNLPVIYNQWTCVFRAEKNTRPF
FT                   LRNSEFYWQETHGLFSDGVNSESAAIAFWKLYQDIIVNQLCIPAFVGLKSPNERFAGAQ
FT                   NTWTVESIMPDGQALQCATSHDLGQTFTKPFGLTFQNQANQQAIPYSFSCGISTRILGA
FT                   LLLTHSDDFGLILPWKVAPIQVKLYLFDKKGDTKTVELAQKVQTLLEQLAIRFQFIKVE
FT                   NQLGKQLGQGEVNGIPFQLIVDNPQTVNIFNRLTRVKTAYSFEQLASRFVELVQQYHQA
FT                   MYDKAKAVVQQKVVQATTLKQIEQAFNDKKAVLCAVRLTDTLEQQLKERYQVTVRCCLE
FT                   QLQKPQICPFSGESAQDYVLIARAY"
FT   gene            483267..483635
FT                   /locus_tag="MPNE_0472"
FT   CDS_pept        483267..483635
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0472"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM76"
FT                   /protein_id="ADK86841.1"
FT                   /translation="MSFKVKNQSKHLYSLMTKFKRSQLILKHQSNNFASELWNEEDIIR
FT                   SKQFIELIEDTLLHLKKDTVDFIYDIFIYGKKPCDISYSNSTYYKKLNKAANSFFDHFV
FT                   WEAPIYKTKELKNDNSHS"
FT   gene            483927..484655
FT                   /pseudo
FT                   /locus_tag="MPNE_0473"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            484662..485255
FT                   /locus_tag="MPNE_0474"
FT   CDS_pept        484662..485255
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0474"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87085"
FT                   /db_xref="InterPro:IPR035219"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL17"
FT                   /protein_id="ADK87085.1"
FT                   /translation="MIFSISKRKLICGFSLVALTIAGIVGGVYLVTKNNQQTTPQTNHF
FT                   NVAEPVNKVPNWRKLGPETQRELRDRLYPLDDTGYFIYKYGAISRYLQSQKELDELVDY
FT                   RTVLPSTQKHFKYDSFNQSVLESKLRKWLMKAIKQHPYFQHFEFDPVLKAQYNINIPAQ
FT                   KITVNAVWFYKKDNDLTTGKPIRYWDQFEIKLKQ"
FT   gene            485290..485544
FT                   /locus_tag="MPNE_0475"
FT   CDS_pept        485290..485544
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0475"
FT                   /product="acyl carrier protein"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86736"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLY0"
FT                   /protein_id="ADK86736.1"
FT                   /translation="MQERDILLKIKEIAKAKNFKTELDESVLQKPFRELKIDSLDMFSV
FT                   IVSLEKEFDIMFEDEKLMQLNNLAELIAEVKHLISQKGV"
FT   gene            485535..485609
FT                   /locus_tag="MPNE_0476"
FT   tRNA            485535..485609
FT                   /locus_tag="MPNE_0476"
FT                   /product="tRNA-Sec"
FT   gene            complement(485649..485942)
FT                   /locus_tag="MPNE_0477"
FT   CDS_pept        complement(485649..485942)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0477"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86963"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKM9"
FT                   /protein_id="ADK86963.1"
FT                   /translation="MDDQTGVLDIKQSVPPKLKVNKQGFEPVFITFTNTNNNEQVTVVL
FT                   NNWSQWETHKTDFAPWLKCKHWNIDVKQIRRVKTTFRDQENANFFELIESKQ"
FT   gene            complement(485949..486554)
FT                   /pseudo
FT                   /locus_tag="MPNE_0478"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(486554..488287)
FT                   /pseudo
FT                   /locus_tag="MPNE_0479"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            488515..490797
FT                   /locus_tag="MPNE_0480"
FT   CDS_pept        488515..490797
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03202;
FT                   match to protein family HMM PF03305"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87262"
FT                   /db_xref="InterPro:IPR004890"
FT                   /db_xref="InterPro:IPR004984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNI2"
FT                   /protein_id="ADK87262.1"
FT                   /translation="MVIKKGFFALSSCTLGLGLILTACGARGKFDQVDDGVIKLATSIQ
FT                   NKDSIAALNTIYKKYKERHPGSYPVQNFQVPGGYSGLRNDIRTRLSAKDGNNFYNIVLN
FT                   YPDVVSSLATSDMQLILDNVDTKLLSKNFLSFNERIGGVRQKGIYAIPISLSTELMVLN
FT                   GPVLHYILNSAKKKENGAQMIKRSGSFSTVQKGTMAIDMNDQKTKDLWQKIENAAKANG
FT                   KTTSTQTSPQPKNAVSSLQLKQAAEGTSTDNSQDAENSDNEIKKTWGEYKEEGNHTLKG
FT                   YTFKASVFENWNELLDFSTRVANSFPDKIKNQASKKATELQGVFGVDSVSGALFSATFA
FT                   AGGGDYDKFFFNVKNGRGNFRNLLEKGSSYNNLQKVFNDYKQLISSNGLYINKGGAYSS
FT                   NFLKFHQLAFSVGSSSGYNFAFAGESAKRLEFGQKAIEYPRDTYEIKAPTNSQNGNGTL
FT                   LGSFTKSKSNGKEQSGQDEDNQTSETIELYKSSVPSGKEAGKNALAITNQQLISALENA
FT                   AKDNKTSQPQARSLTASDQVQITQSSDKVIGYITTSNLDIDNNNTFDVGKLNGDKSTSK
FT                   IIVNATLKTLNKINTLQSEEGIILPHPQKYKSTDPQAVATVQGPSIIGVHANAKENAET
FT                   QKFINWFINQKETWPENSKGNKNGQNCQMTAAQYFAKSSGYVLPYSETFTKQSEDEHSK
FT                   TKDAYKILKDVNDGKLVGYSDPSDFRSGKFRDTIVAAFSGAVSSKADFNKFFKDFEQQL
FT                   GQEYRRG"
FT   gene            490870..492498
FT                   /locus_tag="MPNE_0481"
FT   CDS_pept        490870..492498
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0481"
FT                   /product="adhesin P1 domain protein"
FT                   /note="identified by match to protein family HMM PF03257"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86715"
FT                   /db_xref="InterPro:IPR004940"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLS0"
FT                   /protein_id="ADK86715.1"
FT                   /translation="MDYVPWIGNGYRYGKNHRGVDDITAPKTGAGSSSGTSTNTSGSRS
FT                   FLPTFSNVGVGLKANVQATLGGSQTTTTGGSKWPTLDQANLLLWTGAGWRNDKNGQSDE
FT                   NHTTFKSATGSGQQGGSSGTSAGNPDSLKQDKISKSGDSLSVVDTGQGDDTHYANLPPS
FT                   ITPTSDWPNALSFTNKNNAQRVQLFLRGLLDSIPVLVNKSGQDDNSKFKAEHQKWKYSD
FT                   LKSDQTKLNLPAYGEVNGLLNPALVETYFGTTRAGGSGNQNSTTVPGIGFKIPEQNNDS
FT                   KAVLITPGLAWTPQDVGNLVVSGTTVSFQLGGWLVTFTDFVKPRSGYLGLQLKGLDVSE
FT                   ATQRELIWAPRPWAAFRGSWVNRLGRVESVWDFKGVWADQTHSAVSESQAATSGTTTAT
FT                   GAALPEHPNALAFQVSVVEASAYKPNTSSGQTQSTNSSPYLHLIKPKKVTQSDKLDDDL
FT                   KNLLDPNEVRARMLQSFGTENSTQAQPQSLKTTTPVFGAMSGNLGSVLSGGGTTQGSSS
FT                   GQSGVDLSPVERVSGSLTINRNFSY"
FT   gene            492563..492835
FT                   /locus_tag="MPNE_0482"
FT   CDS_pept        492563..492835
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0482"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86951"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMJ3"
FT                   /protein_id="ADK86951.1"
FT                   /translation="MNEYPKSMKLVKLASFHRFLKQDQLQLVPLFSPNFLQVLLALFNK
FT                   PVNLFSENTTMKTNKKYAFAVLLMQAQAKLPNSFKFFLSKKGGMA"
FT   gene            492835..493281
FT                   /locus_tag="MPNE_0483"
FT   CDS_pept        492835..493281
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86853"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKE4"
FT                   /protein_id="ADK86853.1"
FT                   /translation="MKEKIPFYNEKEFNEMMKKTKKGTFSGWYIINPENNSVEFSGSFN
FT                   RQFKLNKPIIPVNTEYVTRKEFNEYKDSNDQRLIKIETTLTAQGEQINKLTQTVEKQGE
FT                   QIRELQVEQKAQGEQIKAQGETLKLILQTLQKMSDRLDKIDPPK"
FT   gene            complement(493423..494181)
FT                   /locus_tag="MPNE_0484"
FT   CDS_pept        complement(493423..494181)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00938"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86975"
FT                   /db_xref="InterPro:IPR001595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMI9"
FT                   /protein_id="ADK86975.1"
FT                   /translation="MRKKKFLSRFAFGSLFLLCGTILSACTGIQADLRNLIKEATGKDI
FT                   DLSKSIKTTDGKKNIITSSKKSYEVNPKDTTKLLLDAWKQSFEEGKLGIAELAFDQATN
FT                   PTKNSDFKMERKVEYFNMEYKSFSDFSVNARLSYIFNWYGSYFGEKSFTANNGGKHNFD
FT                   LFLSIKSHSKKQFTEKSFIVKDENFQDQDKSQQIITEWIQLDLSLIWSLKGQDELSRKS
FT                   LDKIFLKDYITYSANEKQINLFTYLQHLIK"
FT   gene            494688..495611
FT                   /locus_tag="MPNE_0485"
FT   CDS_pept        494688..495611
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86875"
FT                   /db_xref="InterPro:IPR022116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM81"
FT                   /protein_id="ADK86875.1"
FT                   /translation="MVYYEQLQRGLGLPQQRTENGQNTSTTGAMFGLKVKDAQKDDQKS
FT                   SEYLSGEAGSQAGGSTQGTSTTTQRRGSSNENKVKVLQVAMKKKSDSEDNGQIELETNN
FT                   LANAPIKRGSNNNQQVQLKADDFGTTSSSESGQSGTQGSTPSNPGPWTPWLTTEQIHND
FT                   PAKFAASILILYDAPYARNRTAIDRVDHLDPKVMTANYPPSWRTPKWNHHGLWDWKARD
FT                   VLLQTTGFFNPRRHPEWFDGGQTVADNEKTGFDVDNSENTKQGFQKEADSDKSAPIALP
FT                   FEAYFANIGNLTWFGQALLVFGICLS"
FT   gene            495804..497699
FT                   /pseudo
FT                   /gene="mgpC_6"
FT                   /locus_tag="MPNE_0486"
FT                   /note="MgpC protein; this gene contains a frame shift which
FT                   may be the result of a sequencing error; identified by
FT                   match to protein family HMM PF05220"
FT   gene            497950..499092
FT                   /locus_tag="MPNE_0487"
FT   CDS_pept        497950..499092
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0487"
FT                   /product="high affinity transport system protein p37"
FT                   /note="identified by match to protein family HMM PF06646"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86678"
FT                   /db_xref="InterPro:IPR010592"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKA3"
FT                   /protein_id="ADK86678.1"
FT                   /translation="MLKRKKLLQGFLKFLPLIIPATIFVSCARRESNHLIFNISLDHDA
FT                   DASISKFFELYSNNLSKKLDKKVTVSFNIIDDSFTKISNIQTAKADFAFVNSQSIKDNG
FT                   IEGFNLILQTQTDAFKEDTNLDYYSDGQLKSKAEKMTTLFSKTPYKDWEDTAQQWTGSR
FT                   YNFLYETNKLINFYRGMILITGSEEEIKKIKEAWDQKKWSDFMNYGIGHGSSGSAGKFQ
FT                   LPDLLLRKHFGSSYPGLQNAINQNPDKFANVRGREIGRDNKIKIVFDDANSFAWTHNDK
FT                   NATNHFYTPTENNGKGDSEKSNNKNNKVEILTYTDPMLYDIGIVSDTLSDRYQKAIAEV
FT                   FVELAKTKQDIYGPSYGYNGYNLITDPNKEILDVIHKTYG"
FT   gene            499085..499336
FT                   /pseudo
FT                   /locus_tag="MPNE_0488"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            499432..499818
FT                   /pseudo
FT                   /locus_tag="MPNE_0489"
FT                   /note="ABC transporter, ATP-binding protein; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00005"
FT   gene            499811..501439
FT                   /locus_tag="MPNE_0490"
FT   CDS_pept        499811..501439
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0490"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86987"
FT                   /db_xref="GOA:A0A0H3DP52"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP52"
FT                   /protein_id="ADK86987.1"
FT                   /translation="MTSLFFYQISDKQKRWNWYWKLALAIIVLVVIIYSFIDNFSGFNV
FT                   SGFRNFSRNFIRLFTPDTARDYFLGSYLLQTIFYVVSGSILGFVIALWFSYLTAFKIQP
FT                   LYIALPTRLFTIFLRSFPVLVFAFLFNNLFNKQLTATLTITWFSWLWSTKYITAFFENS
FT                   ALKQFFNQSSRYIHKFKAFWNTVVISQAERLWLFLLYSLEANFRWTTVLSIAGITGIGE
FT                   LIATPLGGTVQLNLVLIPMLTLIGFLLFLEASVFLLTKFVLQKQSQAGDYFLQAKTLQK
FT                   RKWKKVMIYILALVLAAFTLANLVQLDYTVKAPGFVADFFKQFFQTKTAFLISEDANIN
FT                   PLLMLLKLTTQAISLITLVFVLALLFGFLASKLFSTITSISLKLLLLVIRVIPSVLLFR
FT                   LFDPIIFRPETTIIFVLAIHSAASYGQLITINFDNANEGVINNMQNHGFSRFYILWNYL
FT                   IPTTKPQLLNTLSDSFDNAIRDLVVFGIFGGSIIGVRINNFFERAQYSELGTITLPLMV
FT                   YLMVFEVILMAVRLNKLKVWQRHLW"
FT   gene            complement(501440..501862)
FT                   /locus_tag="MPNE_0491"
FT   CDS_pept        complement(501440..501862)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0491"
FT                   /product="RNAse H domain protein, YqgF family"
FT                   /note="identified by match to protein family HMM PF03652;
FT                   match to protein family HMM TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87209"
FT                   /db_xref="GOA:A0A0H3DPU9"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPU9"
FT                   /protein_id="ADK87209.1"
FT                   /translation="MQYILGIDFGLKRIGTALANTIDRFPSPFRVFAVQNNLQQAVNTL
FT                   FKDLKQAGYELVQIVIGFPHFHYQSSIQVSIHKFVELIKTRFNVPVTLIDESGTTSEVK
FT                   ANLQELGLKNRTFKKAKDTLAATLILERFLNQQKPN"
FT   gene            complement(501862..504564)
FT                   /gene="alaS"
FT                   /locus_tag="MPNE_0492"
FT   CDS_pept        complement(501862..504564)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="alaS"
FT                   /locus_tag="MPNE_0492"
FT                   /product="alanine--tRNA ligase"
FT                   /EC_number="6.1.1.7"
FT                   /note="identified by match to protein family HMM PF01411;
FT                   match to protein family HMM PF07973; match to protein
FT                   family HMM TIGR00344"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87117"
FT                   /db_xref="GOA:A0A0H3DN14"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN14"
FT                   /protein_id="ADK87117.1"
FT                   /translation="MKWTTDKVRQTWLDYFTAKGHLALPSKSLIPVNDPSLLWINSGVA
FT                   TLKDYFSAKKTPPSKRLANAQICLRVNDIENVGFTSRHQTLFEMLGNFSIGDYFKEEAI
FT                   GFANDLLVNHYHLDPKRFYITVYQDDELTFNTWLKHGIPASRIIKCDRDRNFWDLGLGP
FT                   CGPCTEIYYDRGERFDPHKVGEKLFFEDIENDRYVEVWNIVFSQFNNDGNGNYSELAQK
FT                   NIDTGAGIERLVAILQDAPTNFDTDIFLKLIGIIEQHCKHKYDTNLYFKFDQKLNEAQS
FT                   AFRIISDHFKAITFTIAEGVLPGPNERSYIVRRLLRRALLACKKLDLDLKFIDPMVDAI
FT                   ISVYGSYYQQLQGKNQVVQQAIWKEVTAFDKTINLGLMLFEKSIAHNALKPQVAFQLYE
FT                   TYGFPIEMIKELVDKRQLQVDWKAVEQLMEQHRLISKQNSNTLSFEKQNEHLVNFKTAS
FT                   EFLYEANEITAKVIGLFDEQYQPVQKLHNQSGYVVFDQTVLYATSGGQRYDEGYCINHS
FT                   QNDQRVSFQGVFKGPNKQHFHFFLTGSFQLGDKVILVHDGKWRQLVKNNHSLEHLLHAA
FT                   LQKEIDPLIKQDGAFKSAQKATIDFNFSRALTWAELERVEHRIRQIIQQDIQREEIFTD
FT                   LEGSQKLNAIAYFEEEYSNHELLRVIRFGDFSVELCGGTHVEHTGLIENCFITDYYARG
FT                   TGRWRIEIISSNETIAAYLNEQNGKLSETINSLHNTLNNIANPALNKQKTALTKQLNHF
FT                   HLPQVITDLRKCQALLNELKITVNELKTEDFKWKQKQLAEKIKQELLELAKQDKAYVLA
FT                   SFAAVDPKLLSQVAQAVLNQHKNKLFVLLNQFNNSPSFMLLGQDVSKCIQLLKAHFELK
FT                   GGGSNNFFRGSFNESVDVSKLQAILDTLQ"
FT   gene            complement(504616..505341)
FT                   /locus_tag="MPNE_0493"
FT   CDS_pept        complement(504616..505341)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0493"
FT                   /product="glycerophosphodiester phosphodiesterase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86744"
FT                   /db_xref="GOA:A0A0H3DKI7"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKI7"
FT                   /protein_id="ADK86744.1"
FT                   /translation="MLKRQLLLAHRGYSDIAPENTQLAFELAFQYRFDGVELDVHLTKD
FT                   GELVIIHDETTTRTALVDKTIELETLASLKQDDHSAFFKFKTQPQPIMTLKEFFDQYLD
FT                   KFQLINVEIKTDQKEYPGIEAKIDALAQQYGKKVIEKVVFSSFNFASLQRLYDINPNYQ
FT                   IAFLFWTKKQFQAVDALKIKQVCQYLHPWTNIYEKFPDMVLSLQLPLGLWTLNSEVKFH
FT                   QFRQDRMVYAQIANKKFEV"
FT   gene            complement(505334..506761)
FT                   /locus_tag="MPNE_0494"
FT   CDS_pept        complement(505334..506761)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0494"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86667"
FT                   /db_xref="GOA:A0A0H3DJS7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DJS7"
FT                   /protein_id="ADK86667.1"
FT                   /translation="METKLSLKKRLQQFSKKQLIALIILGAADVFVIAAPYYIKNVVPN
FT                   LHLYLGITEDEVATLTSIIGYVTLATQLPGGFLANRFSSRKLLFLSEISTGVITFWLAT
FT                   NILTRESQKSNALFVQYCVIWGLWGITSTLIFWTPLWKLASQQATQENQALGFGIQGAA
FT                   NGVWGFIFIFLIALIITAVAYPAGGESSANNPAPFAIYAFIIGGMLLVTGFTVLFFVPE
FT                   KPIEKYDSHTSLKTAKKNFEQILITLKNWKLWLLSFFLMGMYVFQSTFAYYLLQMMQNA
FT                   FLAPVILGTVLGGVRTYVLRSAVSVYLGRLADKFRSYILFLMLCTGLGIIFVLMFILLG
FT                   FGQVGQQQNYALIIVSAILYILTGVLSWGMVTVRYNQVAEIEIGKNNYASSVGLLSFIG
FT                   FSTDGWLYTVTSVVGKAYTPDGQKNTSIQGYQIIAAICLGIALFGLLCGTIVFLVNTWE
FT                   LKRLGKTDYRWRTLDNA"
FT   gene            complement(506892..508004)
FT                   /gene="trmU"
FT                   /locus_tag="MPNE_0495"
FT   CDS_pept        complement(506892..508004)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trmU"
FT                   /locus_tag="MPNE_0495"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="identified by match to protein family HMM PF03054;
FT                   match to protein family HMM TIGR00420"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87226"
FT                   /db_xref="GOA:A0A0H3DLQ5"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLQ5"
FT                   /protein_id="ADK87226.1"
FT                   /translation="MQNKTVFVGISGGVDSAVSALLLKQQYREVIGIFMECWDNTLNND
FT                   QLGHRAFNEHKSGCSSKEDFREAQAIAQLLGIKLIKQNLVEPYWKQVFLPTIDAFKNGL
FT                   TPNPDMLCNRLIKFGLMRDYCKQLDPNSDFATGHYAALSWDNNQPLLAIPKDKHKDQTY
FT                   FLAHVKPAQLQDVVFPLAHLLKTEVRQIALAHHFSVATKKDSTGICFIGERHFSDFLKN
FT                   YLPVKPGVIYDWKTQRQLGSHEGVWFYTTGQRSGLNLGGQAARNFVVEKDLKTNTLYVS
FT                   SDPEDLQRRGITLSHFNWLYQPNPLTQTVLVRIRHAQPLVQGHITVQPNNVVQVQLDQP
FT                   IDRVTNGQYGVLYTQNGICLGSGIITASQI"
FT   gene            complement(508005..508394)
FT                   /locus_tag="MPNE_0496"
FT   CDS_pept        complement(508005..508394)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0496"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87013"
FT                   /db_xref="InterPro:IPR019097"
FT                   /db_xref="InterPro:IPR027371"
FT                   /db_xref="InterPro:IPR036340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP74"
FT                   /protein_id="ADK87013.1"
FT                   /translation="MKPQLLALKQFVQTEFEKVDFETFRQNFNRCLEREQSTLLIYEDD
FT                   DYDDQSFFLKPMLSDAFFISSEVVKQLDLLAVLVDNPKGDVKSCCQSFYEALTLFISAL
FT                   AITKGVDVGRYHQQLGKRFGVLTVY"
FT   gene            complement(508394..508702)
FT                   /locus_tag="MPNE_0497"
FT   CDS_pept        complement(508394..508702)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0497"
FT                   /product="helix-turn-helix protein, YlxM/p13 family"
FT                   /note="identified by match to protein family HMM PF04297"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87099"
FT                   /db_xref="InterPro:IPR007394"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPH7"
FT                   /protein_id="ADK87099.1"
FT                   /translation="MNQTKLNQRLKQQQLFDIYGELLTKRQACYFNEYINLDLSMQEIA
FT                   DKYQVKKSSIHQHIKTCNLIFNRFEAKLQLFKKQQLRLKLYEKITDPQLREQLIKLR"
FT   gene            complement(508683..509729)
FT                   /gene="ftsY"
FT                   /locus_tag="MPNE_0498"
FT   CDS_pept        complement(508683..509729)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ftsY"
FT                   /locus_tag="MPNE_0498"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86858"
FT                   /db_xref="GOA:A0A0H3DKE9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKE9"
FT                   /protein_id="ADK86858.1"
FT                   /translation="MSFIHKLIQKFKPKKKLVDQVQQAVQEKSFFQANQKSYYQGLNKS
FT                   ANSFANTINKLAANYVTVNEQFQESLFEELVLLDIGYHAATKICDAIVQELKLQRVSDP
FT                   QLIQEIIVDKLIVYYIQDKLFETDLTVEANKTNVYLFVGVNGVGKTTSLAKLADQLTKQ
FT                   NKRVLMVAGDTFRAGAVAQLAEWAQRIGCDIVLPNPKEETPAVIFRGVQQGIQNEYDFV
FT                   LCDTSGRLQNKTNLMNELKKIYQIVQKVSSAKPQETLLVLDGTTGQSGLAQAKVFNEFT
FT                   ELTGIILTKMDSSSKGGIILAIKDLFNLPVKLIGFGETTADLAAFDLEQYVLGLTKNLS
FT                   LNHEPNQT"
FT   gene            complement(509735..512683)
FT                   /gene="smc"
FT                   /locus_tag="MPNE_0499"
FT   CDS_pept        complement(509735..512683)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="smc"
FT                   /locus_tag="MPNE_0499"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM PF06470; match to protein
FT                   family HMM TIGR02168"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86918"
FT                   /db_xref="GOA:A0A0H3DKJ5"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKJ5"
FT                   /protein_id="ADK86918.1"
FT                   /translation="MVFLKRFRAYGFKSYADEITINFTHSMTGIVGPNGSGKSNVVDAL
FT                   KWVLGERSMKHLRSKSGDDMIFFGSKDKPASKLAEVELTFDNSQKLLHDPRPEISVMRR
FT                   IYRGSGQSEYYINGELVTLKEISGIFADIGLEKGSLGIISQGSVSWFVEAKPEERRKIF
FT                   EDASGIGRYTKRKEEVTNQLARTVQNLKQVSIVLNELKKDLKKLTIQADKAQRFVKLKE
FT                   ELKELELSVLVADYLKSQGELDRFNHQIGYIEQDFKLHEPQLQLLEDQLNIFNQRFRDA
FT                   DEQSIKLQQELQAVYQTINELEQRKAVIDVQLKNELSKKDEKHKIQALKKLIRVDQAQL
FT                   ESLQAQVLKTTSEITLLTNELSTVQTELDTTKLNLNQNSAALVYQQAQQEFLKAQNEEW
FT                   VKTNPAHVLVKNVKALTGLLNTLNTFLKFEKQYEKALLKALGKSIGYLVVNNNLAALKA
FT                   IDFLLTNQIGQVTFLPIDDIAFDTKIVPEHMEILQQLDGFLGVGSDHVSCDERLQPIVN
FT                   ALLGQVIIASDLQAALKLSSYTYKLYRVVTLNGETVYAGGIIQGGYVKDNLSLYNLQEK
FT                   LASSEANITQLEHNEKQLRTNLTSLETKLNELNKKLKYEEILLEKFNERVNHTNKAILS
FT                   YKIEYEQLTNESFDGTPHSFDETRLVESLNRAWAERDELNSQLKLNQELKETLAKSIKL
FT                   AEAKTADLRALLDEQRSQLVLAREGKIRFENTIHNITDKINGGYKLTMEFAIANYNKPI
FT                   KLSTMQAQNKIARMQSQLDEMGPINLESIAEIADKQKRFDDINGEYESLQTAIKDLQTA
FT                   IGEIDELACKEFDELIQKVNAELPKTFNYLFGGGSCQIRYTDTDNVLLSGIEVFANPPG
FT                   KNVANLMLLSGGEKTLVALSVLFSILRVSAFPLVILDEAESALDPANVERFANIIGNSS
FT                   NNTQFLIITHRQGTMMKCDMLLGAAMQTKGVTKTFAVSLEKAEQYISKDKQN"
FT   gene            512868..513740
FT                   /locus_tag="MPNE_0500"
FT   CDS_pept        512868..513740
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0500"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF05116;
FT                   match to protein family HMM PF08282; match to protein
FT                   family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86696"
FT                   /db_xref="GOA:A0A0H3DNA0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNA0"
FT                   /protein_id="ADK86696.1"
FT                   /translation="MTKTSKASGLSWFFCDLDGTLLRYQNNQHLIEPTTKRAVAQLVES
FT                   GANFVVATGRKPSDVRNIYKELGIEQASPYLIANNGAVVWDLKRNSYLNKQTLSLSDFD
FT                   LIDHINQTLNQLNHEYGCILYGLNDQVYFYHIHAPDSQAFKQYFAFYEGEFVQNQYLEI
FT                   DGLKTEYNLVKAIWFFKEVHQQKAVIAQHFTNQERLVITSAHSFELVPLNVSKGHAINL
FT                   IKQQVKITDNQIMVLGDSYNDLPMFQHGVVKVTNHLAPDNLKQLATRVYDLPASLFVGQ
FT                   ALNDYFKFD"
FT   gene            complement(513746..514708)
FT                   /gene="pta"
FT                   /locus_tag="MPNE_0501"
FT   CDS_pept        complement(513746..514708)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pta"
FT                   /locus_tag="MPNE_0501"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /note="identified by match to protein family HMM PF01515;
FT                   match to protein family HMM TIGR00651"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86668"
FT                   /db_xref="GOA:A0A0H3DK93"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK93"
FT                   /protein_id="ADK86668.1"
FT                   /translation="MSVIDLLKQRVQSAGKKPVIIFPEGWSPTVMEAVNQLQQAGILTP
FT                   AVIFRTRSEVPAGFNTAIKHYVIEEMDLTKYANFVYEKRKHKGMEMREAQKFVRDASSL
FT                   AATLVALNEVDGEVCGKEYATKDTLRPALQLLGTGNFVSSVFIMEKNEERLYFTDCAFA
FT                   VYPSPQELAVVAENTFKFAQSMGEPELKMVFLSYSTLGSGKGEAVDKVVSATQIFLEKH
FT                   PELKANVCGELQFDSAFVEKVRKQKAPNLTWNGSANIYVFPNLDAGNIGYKIAQRLGGY
FT                   EAIGPIVLGLARPFNDLSRGASVSDVFNVGIITAAQTLK"
FT   gene            complement(514746..515975)
FT                   /gene="pgk"
FT                   /locus_tag="MPNE_0502"
FT   CDS_pept        complement(514746..515975)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pgk"
FT                   /locus_tag="MPNE_0502"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="identified by match to protein family HMM PF00162"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86935"
FT                   /db_xref="GOA:A0A0H3DMD9"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMD9"
FT                   /protein_id="ADK86935.1"
FT                   /translation="MVDFKTVQAFDFQGKTVVLRADLNVPMKDGVITDNERILASLDTI
FT                   KYLLGHNCKIVLLSHLSRVKSLDDKKGKKSLQPVASALQNLLKDTKVHFCPENTGDKVK
FT                   VAVNQLPLGEILVLENTRYCDVNEAGEVVKHESKNNAELAQFWASLGDIFVNDAFGTAH
FT                   RRHASNAGIAKYIKNSCIGLLMERELINLYRLINNPPKPFVVVLGGAKVSDKLQVVNNL
FT                   LKIADHILIGGGMINTFLKALGNEVGTSLVEEDLVQTAKQILDSDKDKKIVLGVDQMLH
FT                   ASFKDEPGVECVVAPQWPAELQGFMSLDVGSKTVALFSSYLAKAKTIFWNGPMGVFEFS
FT                   NYAQGTLAIGKAIAQNQQAFSVIGGGDSAAAAKQLQIADQFSFISTGGGASLALIGGEE
FT                   LVGISDIQKK"
FT   gene            complement(515978..516991)
FT                   /gene="gap"
FT                   /locus_tag="MPNE_0503"
FT   CDS_pept        complement(515978..516991)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gap"
FT                   /locus_tag="MPNE_0503"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by match to protein family HMM PF00044;
FT                   match to protein family HMM PF01113; match to protein
FT                   family HMM PF02800; match to protein family HMM TIGR01534"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86868"
FT                   /db_xref="GOA:A0A0H3DKF8"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKF8"
FT                   /protein_id="ADK86868.1"
FT                   /translation="MLAKSKTIRVAINGFGRIGRLVFRALLSQKNIEIVAVNDLTHPDT
FT                   LAHLLKYDSAHGEFKKKVVAKDNTLMIDKKKVLVFSEKDPANLPWAEHNIDIVVESTGR
FT                   FVSEEGASLHLQAGAKRVIISAPAKQKTIKTVVYNVNHKIINAEDKIISAASCTTNCLA
FT                   PMVHVLEKNFGILHGTMVTVHAYTADQRLQDAPHSDLRRARAAACNIVPTTTGAAKAIG
FT                   LVVPEATGKLNGMALRVPVLTGSIVELCVALEKDATVEQINQAMKKAASASFRYCEDEI
FT                   VSSDIVGSEHGSIFDSKLTNIIEVDGNKLYKVYAWYDNESSYVNQLVRVVNYCAKL"
FT   gene            complement(517022..517975)
FT                   /locus_tag="MPNE_0504"
FT   CDS_pept        complement(517022..517975)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0504"
FT                   /product="cobalt transport protein"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86954"
FT                   /db_xref="GOA:A0A0H3DL39"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL39"
FT                   /protein_id="ADK86954.1"
FT                   /translation="MTSKNFLSQLPPVLKLWWWIISLVVAFLPLGLHGLIIINAIFFAL
FT                   VIVVERKLKTFAIIFGWLLFFFWFNIVVNGFIFLPNSSALASQNENFLGHFIYSGGEQF
FT                   GGVSWWSVNTRSLLRSLVIALRISMLFATSFLLTASTSIYELAFGVERLCTPLRYLKIK
FT                   TQPLSILFALVFKLLPIVKGELKRIKQAQAIRGFKYGKLAFLNPVKLKTLFIPVLLSTV
FT                   KKTEAVAFALQAKGYQLDNPNKTHYLQKYNLWGGIVFLGLFVLLSCLLMVNNWHLVYWT
FT                   NPHYSFTFTHQNFCFFKQISSPQLLAFWQLELLAIG"
FT   gene            complement(517965..519026)
FT                   /locus_tag="MPNE_0505"
FT   CDS_pept        complement(517965..519026)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0505"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86735"
FT                   /db_xref="GOA:A0A0H3DLV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLV2"
FT                   /protein_id="ADK86735.1"
FT                   /translation="MQTPQIIWSLIAPQYRGLANKVNRKLIQSSIKHYFWYCKQFDKLV
FT                   HPFYYLTAKKHTPLFNQQLVDLAQSTLYFYNLSVFVDKSNAGQIIKNVTGSVEPNQITV
FT                   IFGPSGSGKTTLIKQLGLVENPTCGFLNCGNFYYFANQKHNRATKQFQNSIGYVLQKAE
FT                   EQFFCDSVLEEVLTGAINLGLCQKGDVNFAKKYLEMCGLDHIPLIKNPLELSGGQKKRL
FT                   ALASVLAMQVQFLILDEPTVGLDQEGKALKSALLKQLKQVTRIMIVSHDVDFIYETADS
FT                   LIQLEAGQIVDQMSVADFFNNMQLLQRYEITPPLVVQTIQLLQAKGVQLNDPLAIKTVH
FT                   DLIDQLKPLFHDQ"
FT   gene            complement(519008..519820)
FT                   /locus_tag="MPNE_0506"
FT   CDS_pept        complement(519008..519820)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0506"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86779"
FT                   /db_xref="GOA:A0A0H3DKK8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKK8"
FT                   /protein_id="ADK86779.1"
FT                   /translation="MLNVTNLSFTYPRHSQPALEKLNFSLKPNTHVAIIGHNGSGKSTL
FT                   VKLLGGFLKAPKQTIFFRGQPLEEVGFRQIGILLQDPDMQLLGDTLHQELIFSLENHGV
FT                   DPKQMDRVIADVLAVVELQGKQFTPLSKLSFGEKQRAVFACLLAVKPELYLLDEAFSML
FT                   DGKLASKLKRFIFKVIKEQQKTVINVTHDFNDLFLADEIIFLSKGQLLKQFSPAAIYKQ
FT                   LHLFHQHHFTLPFPWLLAHEVADHLHHEMKGPIEELQDVVDWICKHLK"
FT   gene            519773..519886
FT                   /locus_tag="MPNE_0507"
FT   CDS_pept        519773..519886
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0507"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87015"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL94"
FT                   /protein_id="ADK87015.1"
FT                   /translation="MTVARIGKTEVGNVEQFKFLFLNFKNKTNWKNGLKSA"
FT   gene            complement(519978..521765)
FT                   /gene="dnaK"
FT                   /locus_tag="MPNE_0508"
FT   CDS_pept        complement(519978..521765)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dnaK"
FT                   /locus_tag="MPNE_0508"
FT                   /product="chaperone protein DnaK"
FT                   /note="identified by match to protein family HMM PF00012;
FT                   match to protein family HMM TIGR02350"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87278"
FT                   /db_xref="GOA:A0A0H3DNM0"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNM0"
FT                   /protein_id="ADK87278.1"
FT                   /translation="MSTDNGLIIGIDLGTTNSCVSVMENGRPVVLENPEGKRTTPSIVS
FT                   YKNNEIIVGDAAKRQMVTNPNTIVSIKRLMGTSNKVTVKNPDGSTKELTPEEVSAQILS
FT                   YLKDYAEKKIGKTISRAVITVPAYFNDAERNATKTAGKIAGLNVERIINEPTAAALAYG
FT                   IDKSNREMKVLVYDLGGGTFDVSLLDIAEGTFEVLATAGDNRLGGDDWDNKIIEFILAH
FT                   IAQEHNGLNLSNDKMAMQRLKEAAERAKIELSAQLEAIISLPFLTVTEKGPVNVELKLT
FT                   RAKFEEITKQLLERTRNPISDVLREAKIKPEEINEILLVGGSTRMPAVQKLVESMVPGH
FT                   SPNRSINPDEVVAIGAAIQGGVLRGDVKDVLLLDVTPLTLSIETLGGVATPLIKRNTTI
FT                   PVSKSQIFSTAQDNQESVDVVVCQGERPMARDNKSLGRFNLGGIQPAPKGKPQIEITFS
FT                   LDANGILNVKAKDLTTQKENSITISDNGNLSEEEIQKMIRDAEANKERDNVIRERIELR
FT                   NEGESIVSTIKEILQSPEAKDFPKEEKEKLDKITGGIDAAIKANDYTKLKAEIENFKKW
FT                   REEMAKKYNPNGDQGQPAQ"
FT   gene            complement(521821..523008)
FT                   /locus_tag="MPNE_0509"
FT   CDS_pept        complement(521821..523008)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0509"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86824"
FT                   /db_xref="GOA:A0A0H3DKQ5"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKQ5"
FT                   /protein_id="ADK86824.1"
FT                   /translation="MSTPKSASFFTRKNILAFSFFIAFLVVVSVLVTVFFLDIKTGDVK
FT                   TIINTINRTNWPWILLIVLGIVVTLAWNIIINWWVARRFCFHAPWWEWVLFACVVQFFQ
FT                   IVTPLSLGQDPFRLYWFIKKGMKKQTAVLLVTSTGAFWNLAQALITWPSFFVLSQNYAL
FT                   LEQNHEGFVSYWFSFAGMIFDVVVAILFIFIAYSKRMHVLIYSGVNQFRKWIKRPYLTK
FT                   EQIYQRFIDKAEFNKLYGLEIKRLGLTIFKLLANILIAVVGYFSVFAVFAIVKKENATN
FT                   NVIDQYSTADIFNITNIAITASNFIPVPSGEGATQFVMTSFLNAFKSAVGIESQVKQGV
FT                   FLWRFLSVYIPAILFSLCFIGWVVKVVIEFKHPKPVLPTVNLINHHFWNNKKLHN"
FT   gene            complement(523018..526752)
FT                   /locus_tag="MPNE_0510"
FT   CDS_pept        complement(523018..526752)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87125"
FT                   /db_xref="InterPro:IPR022186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL65"
FT                   /protein_id="ADK87125.1"
FT                   /translation="MKKFLRKPQFWLLTLGGFLSTSVILAACATPSNSALQTVFKARSS
FT                   QFFNGEQGSLQSALTTALKNPVANKQFIAAPLLKALEAWYENNEDKKITQFLKDTKSNV
FT                   DSQYTTAVDKVVSASRNKSLFVQQDLLDNAGGSEATWKAQKLLEQLISDFASRVFQKNY
FT                   LNYKKDGQVSTGPFTYDELHKEESWKNFEFSAPRFSETNDDFFAKIQSQVFDQWVEYTD
FT                   PTLISQVNYKYSAPSQGLGQIYNREKLKDKLTPSYAFPFFAEEKDIAPNQNVGNKRWKQ
FT                   LVKGEGAITDNNIGQSGTNSQKTGLLKYRNESNKGDFLDFPLNLSDTNETKQLVDASNI
FT                   VDQLEAANLGAALNLKLQVFEQDNDELPQIKELKEDLNNTIVVDKSKDVEKASKTNALF
FT                   YSDQEGKQQQSDSDPIAGALDDIFAQNTSEGTNLSKLAEQVKKAAATKMEAKTAVLRTN
FT                   NSKGQQNNYVVLDAAIPTFNSTTSKSKNNSASNEVLVALKSGSINLRQVQQTDQNSYSP
FT                   IKFRIVRNSTGVTVFGLDGGSYYLKQDSTNKKSVSKQSLTLLTKSSSGNSNKVLRDLDK
FT                   QKQFLKFRAFQAKTNTFYSTNFAFSFPLNETLKSWFDKHRELILANALVNASLDQKDKA
FT                   SKALTEAFNPYKELIKEFAPVALATTMISFYFDQMKALNNKLLERARNLNQNVNQANPT
FT                   PWLNGLSAKLPYVNTNGNYEKLNNYFTFLITKTLWPKVGQEETSISEESNKLKTKTADV
FT                   DKIRDKILENIQTKVNDFVKNKLKPALAPRPAYSNVILLNVNNDKVLSSGANWSLASLL
FT                   QSDKVNPLSFMLLKQAFDNNDLFKKAQKLFKDIQEKSSNNGGMQSSSTTNSDADALSKV
FT                   IGNYYYTTWAKLTDKSIYGNPKDNKFDELFKLAFEASIDEKSFNVDYKAVIDHYRFIYT
FT                   LQWLVDQKLKNFKSLLKTNLKFGEVAFIAYKNTETTNFSNPQGVFGSYFNYENSANEVK
FT                   ESTQTLDPNNFFYKTTTKPTVQATQQVASLALVQKQQMQQNSTDHYGFTGLSTSTSSMF
FT                   DASSRDAILQQITKTSLQQYGSKDQLKKIIQGTNNQLLLDRIAVQLSGLNPSTTNGGSG
FT                   KTIATYFQVDAVGNPTLDFQAKRQLLLDLLDQYQNYFGNGAQKSQRDSTPSGTGNYLTY
FT                   QNGSDKYTYTQFTYQDIDSLSLTTTSGTNNKIASDVVAALLLFQAADKGTQQLALSAIN
FT                   KPQLNIGDKRIESGLKLLK"
FT   gene            complement(527000..529660)
FT                   /locus_tag="MPNE_0511"
FT   CDS_pept        complement(527000..529660)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86946"
FT                   /db_xref="InterPro:IPR022186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMI8"
FT                   /protein_id="ADK86946.1"
FT                   /translation="MNDTIVAKSDNLEKTSKTNSTFYKDNGDSSEKQGSAESKNSPKTQ
FT                   LKEIFNGQNGDSGNLGKLAEQLQKADSTKMEARSQTWQLRNAVSLKTTNMAQSDEKYVL
FT                   LDAAIPAFETSSQSPQSSGTISGSGALVNLTSTSVNLTQQKSSTTPLNQRIVRNSTGVK
FT                   LLALEGLLYYVVGSSNKQQSSSSTIATSLAQNQSNNNQEQEINSSLQKNLLKFRAFQAK
FT                   NRVFKQGGTKYAFSFPLNETLKGWFDKHRELILANALVKANFDQKDKANKALTEALKPY
FT                   KDLLAEYAPIGLATTMINFLFNQMNAFNKFLERAKALNQNVNQANPTPWLNGLSAKLPY
FT                   VRTNGNYEKLNNYFTFLIVKYMWKKVGNEDASLSKDSSTNKLKTKTEDVNKIRDKILED
FT                   IQKKVQEFVKNKLKPTLAPRQTYSNVILLNVNNDKVWSMGANWALANLLDTSKINPLSF
FT                   MLLKQTFDQNDLFKKAKKLFEDIQSKTNGGSSGGMQGSNTSSSEGADALSKVIGNYYYN
FT                   SWAKLTDKSIYGNPKDNKFDDLFKLAFEDSINEKSFNVDYKAVIEHYRFIYTLEWLVNG
FT                   NLKNFKDLLKANLKFGEIAFIAYKNTETKEFSNPQGVFGSAFNYENETNEVKIAAQNLD
FT                   PNNFFYKTTTKPEEVKTAQNGASMMVMQQKMQSTMQDSNHYGFTGLNTSTSSMLGAATQ
FT                   QAILDQITKNSLQQYGSQQELKTLIEKTNNQLLLDRIASQLSGLNPSTTGNSNNGKGKN
FT                   IATYFQLDAIGNPTLSFQQKRKLLLDVLDQYKDFFGTNTQAAQRDSGKGGHGSYSTYQD
FT                   GSDKITYLQFSYKDIDNLSLSDKGNSKLASDVVAALLLFQAADKGTQQLALSAINKPQL
FT                   PIGDKRIKTGIDLLK"
FT   gene            complement(529968..530795)
FT                   /pseudo
FT                   /locus_tag="MPNE_0512"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(530956..533082)
FT                   /locus_tag="MPNE_0513"
FT   CDS_pept        complement(530956..533082)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87238"
FT                   /db_xref="InterPro:IPR022186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNI0"
FT                   /protein_id="ADK87238.1"
FT                   /translation="MRNSVGVSVLGLDGFVKFIKGGSGGSNGGSSSAKKIDKEEQKKFL
FT                   KFRAFQAKIGTFYNTNFAFSFPLNETLKGWFDKHRGLILANALVKVTLDTKEKASKALV
FT                   DAFSSYKNWLSEYTPIGLATTMISFYFDQMKALNNKLLERVRSLNQNVNQANPTPWLNG
FT                   LSAKLPYVNTNGNYEKLNNYFTFLITKVLWPKVGTEDTNVSEEKSKLKTKTEDVNKIRE
FT                   KILNNIDSKLKTFVQKLKPTLAPRPAYSNVILLNINNDKVWSAGANWSLAVLLDPKKVN
FT                   PLSFMLLKQMFDQNSLFKKAKTLFENIQNKAKTSGSGKSGTTTNDDADALSKVIGNYYY
FT                   NTWAKLTDKSIYGNPKDDKFDDLFKLAFDSSINEKSFNVDYKAVIEHYRFIYTLEWLVD
FT                   KNLKNFKDLLKANLKFGEIAFIAYKNTETQNFSNPQGIFGSYFNYENETNAAKSATQII
FT                   DPNSFFYKTTTKPEAKTTQSANTAVMVQNTQMNNQQTNSYGFTGLSTSSGSMLGAATQQ
FT                   AILDQITKTSLQQYGSQADLKKIIGETKNQLLLDRIANQLIALKPNTSGNSGTQKTIAA
FT                   YFQTDAVGNPTLDFKAKQKLLLDVLDQYKDFFGNNAQAVQRDSGKSGTGNYLTYTDGSD
FT                   KITYLQFSYKDIDGLSLSSSNGTSSKFASDVVAALLLFQAADKGTQQLALSSINKPQLP
FT                   IGDKRIKTGIDLLK"
FT   gene            complement(533143..534246)
FT                   /pseudo
FT                   /locus_tag="MPNE_0514"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(534227..534679)
FT                   /pseudo
FT                   /locus_tag="MPNE_0515"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(534664..535893)
FT                   /locus_tag="MPNE_0516"
FT   CDS_pept        complement(534664..535893)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0516"
FT                   /product="DEAD/DEAH box helicase"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87052"
FT                   /db_xref="GOA:A0A0H3DMU3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMU3"
FT                   /protein_id="ADK87052.1"
FT                   /translation="MHFIQPLQAFLQTKHIVEFSSIQQAVFKVWPRQNVVGIAETGSGK
FT                   TFAYLLPALNQIDVTLNKPQAVVFVPTKELKWQILTILNDIKASFTGLKVSENFNSNAH
FT                   LIVSLIGKDIILHETIKYVVFDEVDMFLEDSSQAEWINCVQLFQKHKPHFGFFSATLFN
FT                   EQLQQIRKQVAPLTVVNQKKRAWKHSLVKHFLLNLNGQEPFAGLLALLNYHHNEQVLVF
FT                   CSNAKSLKQLTSLLAHNQVSFKSLHGQLTPNERKHIFTSAANNTVRVLVVSDLLARGID
FT                   LPHFSVVISWDLPLVDSFYIHRSGRVARFNSWGNSYVFDLPHNQHKLTKFAHKGILFNS
FT                   VHLERDGTLKFPQLKQSKQKPAVSSELKTAIKRIKAGYKKVKPNYKKRQKQQIAELFAK
FT                   RKQRRSWKNF"
FT   gene            complement(535900..539769)
FT                   /locus_tag="MPNE_0517"
FT   CDS_pept        complement(535900..539769)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87127"
FT                   /db_xref="InterPro:IPR022186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN30"
FT                   /protein_id="ADK87127.1"
FT                   /translation="MEGLFKPSSAFADRTDFSLSSILQKSLINRESFNQYLAMRLAPVL
FT                   RTFYDDNYDTDIKERLNGFTADTDNAFVSQEQNLRNQFRENYLVHLQTDIFDNTGGNQA
FT                   AWKLRDVNNKIIDDFISRIFAKNFVEYVQDGVGPLTKPTKSLIENTSNFKNIKLQPKFV
FT                   NKNAKLKINNDAVYAAIQDKLLDQFITNENPNLVSRVVFTNETPVDGFDNYFNTKVIQS
FT                   PTPSYQFQVFNKYNQQSGGTKGANGFNLLASNLKSYKNDQSKGIDIPNKFSSDSGGKLL
FT                   LKASDMFDTFDPSFSAAFIQGYLALQKKSKGADSKEVDSLIKDKSIIENFFVDNNTQAA
FT                   AAARAASSSSEGTIQLKTASDGGGTTQSTVHKTDLVKIFGDKDVFAGEYKQQIGNTNAN
FT                   QTGGGGSGGGGGTSTGSSTGSSTETTTGNSSKAVVDLIEVKKDSSSQPDYILSRGKDGI
FT                   HLMAVDGGSHYLTESGRDVAKQKEFLLFRALQTKYGLVDTDTTYDFKLFDEVKKYFDTN
FT                   RILFLFEALLDLSSDTNNKDNFLSYPQFKKFADSIKSIEKDLKELVQAHYKQAVFNETA
FT                   VAENKVTLKLAERNQPFIDNERNNQIEQNGLAAKLPYEQDAKTGHYNDLGNYYKDIIDN
FT                   VDKKGTSTVKTTSSNTGQTKNFSEEVVSKLKDNKKKVEEAAKKHVEALKVFTIPSPLYS
FT                   QVILVQTKLSFTPESTSLGLNLALNNYLTSTELQNSIKLSYFQEDEAFKKIIDITNLTF
FT                   SQQSGGTGGTNGNNNLTADNWKIFKETYLLDLFESQAQKSIFGHVGSSDKNSSTKTGIE
FT                   GVLDTLYSSLNLEERLDSDDVIDYLSYLYTAHWLLKDNLKNYKQSLQSKLSRTSNAFLV
FT                   WSVDSEKNKNDSQSTLSSTASSTSNTGLIQLRSVVSLAQNQAAGQGGDNNSDITQTEVK
FT                   NPNFVFGSSVYDWTNSKTPEVNRAADDTSSFFYTKSSSSTGAAQSSATVLRSLNQASGM
FT                   TTKTAKNRYGFRGIVTSSTSGSLPEAVSRRLFKQFVNQTEKGVKVGGQMLITTAKSGKA
FT                   TLVLKQQADDAESTTNNAYKGALFSFGSMDNLKNIINGIQTQTEFDALYNHLTSDLNID
FT                   VTGVDKNKTLTEQKTSLTSFVDSNFKQSTQSAQRGDTSARSARSATVQIKKTQEDNQNT
FT                   NYKDVFSRFDGYIGDNKVEEKNYTSYQFLSDGGKYHATFVKQVNLDDVEKIGTDSLKQE
FT                   DSSKDKRLNLSLEEFLAAIALEALDPNNQTQAINALISGNKKGLVKVGDFRIFSSISAQ
FT                   WVRRF"
FT   gene            539929..540738
FT                   /locus_tag="MPNE_0518"
FT   CDS_pept        539929..540738
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0518"
FT                   /product="hydrolase, alpha/beta domain protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87187"
FT                   /db_xref="GOA:A0A0H3DN91"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN91"
FT                   /protein_id="ADK87187.1"
FT                   /translation="MRLEIENGLEFVCDPFLNERGKILFLHAFTGNITNKLSFRTHFKD
FT                   YSFYGINFPGHGNSVIHNQSELDFNFWIKLVQQFFNKYQLKNVVLFGHSIGGGLAIALT
FT                   QVLTKEQIKGIILEAPLNPGIRATPPSIISALVPDTNEDFEAVQRALIYNIEQRFGANF
FT                   KDFCAKQKQKMIQKYAPLKVMLQPEQAEQRLQLIDAAFKRLSYPTLWIHGQEDGIVRYL
FT                   PSKAYLESLHNPLIELVGLSNTAHTTFFEQPQQFLQLVEQFLNKLNK"
FT   gene            complement(540799..541416)
FT                   /gene="rpsD"
FT                   /locus_tag="MPNE_0519"
FT   CDS_pept        complement(540799..541416)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsD"
FT                   /locus_tag="MPNE_0519"
FT                   /product="ribosomal protein S4"
FT                   /note="identified by match to protein family HMM PF00163;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR01017"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87239"
FT                   /db_xref="GOA:A0A0H3DQ07"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ07"
FT                   /protein_id="ADK87239.1"
FT                   /translation="MKYTGSIFKRSRRLGFSLLENNKEFSKGKKRKTIPGQHGNRFRSS
FT                   TMSGYAQQLQEKQRMQYMYGITDKQFRRLFRLVLKQRGNLAVNLFRVLESRLDNIVYRM
FT                   GFAPTRRSARQLVNHGHVLLNDRTVDTPSIILNPGDKVRLKAKTIKIPIVKAASESGVV
FT                   SPFVETNNKTFEGTYVRFPERSELPAGINESYVVEWYKRLVK"
FT   gene            complement(541439..544495)
FT                   /gene="hmw1"
FT                   /locus_tag="MPNE_0520"
FT   CDS_pept        complement(541439..544495)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="hmw1"
FT                   /locus_tag="MPNE_0520"
FT                   /product="cytadherence high molecular weight protein 1"
FT                   /note="identified by match to protein family HMM TIGR03834;
FT                   match to protein family HMM TIGR03836"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86732"
FT                   /db_xref="InterPro:IPR021199"
FT                   /db_xref="InterPro:IPR022466"
FT                   /db_xref="InterPro:IPR038145"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNF3"
FT                   /protein_id="ADK86732.1"
FT                   /translation="MKKSKEAVFEDKDYTEENPEQIFGNLYDGKLTVQDGKVKIAYDGD
FT                   GNGYYIAFNSETGVYYDPYGDTEYDISVLFDANGNPFVFADAPTVEVLAGEQEQTEAEP
FT                   DYLQYVGNEAYGYYDEAGEWVWSGYFEGDQWISTLPQTEAEEKQFGFEDNIETTPTASE
FT                   DFGLEADVPAPEVAEPSYEVQPEVAAEPVYDVQPEVAVEPVGETTATVEPQAVEIQPEV
FT                   VVEPIVESQLEQPVEVQAEMVQPEVAVEPQLEVSLDPIGETAPILEQVEPQAVQTQPEI
FT                   PAEQSAVELQPEPVTEVQSEMVQPEAAAEPVTEAQQTEPTPVVETIAEITPQVVTEPVV
FT                   AVVEHQPEAVAEPLPVEPAVAGVSELIPTEQVQPEVVVESTPVAEVQSEMVQPEVAVEP
FT                   IVEPQPEQPVEVQPEVITTPEVASVLEVQPENPVVEVEQVVEPQPETPVEVQPEPVVET
FT                   VQEAVAEPTPVVEPQPQAAPQPAVYEWNLTPEAAPVEQPEVIPVTVVESQATATAEPQP
FT                   AVAPVADMDYVLHLTDTVKNQPQTAPVQPTTPIKIEVAESTPTVTTSPVEPTIAPPLFE
FT                   IELNNTTSSDLPLVEVVDFKHNQHGAVGTHSFDDFTPPEVGMESKTHCHSNSEVVWRVS
FT                   EPKTVPVPPAVSSINIQTVNRVVEPTISTPTTPVVESAPAIEIFVDTPPVETKEASSNV
FT                   DVVQQPVKPLMPVMVEQLRTTELQPTTEINLFANSDINSIIAELKQGRSNPAINFDDIF
FT                   KMSSYQMVVKKSFVQISDFITNSKTDITNRFLLIKKELQAELTRLIEENEQLKAEFLNA
FT                   KDLSVYQKDELLRSLSNDFTIAHRPSDSYEQLQKSGELVRNIQKAILENESKIKNIQIT
FT                   LKELKAVYKLCSDTVLNGMAKLDSVLRFNKKEKDPLLLNSMETLSSFETEPQAIIEDLL
FT                   DFSSSFDKMSNEQLDEFVYQNLDSGLNLDLDGFDHQLSSMNIHGLEPLDPMKLDDFDFE
FT                   TLTPDKTSNLSSILDDELMENGGDFNLDY"
FT   gene            complement(544559..545356)
FT                   /locus_tag="MPNE_0521"
FT   CDS_pept        complement(544559..545356)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86796"
FT                   /db_xref="GOA:A0A0H3DM36"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM36"
FT                   /protein_id="ADK86796.1"
FT                   /translation="MLMALSFIFNIFSINVTSVLKVSFTRIPFALIGWMFGPVWGFTFG
FT                   AIADTMDWLTRGYTWFWLFAIQKPMFCFLAGLVKGVYQVRQSSTNWKIDFWILQSILIG
FT                   FFVLTLVLLLMYLTDGNFQAAGNQSFGRGFDVNVHILQGITMAAFISFFVGLEIFLGWK
FT                   YTKVKKPKEMILNLYILMMALLMTLVVSLLIGTIASIEYLVFLSGKPSKNFVKYGSYFF
FT                   LMPRVLVQALLMPLYLALFKPLIRIAENNLRNYLRVYNLSWKR"
FT   gene            complement(545467..546813)
FT                   /locus_tag="MPNE_0522"
FT   CDS_pept        complement(545467..546813)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87150"
FT                   /db_xref="GOA:A0A0H3DL91"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL91"
FT                   /protein_id="ADK87150.1"
FT                   /translation="MTFSDLLTKLQDNLDIVFNANALKERIQSDPAFAKTIREQLKLLY
FT                   FLEQKQAKAKTKKKDFQPVFQNLEARFVSLGQTKLANTELNLKLDLTDATDLANYLPIA
FT                   VCNLFNRDLNSFSKLSSVQPTAVEKTTNGANKPTVTIDLNQPRIHTTGTVSPELENFVN
FT                   ESLEARARQRAFMRVTSERMVGKIFEFQFKSQWIKWAQLAIFISMLLIGAAAIAYLVVV
FT                   NLLFYRYVNPDSNLTKAVTGQNNTDRPALVDLNGGINLFFPVSASTLITLIFLGFGSTS
FT                   FLLAFQGKPYSFATRSQTFKAMHFLKHQFGVTDFPRINDNYRYKVRIKWIFWTIFLFVA
FT                   LNALPGGNIITGGILNPSFLLNALRSNELKINSETFKTIFVGFSIFYLASIIPFALISI
FT                   IAFVLSPKPSSDQTNEVLNRYVQEEMQQPFKTDCDPNNDNDLTPPAVFG"
FT   gene            complement(546825..547610)
FT                   /locus_tag="MPNE_0523"
FT   CDS_pept        complement(546825..547610)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0523"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF06144"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86711"
FT                   /db_xref="GOA:A0A0H3DNB8"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNB8"
FT                   /protein_id="ADK86711.1"
FT                   /translation="MVLNQNLFAEDTKPILIHNCSFLEKNNLTKAELHCLKTLKDTDVV
FT                   VTIYSDSPANALINDRAITKYACKPVTAKTIHQVISKAAKTLKLNLNPDLIDHLATILP
FT                   FNLGVIEQELRKLTLLSPAELQDKKMLEAVLCDYQTSQILQLTDAMVRLQTAKALKLIE
FT                   RLFLPKQLTPPQFLEFLANELLLALMVKGVKPQAVFQLQWNVNPFRLKAIQSQYRFWST
FT                   NQLTALINAIWQLDIKIKRNDGLAIHLLKHFVLRFFAQK"
FT   gene            complement(547648..548757)
FT                   /locus_tag="MPNE_0524"
FT   CDS_pept        complement(547648..548757)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0524"
FT                   /product="ComEC/Rec2-like protein"
FT                   /note="identified by match to protein family HMM PF03772;
FT                   match to protein family HMM TIGR00360"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86817"
FT                   /db_xref="GOA:A0A0H3DNN6"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNN6"
FT                   /protein_id="ADK86817.1"
FT                   /translation="MKWKLFYFFTLLTFTPAYFFIEQNQWVILASFLVIVNLISLTVHW
FT                   KFGLLLISCSAALLAYCQLMPEFQLAKLMKANWLRTPFISWLDQHTSGVFNQYLKLFLI
FT                   NETTKNTLYQSAIQLNIVHLFVISGFHLSFLFGVMERWLYKRFYINKITGFVMLLLYLF
FT                   LVGFAFSALRVFVSKLLRQMFPKQLPENNLGLTALLIILMSPGALHNFGFNFSFLACFV
FT                   LFAINKVKLWKPLQAVLTSTLILIVVSPITLHLNRKLNALSVFHNLLFTPIALFYFCAS
FT                   WLLLPLIPWMGNSLVGFYWPLPWLSQWALNTTVFLNLPKPNWVFYLVYYGLWGLLYTVG
FT                   TVFYYDRSLWRRYWVNSPAVKPTAQPSRL"
FT   gene            complement(548797..550815)
FT                   /gene="hmw3"
FT                   /locus_tag="MPNE_0525"
FT   CDS_pept        complement(548797..550815)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="hmw3"
FT                   /locus_tag="MPNE_0525"
FT                   /product="cytadherence high molecular weight protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86713"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKD8"
FT                   /protein_id="ADK86713.1"
FT                   /translation="MTDKERAKLAKAYGKLAQKIQKSYPDINVVYGRDAKNKLHALYQD
FT                   PETGNIFSLEKRKQLPADYPLFELDSDEPISFAPKIIPLTAFDGNNNEVIVQYDQVNNT
FT                   FYDQDGNVLDVSGYRDGENIPLVDYLNYGGSTASADTTTSEPLSGEGYPDIDAGLPVVD
FT                   PDATPEQQADQLFGLDPLPQAPDEYQDTTAPPVYDQTFDQATYDQQAYDQNYDPNAYYD
FT                   QQAYDQSFDQQAYDQAYDANAYNTQNYDQAHDPNAYYDSQAYSDPDQASAVAPIEVAPL
FT                   QPEPVAPVVEPTAVPIVESAPIVEVTPTVEPTPTPVVETAPVVEAPKVVEPTPTPVVEA
FT                   TPAPKVEPKVVEQPQPTPVTVEVDSPKVEIPKVVTAKVALQVAQPTPVPAVPKVAPQPT
FT                   PAPVVVQPTAVVQPVVKAEPKVVTPTPAPQVVVTPQVATPKVTPKVVQTTPAVPPVVVQ
FT                   PEVVVQPIIRPTQPEPEWKPSPASVVEPQPCQSTCVNNESGAITIHTTNRSLLLEKLAS
FT                   LGHLHDASTRTPLPHERYQLAPPSEYVATKYNEPLFNLPAIRNSWARFTRPTVESTPIA
FT                   SRFTGVTPMAVNYRNPASLNFDSLNSFGAYRSPSSFYPLRRPLELSSLRRNRSSFFNTH
FT                   RFDLGSNYTSFTPRYRSPLRGGLSQRFPLRSSWSKEF"
FT   gene            complement(550825..551604)
FT                   /pseudo
FT                   /locus_tag="MPNE_0526"
FT                   /note="cytadhesin P30/P32; this gene contains a frame shift
FT                   which may be the result of a sequencing error; identified
FT                   by match to protein family HMM PF07271"
FT   gene            complement(551673..552254)
FT                   /locus_tag="MPNE_0527"
FT   CDS_pept        complement(551673..552254)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0527"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86852"
FT                   /db_xref="GOA:A0A0H3DNS1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNS1"
FT                   /protein_id="ADK86852.1"
FT                   /translation="MGFFKLLFKLAFLAVLTVAIAYLFLAIFYFGTVSPSFKLAQPMDV
FT                   FNRFFSKEALDTVTTSGVGATVTAPKAAAASQSHALILAAEQVANNANKLDPRFPIDGS
FT                   LFSQIPGYVDFLKKPNIPAFLEKVGPYLTKYIIPLGMALVSGLIGALIINFILSKITRA
FT                   IIKKRRKAKRAQQSRDDDYYYDEAPRRRRR"
FT   gene            complement(552343..553206)
FT                   /locus_tag="MPNE_0528"
FT   CDS_pept        complement(552343..553206)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87096"
FT                   /db_xref="GOA:A0A0H3DLG4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLG4"
FT                   /protein_id="ADK87096.1"
FT                   /translation="MINQANNQVNFSEQQFVHHKRFSVIRLTFSVAAIGILFIFLIGFG
FT                   VQQLLTNTTSLGTLASDIRTLGTIAFVASLVSLILYFVTAFKLRNRNTTLAWFWGLIIA
FT                   DVISYGITLGVLLTLATTQLRELIDFKFSDIVFAFLGAALVYGTVWGLSALPSQQRRYQ
FT                   QTQTLFRIFIWAFFISIIASLLTFVLNFTVFRGGRTNILDLLFPGLSLIVGGIFSLLSV
FT                   YFVCLQIRNEQDLVKLYESQDPALAKAQMWRSALFFGAWLVSSFMNLVYFILRIILLTR
FT                   NLSRAF"
FT   gene            553276..553366
FT                   /locus_tag="MPNE_0529"
FT   tRNA            553276..553366
FT                   /locus_tag="MPNE_0529"
FT                   /product="tRNA-Ser"
FT   gene            553368..553456
FT                   /locus_tag="MPNE_0530"
FT   tRNA            553368..553456
FT                   /locus_tag="MPNE_0530"
FT                   /product="tRNA-Ser"
FT   gene            complement(553532..556549)
FT                   /locus_tag="MPNE_0531"
FT   CDS_pept        complement(553532..556549)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87054"
FT                   /db_xref="InterPro:IPR035158"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKY6"
FT                   /protein_id="ADK87054.1"
FT                   /translation="MKFQRKYWGLLSTLGVSSAVALSACAAQARDVYVTSSASDLLKNN
FT                   SVPMSMFNVSPTSSFFGSKYAGLTTYIATGSNKDDGVNVTTQTQEKLVLELATSVKGYK
FT                   KKDKATSSQKTSTNSSCTTTSSGTSTSGEDDWECIGEIKRQSSSNGQNNQQSKSITEEE
FT                   KFQEISQKATRYEFAIDTGIKWVDNNGKPVKDASGNDVKLSSKDFERGFEAYILSSELR
FT                   FNRNGYFIDLMGLDVKKTVGMTKKNGTQVQMKVASSDEKDGEEKTVKITDDAYNPEDYQ
FT                   STDDSKFNVYLTSPFPFLLSMMSKEFFFPIPHTHPKVKAIKVGKDSPLVYNEKNGSKIL
FT                   DQTKTNFDGIYGGGVNAWRDTWSVGPYYVESFNQSQIVFKRNSEYDTHITPNLPKTREE
FT                   NEKPIPTMINYFQPGATPEVFYSNYIAGGLSSAEVPYSQQEDARSRFAGTGDLRWVKVQ
FT                   KTAQSAQITYSSRPYVVEGETVKTNSNITETEAKFLYNSESEEALTIRAGINGLINWQN
FT                   LAIILLPNSGDLNYSIVPFGIFKEKGKNGASVQQKAVSTTEGSDLMNDYYYKIEKEQRL
FT                   GLIPQREGNYEKNKNVLESATVKINYYSSKATSGQAGAAASAAFAKNNNTSDNTQQNQT
FT                   SSVEAKSVNVTKHSFVQVLKKVGFSGSNPLHFNMKLGNSSLSANGVDYYNAVKQALTEL
FT                   GTADNGEKLIVPEIILGDAQGPTRNEWYIGLSSVLGFSSWSPDYDGVGTWLDAATQLND
FT                   QGGGDVITYSSGAHIVRTLLLAASQKDVHSKFTQKIDQQNTASTTSDVTVKKADSSQDS
FT                   SKSNTEEEKWDDVTSADLFKDDPYVLKNFGDAKAQAAQRSTGSTTSGNGTQASLEFTKK
FT                   ALSLLKFLVDNGILDKEKVKEAIKDPNKYLGKRDKIENGTNKPSKNEDFIGYELKDIYK
FT                   NAAQLNRFNSIWAEKDTDNAKFLITVVDSYFPVLPVPAAGLNETSPTLLKPWFQFRSAP
FT                   SGNGTIRDYGFIPENK"
FT   gene            complement(556773..556857)
FT                   /locus_tag="MPNE_0532"
FT   tRNA            complement(556773..556857)
FT                   /locus_tag="MPNE_0532"
FT                   /product="tRNA-Leu"
FT   gene            complement(556862..556937)
FT                   /locus_tag="MPNE_0533"
FT   tRNA            complement(556862..556937)
FT                   /locus_tag="MPNE_0533"
FT                   /product="tRNA-Lys"
FT   gene            complement(556950..557025)
FT                   /locus_tag="MPNE_0534"
FT   tRNA            complement(556950..557025)
FT                   /locus_tag="MPNE_0534"
FT                   /product="tRNA-Thr"
FT   gene            complement(557027..557102)
FT                   /locus_tag="MPNE_0535"
FT   tRNA            complement(557027..557102)
FT                   /locus_tag="MPNE_0535"
FT                   /product="tRNA-Val"
FT   gene            complement(557110..557184)
FT                   /locus_tag="MPNE_0536"
FT   tRNA            complement(557110..557184)
FT                   /locus_tag="MPNE_0536"
FT                   /product="tRNA-Thr"
FT   gene            complement(557186..557262)
FT                   /locus_tag="MPNE_0537"
FT   tRNA            complement(557186..557262)
FT                   /locus_tag="MPNE_0537"
FT                   /product="tRNA-Glu"
FT   gene            complement(557271..557345)
FT                   /locus_tag="MPNE_0538"
FT   tRNA            complement(557271..557345)
FT                   /locus_tag="MPNE_0538"
FT                   /product="tRNA-Asn"
FT   gene            complement(557373..559070)
FT                   /locus_tag="MPNE_0539"
FT   CDS_pept        complement(557373..559070)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0539"
FT                   /product="cation transport protein"
FT                   /note="identified by match to protein family HMM PF02386"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87248"
FT                   /db_xref="GOA:A0A0H3DNJ0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNJ0"
FT                   /protein_id="ADK87248.1"
FT                   /translation="MTAAHKQKAKLLAWLKLILWGDSISQRIFHFYIYCILLGAVLLFL
FT                   PFALKTDYQKVISYEVDLQGHTISKQTASYGFLDALFLAVSAFSDTGLSTTVVSETYSV
FT                   FGQTVLAILLQLGGIGFVVIAFLVWRLFKLHKKGKYSFYEKLMLQSERGGSKLGTTSEM
FT                   IVVSVLFLFMVELLYGFLYTILFYFIPAFESASVFQSSGKVSNQLKALIVDSTKRLPVV
FT                   HNLNLAFQYGFFHSLSAVNNAGIDLLGANSFAPYRTNWGIVIQWLAISQIIFGGIGYPV
FT                   LFDAYEAIKKRRLYGKYYKHQFSLFTKLAVLTNLIVTAWCFLMLLMVEFIVITSLTNTI
FT                   AHLNVEKAYLVEGLKNKSNQELQSLIFGPIPAASRVMQLWFGVISSRSAGFSVFPWSAE
FT                   SDIIKGIMVIAMFIGGSPSSTAGGIRTTTLAVIFLTLKAKFRGQKEVKVFKRSIDGQTV
FT                   INAFLVAVFGLVSVVLIAILLPLSMQQPLSFVDSLFETTSAFGTVGLSSGATKIMALEP
FT                   TRNLFNYLTLGLLMIMGQVGVSSSVLTFVKKHPQGNSFSYPREDVKVG"
FT   gene            559105..559800
FT                   /gene="trkA"
FT                   /locus_tag="MPNE_0540"
FT   CDS_pept        559105..559800
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trkA"
FT                   /locus_tag="MPNE_0540"
FT                   /product="TrkA-N domain protein"
FT                   /note="identified by match to protein family HMM PF02080;
FT                   match to protein family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87203"
FT                   /db_xref="GOA:A0A0H3DND4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DND4"
FT                   /protein_id="ADK87203.1"
FT                   /translation="MKRADFCIIGLGRFGMQVAHSLKENNFTLVLIDNDQHKTNTAAQE
FT                   FDHVVCCDGSNLTALAELQLEEFSAVIVGVTNIEASIMICANLRELGQKNIIARAKNEV
FT                   HNRVLRTMGIREALIPEKIVGKNLVIRLIHGMETEIINLGNDILFVRAPVNNKKLFNRT
FT                   LGEINIREHTNANLISIMRNGKDVVFPLGPNTQIQPGDVITAVCQLSGVNQYLRYINPN
FT                   DKNKYKASE"
FT   gene            559862..560764
FT                   /locus_tag="MPNE_0541"
FT   CDS_pept        559862..560764
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87116"
FT                   /db_xref="InterPro:IPR022116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLH3"
FT                   /protein_id="ADK87116.1"
FT                   /translation="MVYYEQLQRGLALPNQGSSSGSDSTNQTGAMFGLKVKDATVDSSK
FT                   QSTESLKGEESSSSSTTSSTSTTQRGGSSGDTKVKALQVAVKKKSDSEDNGQIELETNN
FT                   LANAPIKRGSNNNQQVQLKADDFGTAPSSSESGQSGTPTPWTPWLATEQIHKDLPKWSA
FT                   SILILYDAPYARNRTAIDRVDHLDPKVMTANYPPSWRTPKWNHHGLWDWKARDVLLQTT
FT                   GFFNPRRHPEWFDQGQAVADNTQTGFDTDDTDNKKQGFRKQGEQSPAPIALPFEAYFAN
FT                   IGNLTWFGQALLVFGICLS"
FT   gene            560955..562886
FT                   /pseudo
FT                   /gene="mgpC_7"
FT                   /locus_tag="MPNE_0542"
FT                   /note="MgpC protein; this gene contains a frame shift which
FT                   may be the result of a sequencing error; identified by
FT                   match to protein family HMM PF05220"
FT   gene            563339..563869
FT                   /locus_tag="MPNE_0543"
FT   CDS_pept        563339..563869
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87257"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNH7"
FT                   /protein_id="ADK87257.1"
FT                   /translation="MKEKIPFYNEKEFHDMVKKTKKGTFSGWYIINPENNSVEFSGKFN
FT                   RQFKLNKPVIPVNTEYVTRKEFNEYKNSNNQRLTKIETTLAAQGEQINKLTQTVEKQGE
FT                   QINQLVQVVLLHGEQINKLTQTVEKQGEQIRELQVEQKFQGEQIKAQGKTLKSILQALG
FT                   GINKRLDKIDPPK"
FT   gene            complement(564002..564697)
FT                   /locus_tag="MPNE_0544"
FT   CDS_pept        complement(564002..564697)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0544"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87029"
FT                   /db_xref="InterPro:IPR001595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKV6"
FT                   /protein_id="ADK87029.1"
FT                   /translation="MLSACTGIQADLRNLIKETTGKDIDLSKAIKTKEGKKNIIASLKK
FT                   SYEVNPRDTTKLLLDAWKQIFEEGKLGIPDFDFDDVIYPASKDPFTMERKIEHFQMTYQ
FT                   SFKDLSVEDKLSYTFNWFGDYSSGGFTAKKGDKHYFDLFLKIKPDAKKSFTIANFKTEE
FT                   DNSTTIGGKETTRNLEWIEFSASLKFSLKGKDDVSQKSVNKFLSTFANNTEGYSSNINL
FT                   FIYLEYLIK"
FT   gene            565157..565363
FT                   /locus_tag="MPNE_0545"
FT   CDS_pept        565157..565363
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0545"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86943"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKL1"
FT                   /protein_id="ADK86943.1"
FT                   /translation="MKKVKALRNLFLEKASEKLEYPKIASMVAYFDPKEDDTCEFIMKI
FT                   KTVNEVVDTETTNKEKPLGTWKS"
FT   gene            565501..566121
FT                   /pseudo
FT                   /locus_tag="MPNE_0546"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(566185..566519)
FT                   /gene="rnpB"
FT                   /locus_tag="MPNE_0547"
FT   ncRNA           complement(566185..566519)
FT                   /gene="rnpB"
FT                   /locus_tag="MPNE_0547"
FT                   /product="Bacterial RNase P class B"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            566542..566928
FT                   /gene="ssrA"
FT                   /locus_tag="MPNE_0549"
FT   tmRNA           566542..566928
FT                   /gene="ssrA"
FT                   /locus_tag="MPNE_0549"
FT   gene            complement(566971..567753)
FT                   /locus_tag="MPNE_0550"
FT   CDS_pept        complement(566971..567753)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86701"
FT                   /db_xref="GOA:A0A0H3DNA5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNA5"
FT                   /protein_id="ADK86701.1"
FT                   /translation="MPSKTNKKKNVASGGGWMSKINDKLTEINTVEYEVASKHSQYLFY
FT                   SRFGLLDTAAYFLFLLSFFVTAVMFLVGIFHTEQFTLNDQNQGISGFYLFWNVKKPADI
FT                   FNANFVYSISSFGIAILALGLFSLFLMIFLGYRWAISLFIKSQITKWERVIFSTGFYFS
FT                   VVAYCFWIALMLLFLVLSDQHFFPRTTTQLKSNPNLSLFFRISHKDNVFSSRLNQLGAF
FT                   ATALCITLVVYELPFLGLFAFNWNKQRAKAIFCRKRKQ"
FT   gene            complement(567743..568807)
FT                   /locus_tag="MPNE_0551"
FT   CDS_pept        complement(567743..568807)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0551"
FT                   /product="creatinase"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM PF01321"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86856"
FT                   /db_xref="GOA:A0A0H3DM88"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM88"
FT                   /protein_id="ADK86856.1"
FT                   /translation="MHNELQQKLAVLHKLLQDNKADAILIGSDQNRFWLTGFPSSAGWL
FT                   VVHKQRVNLFIDGRYFEAAKTAIDPLVKVELFTTYKQVKALCEQVGVKHLLIEGDYLTF
FT                   NYQNFIKKLCAQYTVINAQEIRRQKLPSEILAIEKVVEITRKVAVKLKRFIQPGMTELF
FT                   IAQWITDQLVKAGGAKNSFDPIVATGKNGANPHHKPSKLKVKSGDFVTCDFGTIYNGYC
FT                   SDITRTFLVGKKPNNEVLLKAYKKVDEANMAGINAANTQLTGAEVDKVCRDIIEASEFK
FT                   DYFVHSTGHGVGLDIHEMPNVSTSYNKLLCENAVITIEPGIYIPGVGGIRIEDMVLVKD
FT                   HKSVWLSAKIPRAF"
FT   gene            complement(568987..569868)
FT                   /locus_tag="MPNE_0552"
FT   CDS_pept        complement(568987..569868)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0552"
FT                   /product="EDD domain protein, DegV family"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86693"
FT                   /db_xref="GOA:A0A0H3DKB8"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKB8"
FT                   /protein_id="ADK86693.1"
FT                   /translation="MKTAIITDSTASIKEGEIQDVYVLPLQVIINGQDTYRDGKDIDYD
FT                   RVYQLLKEHPQGLNISTSLPRQADLIELIEAIKDKYDRFVFLPLSKGLSGTYDMIVQAV
FT                   KPLSTPKKEFVVLETSDIAISLKWLVQEVKALTDTNCPTKAIAEVVDQHKQSIFTAVTV
FT                   KNLVQLRKGGRISGLKKIIATLLRVKPIIFFDKGVNTLSGKAFTFVQALEKIFTFVKSK
FT                   FGDNFKIKRIGFCNAFTPVKAKEVKALILDFLHTNKITLQREIESSFITSAIIAHTGID
FT                   AFSISLLLDKNK"
FT   gene            complement(569874..570680)
FT                   /locus_tag="MPNE_0553"
FT   CDS_pept        complement(569874..570680)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0553"
FT                   /product="hydrolase, alpha/beta domain protein"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM PF05057"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87218"
FT                   /db_xref="GOA:A0A0H3DNE0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNE0"
FT                   /protein_id="ADK87218.1"
FT                   /translation="MASSKSDPFQSIFAFKPHRKRHNFIFLHGFGSEYSSFKHVFKLFE
FT                   KKRWSFFAFNFPGHGNNQSNSVDELKLKHYVELVCDFIIQKRLKKVVLVGHSMGGAIAV
FT                   LVNAVLRERIKALVLVAPMNQTSFVVSKKRILDTLFTRSPKNQQDFIEHTDDKKSIVNF
FT                   FVGAFKKRVNFKTLYSDMVQNAKYGNDYLEAGYNAIKDKPTLVVLGSNDIVTPTKASVE
FT                   YLAKHSETIIFKIIDGVGHSPHYYAPKLFFDYIGEFLDNIKRNKDK"
FT   gene            complement(570667..574089)
FT                   /locus_tag="MPNE_0554"
FT   CDS_pept        complement(570667..574089)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0554"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87146"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLI5"
FT                   /protein_id="ADK87146.1"
FT                   /translation="MTAEKELGIHDFDENLNEQSLLKQLMPKTRNITLEPTRETITVPL
FT                   ERNIVERSFFGELDQLEKEQSIRNFFHFMVDMGVVKSQPHVDVLNHFANQLQVHKPQTV
FT                   DLTMEFLEQEGQEVLTKEIKAGFCEITPSSITEQTTKPQLDETQLVDEYVHTKELETTP
FT                   IPISFATKEVLFEEVFNTPSTQQVDESVLVNEYIELTQQIKNASEQVSSNHTHQFSVAT
FT                   EPAATKAVSETMLLDDYVEMVEQDVQAQTALPQAALDPTVSLTFSSPIDSNAILVYPEM
FT                   KVPHVFDTVAPTTTTVPLDQTQLLDELVEVPVLTHTVTPAPLQPKAAPTNFALDQTQLV
FT                   DELVTVPLTHTLVNESAPVTPVVVTSPAAEHSFSITTVDKANLTNALSQTVVIKPAEDS
FT                   AHQSAVLDKEIATKQVQLQQLQAQIELRQAQLETPPVTYMGVEEYKLLPVQDVVPVQPT
FT                   VSFEMTLLQEQLDKALKHNAALQIQLEEQLAKPLQYDQSPVLQERIELLQNQNTNLTQE
FT                   LNELQQKLFKSQNNSLLLARLEEENRTLKQHLQNNLPEANQLNFVLEKQLEQLQQDKHS
FT                   LTLQIEQYKFDSKKHQEQLALIPSLRSEINSLETEVISLKQTNQRLSLIERENNFLKTE
FT                   IKQLRETKLNDENTKYRNLLKQYELMRADSDAKLKELEHEQHLAHQHHQEQLAQLQRHN
FT                   EALVKELDQVKATNFELGLAAQGFEQQKVVLEQKNSSLLASLQAAEENVHALGITNSEL
FT                   QNQLNVLEFTHKEKTAFDSKTLTLTKQQLEQTQFDLSLTQEQLATFKQQNQSLTDKLMA
FT                   SETQLNHLQQSDENLTQLQTQHELLQESYNKLQDEANHTQQQFHQAQNELDAAHQQLAL
FT                   FKQNNEELTDKCSNIQNELHDLNRVKTNWENLNTEHNLLQDKYAQQKEQMQHEHSNLAQ
FT                   IQAEHELLQESYNKVKAELNEIQITNLNEANAQYQDLLSAYELLQSNHNKLKQELQVLN
FT                   QVNLEKQQLAQKLHNTHQSLSQTHAELTQLQAAYNNLQATPPVSDELLEQFNQVQLEKQ
FT                   RLLQQNLALVHELQYFNELNSSQTHEIKTKQDETVKEVIIVEKEIPVLPEKKPRLKKRD
FT                   IVIENKEDALGKLSKKERIQAYAERLAKINGKQ"
FT   gene            complement(574126..575475)
FT                   /gene="engA"
FT                   /locus_tag="MPNE_0555"
FT   CDS_pept        complement(574126..575475)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="engA"
FT                   /locus_tag="MPNE_0555"
FT                   /product="ribosome-associated GTPase EngA"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF08477; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR03594"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87018"
FT                   /db_xref="GOA:A0A0H3DP78"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP78"
FT                   /protein_id="ADK87018.1"
FT                   /translation="MFTVAIIGRPNVGKSSLFNRLIQKPYAIISDTPNTTRDRIYGVGE
FT                   WLTRQIAFIDTGGLISQKTPLQQQIEVQVRAALSQANAIIFLVSYQEQISSDDFYVAKV
FT                   LKKIKDKPILLVVNKSENLKPDAYEPNLQQFYSFGFGQPVCVSASHGIGIGNLMDRLVK
FT                   DNQLPPYHGSSETNPEVRFCVIGKPNVGKSSLINQLVQQNRVLVSDESGTTRDAIDIPL
FT                   RVNGQNYLLIDTAGIRRKGKIAPGIEAASYGKTQLAIARSNIILLMVDGSKPLSEQDEI
FT                   IGGLAQAALIPVIILVNKWDLVQKDSNTMAKFKKQLQSQFQHLSFAPIVFISVKNNKRL
FT                   HTIFEQLQIIQEQLTKKISTSLLNDVIQQAQLFNQAPLFKGGRLQVTYAVQTHSQTPHF
FT                   VLFCNDPKFVHFSYARFLENKIRESFGFSAVPITLYFKSKNARIRGVAKT"
FT   gene            complement(575477..576130)
FT                   /gene="cmk"
FT                   /locus_tag="MPNE_0556"
FT   CDS_pept        complement(575477..576130)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="cmk"
FT                   /locus_tag="MPNE_0556"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="identified by match to protein family HMM PF02224;
FT                   match to protein family HMM TIGR00017"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86909"
FT                   /db_xref="GOA:A0A0H3DKZ6"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKZ6"
FT                   /protein_id="ADK86909.1"
FT                   /translation="MYFQIAIDGPSSSGKSSVAKTVARQLGFEYFSTGKMYRAFAYVMQ
FT                   VNRLDVNLLLKVINQINWRFEHEKVFYNNADISEVILNQEIAQLASNLATNPEVRKMAV
FT                   LRQQALAKNTNIVMDGRDIGTVVLKDAQLKYFLDAKPEIRAQRRAQDLGIAYDSDKAFQ
FT                   ELVAEIKHRDAVDTSRTADPLVQAPDAIYIDSSNLTFQQVVELMVQQARTVFKL"
FT   gene            complement(576157..576786)
FT                   /locus_tag="MPNE_0557"
FT   CDS_pept        complement(576157..576786)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0557"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86865"
FT                   /db_xref="GOA:A0A0H3DM69"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM69"
FT                   /protein_id="ADK86865.1"
FT                   /translation="MGRLEKFRFYRQNDDNNTTVQKALLKAQKQVASWKVELDELSPKI
FT                   LSHYQPFSELSANPVKRKSEPNQVLQSLQTLINNFQTSDFQAIATQADALWLQIKHHDS
FT                   ATGYESWITDDRGMDKIDNLKRFFEDNEQQFIQQTQTFVVQLGNYNKALMALTNEKVSF
FT                   TTTDLSQPLASSYNPLFKRILLSLLVFFISSLVGLVVLLTLLFTSL"
FT   gene            complement(576789..577496)
FT                   /locus_tag="MPNE_0558"
FT   CDS_pept        complement(576789..577496)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0558"
FT                   /product="DNA-binding regulatory protein, YebC/PmpR family"
FT                   /note="identified by match to protein family HMM PF01709;
FT                   match to protein family HMM TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86810"
FT                   /db_xref="GOA:A0A0H3DM17"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM17"
FT                   /protein_id="ADK86810.1"
FT                   /translation="MPRKHLIASQTNKKQQSNAKQLQKLAKRIAAAVKKGGSNIDANPQ
FT                   LKVAVELALAHGLSADSIKRNIHGSEKDPTKLSEFCYEIFGPNGVGIIVFGLTDNPNRL
FT                   LSSLNGYIAKLKAQLAKPNSVKINFEEKGIALVKHNNFTQDELIELLISNNINLLDLNE
FT                   DDDSFEVVVDSPSYFALKDLLVKNSFTIEASELRLIPLLTVELNAEQHTLLNRFLNACE
FT                   EDDDIQTVVHNAL"
FT   gene            complement(577500..578093)
FT                   /locus_tag="MPNE_0559"
FT   CDS_pept        complement(577500..578093)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0559"
FT                   /product="putative NAD(P)H dehydrogenase (quinone)"
FT                   /note="identified by match to protein family HMM PF02525;
FT                   match to protein family HMM PF03358"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86688"
FT                   /db_xref="GOA:A0A0H3DKB3"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKB3"
FT                   /protein_id="ADK86688.1"
FT                   /translation="MKKVIIIDASVSPSGSYTHLLLERFLATFQAKNKDVELSTWNLNE
FT                   LPVGQISYNTQNAGTFFSVENSDKYIDALKAAHGVIILAPMTNFNYPATLKNFIDHVFV
FT                   ANKTFKDKYVTKGASSGMLGNLKVVVLGSQGAPLGWYPWGDHVNSLRGLFGFAGVASFA
FT                   SVIIDGTKLLYKDKSKSEVVDMFAKQVDAIANEF"
FT   gene            complement(578121..580637)
FT                   /gene="valS"
FT                   /locus_tag="MPNE_0560"
FT   CDS_pept        complement(578121..580637)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="valS"
FT                   /locus_tag="MPNE_0560"
FT                   /product="valine--tRNA ligase"
FT                   /EC_number="6.1.1.9"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00422"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87032"
FT                   /db_xref="GOA:A0A0H3DMS3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMS3"
FT                   /protein_id="ADK87032.1"
FT                   /translation="MDKQFSFQGQYDFKTVSTGLYDSWSSASFFKPQKNKVPFTAILPP
FT                   PNLTGTLHIGHAFEVSITDQIMRFKRLRGYGVNWIPGFDHAGIATQTKYEKLARETNPE
FT                   YFQAPRKQKVKMIMDWALTQGDTIQSQLKSLGASLNWNQVNFTLSKKASQIVNDSFIQL
FT                   FEQGFIYQAETLVNWDTKLNTAISNIEVINKPVDQQLYYIAYKLANNPKKRLVVATTRP
FT                   ETIFVDVCLFVHPKDKHYHSFVKQKVVNPLTGALMPVFTDSYVDKKFGTGVLKCTPAHD
FT                   FNDFALNEKYRLPFVSCIDHNGLLNEHAKQFTGLTVSAARQQVVEFLQTQKLLVKTMPL
FT                   TSNVGFSERSDTVVEPLLSKQWFVDLPKLKKALAIKKYPELIPKRFNKQVTRWLSQLKP
FT                   WCISRQLIWGHPIPVWTHKQSGALHVGSTAPTDKQNYTQSTDVLDTWFSSSLWPLICLD
FT                   WHKNKHFVPTDLLVTGYDILFFWVLRMTFNSYFQTKQLPFKQVLIHGLVRDAQNRKMSK
FT                   SLNNGINPMDLIRDYGADATRLFLTSNHTPGDDLIFNEQKLKSAANFLNKLWNVTKYVL
FT                   QLGEQAKTVPSTHLPSTLSERWIWAKLKQLIVQTTKLLDKYQLALANQALVNFIWNDFC
FT                   NTFIETIKQEDTALLPQLYTTAKTVLSTAVVMLSTVTPFLAERIYQQFHSGSVMQASWP
FT                   TAKAVKPPKLFADVVEAVSSLRHYKANNQLVANQNLTVVLSGKAAPVVQNYFHFNWVDL
FT                   RIEVNKTPGFQIKIVDNAANNLAHLEKQRSFYLAEVQRSQAINTNPAFLKKAPPHKVKA
FT                   ELLKLEEYQKKLAEVNHLIAKLTKAE"
FT   gene            complement(580621..581202)
FT                   /gene="ysxC"
FT                   /locus_tag="MPNE_0561"
FT   CDS_pept        complement(580621..581202)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ysxC"
FT                   /locus_tag="MPNE_0561"
FT                   /product="ribosome biogenesis GTP-binding protein YsxC"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR03598"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86905"
FT                   /db_xref="GOA:A0A0H3DMA9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMA9"
FT                   /protein_id="ADK86905.1"
FT                   /translation="MEARFLKSASDLESCPQDSVKEVCFMGRSNVGKSSLINAFFQKKL
FT                   AKTSATPGRTQLLNFFEYNRKRFVDLPGYGFAKLSKVQKEAITNLLTQFLNFRQNLTGV
FT                   VLVIDSGVVTVQDQEVVKTILQTGLNFLVIANKFDKLNQSERFHTQNKLAHFLKVNPNK
FT                   CLFVSAKTGYNLQVMHKQIFELFKADGQAI"
FT   gene            complement(581210..581431)
FT                   /locus_tag="MPNE_0562"
FT   CDS_pept        complement(581210..581431)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03672"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86682"
FT                   /db_xref="GOA:A0A0H3DJU3"
FT                   /db_xref="InterPro:IPR005359"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DJU3"
FT                   /protein_id="ADK86682.1"
FT                   /translation="MNDLALALGLGIPLSLLVGVIIGYFISIKIFKKQIRDNPPITENQ
FT                   IKAMYAKMGRKLSETQVKEIMRSIKNQK"
FT   gene            581490..582515
FT                   /locus_tag="MPNE_0563"
FT   CDS_pept        581490..582515
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0563"
FT                   /product="glycosyltransferase, group 2 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86762"
FT                   /db_xref="GOA:A0A0H3DNH8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNH8"
FT                   /protein_id="ADK86762.1"
FT                   /translation="MNKLISILVPCYQSQPFLDRFFKSLLKQDWNGVKVIFFNDNKPDP
FT                   TYEILKQFQQAHPQLAIEVHCGEKNVGVGGSRDQLINYVDTPYFYFVDPDDEFSDPNCF
FT                   KAIVETIQGENFDIAVLNSIVYLQMLKNDFLIKHIPLKNIFQGKVKLNPDNTVNHLHYI
FT                   QNNDQYIWNIVINTAFFKALDLQFVNRFIEDIAVWFPIMFKAQKVLWIDVNGVNYYLRP
FT                   NSASTQKNSIKLLSFIEAYERLYFHLKKVGKLADFIDPNNKIESRFWRRQAFIWFSFIN
FT                   VSWMKAEFEQTKSVLQKLFDFMEANGIYDRVFTNKHHGIYLLWVNRLKHFKKLVQAQPH
FT                   L"
FT   gene            complement(582526..582810)
FT                   /locus_tag="MPNE_0564"
FT   CDS_pept        complement(582526..582810)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0564"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86819"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKQ0"
FT                   /protein_id="ADK86819.1"
FT                   /translation="MQVVAIFSISKKQILIMKNKKIIKLPFIDHAMNSLNQSELISFVA
FT                   FNEANEDNKRTLYIKIHANQKEMVVQAQDGKQTLEREQLFKKLLEALAC"
FT   gene            complement(583020..583397)
FT                   /locus_tag="MPNE_0565"
FT   CDS_pept        complement(583020..583397)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86896"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMC7"
FT                   /protein_id="ADK86896.1"
FT                   /translation="MKKDKIKTSKAWIEDLPDGSYDMGFYGNLNHMEKRKSGYVTQKQF
FT                   NDFKNSNNQRLIKIENTLVSQGEQISQLIKVSILQGEQINKLTETVEKQGEQIQTQGET
FT                   LKLILETLQVINKRLDRLESK"
FT   gene            complement(583748..585193)
FT                   /locus_tag="MPNE_0566"
FT   CDS_pept        complement(583748..585193)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPC4"
FT                   /protein_id="ADK87058.1"
FT                   /translation="MLYLFPLTQAFFAYQAPKDGLDSLYDQAAIGSALQLVYAFPAFRE
FT                   PNNGQSQGKTTFDPTPNSAQNFGDFIKAVFPEQKNGQTQQSNTSSRTGLFDWQTKWNSN
FT                   GAANKLLVTKSNLRGAFKGVGLATAIIDQYEYLVGGSKTSSLPEVKVDSNKSNQNPLDS
FT                   FFMEGKDAVAIRSIVSRAKIAMTDQTPGFKVDPAFVKVKQNNQTDAFYTTQRKLSGGQT
FT                   NGGSNNSNDKHHYLQDAVRLTSSQAMAAASTGADSSSGTNVGGSSGGNSVLIPLPRSAA
FT                   LTHTQQQVQQTTSTLQTPVYARGDDGTYALAIDGGDYFLANNKRDFTKQADILLYRYLQ
FT                   AKSNNFKENGVEFSLNLLESGSLFQTWAQTGLTAKLYGALVAMMGSGQGTQVKGSVQGS
FT                   SRAASVSVQTTQQSRQQSTDTQESEVVKLAKALLKSSADLAKPFTDNPTFKKALTDIQS
FT                   EYKDYLAAAGKLSEFKKDLGEVS"
FT   gene            585287..586513
FT                   /locus_tag="MPNE_0567"
FT   CDS_pept        585287..586513
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0567"
FT                   /product="aminotransferase, class V"
FT                   /note="identified by match to protein family HMM PF00266"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87231"
FT                   /db_xref="GOA:A0A0H3DLS6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLS6"
FT                   /protein_id="ADK87231.1"
FT                   /translation="MTKTKFNPYQFRKQFKWFKNNPQWVNFDNAATSIALDTVSQACKE
FT                   YYELFSVNPHNKTPDLNNQIIAIIAETRQLVADWFNVTAPEIIFTSSATESINLFAHGL
FT                   KPWIKPGDEIVLKGDEHSANVLPWVALAKQTKARLVWVEKQANQSLEDTFKSLINPKTK
FT                   VVAITATSNLFGNSIDFAQIADYLKQVNPKAFVAVDAVQTVQHKQIDIAKTQIDFLAFS
FT                   THKFYGPTGLGVAYIKKSLQPQLQPLKLGGDIFTQIDPDNTIHFKSTPLKFEAGTPNIM
FT                   AIYALNKLLRFFKQKFNFAQMMAYGHQLKQQAYELLNSNPQIVLANHDQDVPIFSFKHR
FT                   QLATIDLATFLNINKIMVRQGSICVGRYRNKDYFVRVSLMHYNTVKELQYLAKLLATDT
FT                   KTIIKNVIK"
FT   gene            586516..586938
FT                   /locus_tag="MPNE_0569"
FT   CDS_pept        586516..586938
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0569"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86756"
FT                   /db_xref="GOA:A0A0H3DM02"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM02"
FT                   /protein_id="ADK86756.1"
FT                   /translation="MDRKIREQIIAIYSNLQHKQDLTQFAHCLTTKADDNCEDFFNLGL
FT                   QFQNNQLTALGFNGEGCIISTIASELTLSALEGKTIKEAIVLLEQFMEAVQTGSLSTPL
FT                   PQALQLLWDFQIDQKRLNCLLLTPQNLLQWLKDFSH"
FT   gene            complement(586919..591019)
FT                   /pseudo
FT                   /locus_tag="MPNE_0568"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(591519..592529)
FT                   /gene="recA"
FT                   /locus_tag="MPNE_0570"
FT   CDS_pept        complement(591519..592529)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="recA"
FT                   /locus_tag="MPNE_0570"
FT                   /product="RecA protein"
FT                   /note="identified by match to protein family HMM PF00154;
FT                   match to protein family HMM TIGR02012"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86658"
FT                   /db_xref="GOA:A0A0H3DK84"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK84"
FT                   /protein_id="ADK86658.1"
FT                   /translation="MVQKEMINKKISQDNSFIQNNNLADFDFLDAKKNSEIKTVSTGSL
FT                   HLDEALGTGGLPLGRIVELYGNESSGKTTVALHAVASFQKAGKVACYIDAEGALDLSYA
FT                   KAIGIDLGKLLVAHPKHGENAFALMESLIKTNKVALIVVDSVAALIPKQELEGNMDDQT
FT                   IGLHARMMSKGLRRVQSLLPESDTCLLFINQLREKPGVMFGNGEVTTGGRALKFYASMR
FT                   MEAKRSELLKDRFGNYVGIKSKLTVSKNKVARPFGVAFLEIMFNRGIVYEHEVIELALK
FT                   HNVVVRSDNAYSFKSQNIAIGKEKLFSVLAEKPELFEQIKQLTIKQIHSPPPPAS"
FT   gene            592603..594027
FT                   /locus_tag="MPNE_0571"
FT   CDS_pept        592603..594027
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0571"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86702"
FT                   /db_xref="GOA:A0A0H3DJW5"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DJW5"
FT                   /protein_id="ADK86702.1"
FT                   /translation="MKLTLWLVLGAVGVGAVGTGVGFGTKYFLDHKAKSNVDVAFKQRS
FT                   LRKQVNVGFWNALNFLGSERSFGNQNSKVKTKGIAEIINLLKYDIVGLAEIQPSTESTA
FT                   ERFVDQLNEYADPYTSWSYDLSPVTTSKTASEGQKERILIVYNSQSVKMEGQGWFYDNP
FT                   EMDISNYVSDGSSSKTRTPKKTKTSKKKPTKKKSSRSKSSKGSKKQKTTNESESETLEL
FT                   KLEQRRVTTRSQSKQQKGQEQATDQTDSEGVTTEEGADNTDTELVETTAETTEQEATTE
FT                   STKDTKETKDRIKVDWSRPPYSAEFSTQKGKVVVAFGHFDSPGANTKRGEKIAKMGKGQ
FT                   GAHEYFEAQTTFKAMDSIKQHFNNENILFMADTNIKFGNQAAAFGESKDYTFLTEDNEA
FT                   WKSSLGTKSGYANPYDKIITSNSFKNKVLNQAEPYWNYFDRYLKTKGHNSYLFDLASWG
FT                   TKPRTISDHAPVGVLF"
FT   gene            complement(594166..595044)
FT                   /locus_tag="MPNE_0572"
FT   CDS_pept        complement(594166..595044)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0572"
FT                   /product="putative hexulose-6-phosphate isomerase"
FT                   /note="identified by match to protein family HMM PF01261;
FT                   match to protein family HMM TIGR00542"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86740"
FT                   /db_xref="GOA:A0A0H3DLV5"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLV5"
FT                   /protein_id="ADK86740.1"
FT                   /translation="MSFTSTENKHLLGVYEKAINNKFAWKDKIAIAKQASFDFIELSID
FT                   ESDARLQRLDWSDTEINQLHNELQAQTFCLNSMCLSAHRRFPLGSKNKTTVQQGLTIFE
FT                   KACVLARKLGIRIIQLAAYDVYYEPHDTETERNFITNMRKVAELAQKYAVTIAFEVMDT
FT                   PFAGTIVRCLNLIKRIGKANILLYPDIGNLSQFSTAVFDEIALGQDKIVGFHFKDTLPK
FT                   QFKEVPFGTGTAQFEAALKAIHQYVPTVPILIEMWSKNDPAESTVQNVAQLKQAKQFYE
FT                   QQWDLALKRVK"
FT   gene            complement(595019..595675)
FT                   /locus_tag="MPNE_0573"
FT   CDS_pept        complement(595019..595675)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0573"
FT                   /product="putative 3-dehydro-L-gulonate-6-phosphate
FT                   decarboxylase"
FT                   /note="identified by match to protein family HMM PF00215"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87155"
FT                   /db_xref="GOA:A0A0H3DL96"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL96"
FT                   /protein_id="ADK87155.1"
FT                   /translation="MALPLIQIALDNLSLASALNDLAKVGDAVDVIEVGTILLTAEGVN
FT                   AVKEIAKRYPHKLIVADGKIADAGKVFSQMFFDAGAHFTTVICAAELPTVKDVVTVGNS
FT                   YTPIKETQVEMTSNFTWEQVTQWKQVGVQQVVWHRSRDAQAAGVNWSDKDLQAVKRLAD
FT                   LGFKVTVTGGITLNDIQLFKDIPIYIFIAGRTIRDASDPLQTVQQFKDEFHKYWK"
FT   gene            complement(595677..596156)
FT                   /locus_tag="MPNE_0574"
FT   CDS_pept        complement(595677..596156)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0574"
FT                   /product="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87223"
FT                   /db_xref="GOA:A0A0H3DNE2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNE2"
FT                   /protein_id="ADK87223.1"
FT                   /translation="MTKLDFKAVLKQHHTVRLHQTAQDWKQAIQLCIHPLIAAKLVQPA
FT                   YFDDILKSVAQYGPYFIIAENVAMPHAQNNGTVQQNCFSLVTLKEPVYFDNDPRPVRLL
FT                   IGLAATSAAIHTTEALPQIAALVEDTQVVKDLLDCCDETSLFAVIDRVNLHKYLT"
FT   gene            complement(596158..596445)
FT                   /locus_tag="MPNE_0575"
FT   CDS_pept        complement(596158..596445)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0575"
FT                   /product="PTS system, Lactose/Cellobiose specific IIB
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87101"
FT                   /db_xref="GOA:A0A0H3DLG7"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLG7"
FT                   /protein_id="ADK87101.1"
FT                   /translation="MENKKLHIIAACGNGMGTSMLIKIKVEKIMKELGYTAKVEALSMG
FT                   QTKGMEHSADIIISSIHLTSEFNPNAKAKIVGVLNLMDENEIKQALSKVL"
FT   gene            complement(596448..598430)
FT                   /locus_tag="MPNE_0576"
FT   CDS_pept        complement(596448..598430)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0576"
FT                   /product="putative sugar-specific permease, SgaT/UlaA"
FT                   /note="identified by match to protein family HMM PF04215"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86973"
FT                   /db_xref="GOA:A0A0H3DKN9"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKN9"
FT                   /protein_id="ADK86973.1"
FT                   /translation="MLNKIKLQQKRKLIIGWSVFALINLVVILLTVLLRAGLPNLVSKG
FT                   VTPFSAQAFGDAFIFLITRVYLDNFLRQPALLLGVITLIGYLALGRGGVQSVVGALKTV
FT                   IGFILLSIGSGVLVSTARPVFDTIKGLGGTGVVLLDPYFSLASANDFFTNSFLNNDYVS
FT                   LIAFSLLVGFIVNIIFVGLKRWTNTNSIMVTGHVMLQQAAVVTTLFYIVLFRQIPLLGT
FT                   GIAYGAQAGLVIISGIFLGVYWSTASTGTYLVTNKVTNNAGFSIGHQQMLGIMTVAKLG
FT                   KYFGDKNDSAEHKKLPKALKIFEDNIFTQTIIILSLFVVLFIVILASYKGDKPLLINWD
FT                   KFGAINGLEIWNTTFGGANFTLNIIGGALKMVASLIAIMTGVRMFITELQQAFQGISEK
FT                   VVPGAVVAVDIAAVYGFSINSVTFGFLSGVIGQFLAVAIMAGISYIPGNQFSFVAIPLF
FT                   ITLFFNSGAFGVYANAEGGWKAALLLPGIIGFLEIIVISFALRTVSNAYQASALLDAKQ
FT                   SFDLKALMGNSLDNNNGSALKTAVEKVVNATGVNRITEAQSFVKSDSFNSLKAVNSTLA
FT                   QAIEWISKSASPVDNGFIGMADWNLYFGLLVWIGAYNVIGGWILVILATVGLILLAQII
FT                   DNGKQTKVTKLQQLLKINPQLDLNN"
FT   gene            complement(598430..598573)
FT                   /pseudo
FT                   /locus_tag="MPNE_0577"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(598639..598764)
FT                   /pseudo
FT                   /locus_tag="MPNE_0578"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(598858..599289)
FT                   /pseudo
FT                   /locus_tag="MPNE_0579"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(599323..599484)
FT                   /locus_tag="MPNE_0580"
FT   CDS_pept        complement(599323..599484)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0580"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87050"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLC7"
FT                   /protein_id="ADK87050.1"
FT                   /translation="MKRFVRTVLGDIDPKDLGICDCHDHLIKNWGPEAKEHPDFVMLSN
FT                   EAAIKECL"
FT   gene            599600..600328
FT                   /gene="araD"
FT                   /locus_tag="MPNE_0581"
FT   CDS_pept        599600..600328
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="araD"
FT                   /locus_tag="MPNE_0581"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="identified by match to protein family HMM PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86727"
FT                   /db_xref="GOA:A0A0H3DNE9"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNE9"
FT                   /protein_id="ADK86727.1"
FT                   /translation="MDQKMINDLKEQVFQTNLLLPKYGLVIHTWGNVSMIAPNRQFFVI
FT                   KPSGVSYDKMRAQDMVVVDLDNNVLDTNGLKPSSDTPTHALMYKHCPDIKAIVHTHSTL
FT                   ATSFAQADKPIPCLGTTHADNFFGPIPCTRALSDSEINGAYEHNTGLVILEHLKNNQVD
FT                   VNACAAILVKEHGSFVWSNKNGKDAVDRALTLEQVAQMALYTQMINPHMKEANPALQQK
FT                   HYNRKHGKDAYYGQNTKQED"
FT   gene            600300..600773
FT                   /locus_tag="MPNE_0582"
FT   CDS_pept        600300..600773
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86809"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKN7"
FT                   /protein_id="ADK86809.1"
FT                   /translation="MDKILSKKIKVNWLGGVFWLLPNLLDLFSASKRKASVRPYQSLLE
FT                   LVQENFLNRYDLVHFSFNGDHDFFHFNDLQAIRSFNFTIEEEQLGAMQPDEVLLFEPVD
FT                   RVTVELDQKGLSLIHSGKAFCASANYFKHWLKRVPQQDKVTLVWRKSGFELKQ"
FT   gene            600849..602501
FT                   /locus_tag="MPNE_0583"
FT   CDS_pept        600849..602501
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0583"
FT                   /product="adhesin P1 domain protein"
FT                   /note="identified by match to protein family HMM PF03257"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86851"
FT                   /db_xref="InterPro:IPR004940"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM85"
FT                   /protein_id="ADK86851.1"
FT                   /translation="MLDQVLDYIPWIGNGYRYGNNHRGVDDITAPQTSAGSSSGTSTNT
FT                   SGSRSFLPTFSNVGVGLKANVQGTLGGSQTTTTGNNIPKWPTLDQANLQLWTGAGWRND
FT                   KTTSGSTGNANDTKFTSATGSGSGQGSSSGTNTSAGNPDGLQADKVDQNGQVKTSVQEA
FT                   TSGDNLTNYTNLPPNLTPTADWPNALSFTNKNNAQRAQLFLRGLLGSIPVLVNKSGQDD
FT                   NSKFKAEDQKWSYTDLQSDQTKLNLPAYGEVNGLLNPALVETYFGNTRASGSGSNTTSS
FT                   PGIGFKIPEQSGTNTTSKAVLITPGLAWTPQDVGNLVVSGTSFSFQLGGWLVTFTDFIK
FT                   PRAGYLGLQLTGLDVSEATQRELIWAKRPWAAFRGSWVNRLGRVESVWDFKGVWADQAQ
FT                   LAAQAATSSTTTTATGATLPEHPNALAYQISYTDKDLYKASTQGSGQTNSQNNSPYLHF
FT                   IKPKKVESTTQLDQGLKNLLDPNQVRTKLRQSFGTDHSTQPQPQSLKTTTPVFGRSSGN
FT                   LSSVFSGRGAGGGSSGSGQSGVDLSPVERVSGH"
FT   gene            602568..602867
FT                   /locus_tag="MPNE_0584"
FT   CDS_pept        602568..602867
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0584"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86932"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNZ5"
FT                   /protein_id="ADK86932.1"
FT                   /translation="MSLPTLSNLVNEYPKSMKLVKLARLHRFLKQDQLQLVPLFSPNFL
FT                   QVLLALLNKLVNLFSENTTMKTNKKYAFAALLMQAQAKLPNSFKFFLSKKGGMA"
FT   gene            602867..603475
FT                   /locus_tag="MPNE_0585"
FT   CDS_pept        602867..603475
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86920"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMC2"
FT                   /protein_id="ADK86920.1"
FT                   /translation="MKEKIPFYNEKEFHDMVKKTKKGTFSGWYIIDKDNNSVEFSGKFN
FT                   RQFKLNKPVIPVNTEYVTRKEFNEYKNSNDQRLTKIETTLAAQGEQINKLTQTVEKQGE
FT                   QINQLVQVVLLHGEQINKLTQTVEKQGEQIKELQIEQKAQGETLKLILQTLQKMSDRLD
FT                   KMEVKMDKMEVKMDKMEVKMDKMEEKNRQTWVQITNAQK"
FT   gene            603903..605171
FT                   /locus_tag="MPNE_0586"
FT   CDS_pept        603903..605171
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87007"
FT                   /db_xref="InterPro:IPR022116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMP4"
FT                   /protein_id="ADK87007.1"
FT                   /translation="MRDNIAKGITAGSNTQQTTYDPTRTEATLTTATTFALRRYDLAGR
FT                   ALYDLDFSKLNPQTPTRDQTGQITFNPFGGFGLSGAAPQQWNEVKDKVPVEVAQDPSNP
FT                   YRFAVLLVPRSVVYYEQLQRGLALPNQGSSSGSGQQNTTIGAYGLKVKNAEADTAKSNE
FT                   KLQGYESKSSNGSSSTSTTQRGGSSNENKVKALQVAVKKKSGSQGNSGDQGTEQVELES
FT                   NDLANAPIKRGSNNNQQVQLKADDFGTAPSSSGSGTQDGTPTPWTPWLTTEQIHNDPAK
FT                   FAASILILYDAPYARNRTAIDRVDHLDPKVMTANYPPSWRTPKWNHHGLWDWKARDVLL
FT                   QTTGFFNPRRHPEWFDGGQTVADNEKTGFDVDNSENTKQGFQKEADSDKSAPIALPFEA
FT                   YFANIGNLTWFEQALLVFGICLS"
FT   gene            605364..607049
FT                   /pseudo
FT                   /gene="mgpC_8"
FT                   /locus_tag="MPNE_0587"
FT                   /note="MgpC protein; this gene contains a frame shift which
FT                   may be the result of a sequencing error; identified by
FT                   match to protein family HMM PF05220"
FT   gene            607440..607820
FT                   /locus_tag="MPNE_0588"
FT   CDS_pept        607440..607820
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0588"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87273"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNL7"
FT                   /protein_id="ADK87273.1"
FT                   /translation="MKEKISEKEYKALIRKTGKEHFDGEKEEYGDGTVGVWTYELRKYK
FT                   LKPPVKVKYVTQEQFQEYKDSNNQRLIKIENKVDKLVEIVQIHGEQIKAQGETLQLILQ
FT                   TLQKMSDRLDKMEKRIDKLESK"
FT   gene            complement(607888..608649)
FT                   /locus_tag="MPNE_0589"
FT   CDS_pept        complement(607888..608649)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0589"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00938"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87078"
FT                   /db_xref="InterPro:IPR001595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPE8"
FT                   /protein_id="ADK87078.1"
FT                   /translation="MRKKRLLSRISFSSLFLLCGTVLSAYTGIQADLRNLIKETTKKDI
FT                   DVYKAIKTTEGKKNIITSLKKSYEVNPKDTTKLLLDAWKQSFEKGELGIPDLDFEDVIY
FT                   PKTSEPFKFERKVDHFQMTYQSFKGLSIEAKLSYNFNWFGDYSSGGFTAKKGDKHYFDL
FT                   FLKIKSNSDPKKQFTTEKFLTKEEKNKVNGKEITRNLEWIEFSASLSWLIKGKDDVSQK
FT                   SVKQFLSSYANNTSGYSRDINLFIYLEYLIK"
FT   gene            609082..609288
FT                   /locus_tag="MPNE_0590"
FT   CDS_pept        609082..609288
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0590"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86814"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKP3"
FT                   /protein_id="ADK86814.1"
FT                   /translation="MIEVLSDSEILSYLLSNKHTADGVNEIYVTMNIKDKDSNTQRKPD
FT                   KMSLELELFLNQFIEFLKEQRKS"
FT   gene            609570..611951
FT                   /locus_tag="MPNE_0591"
FT   CDS_pept        609570..611951
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03202;
FT                   match to protein family HMM PF03305"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87062"
FT                   /db_xref="InterPro:IPR004890"
FT                   /db_xref="InterPro:IPR004984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMV3"
FT                   /protein_id="ADK87062.1"
FT                   /translation="MKFKYGAIFFSGFLGLSAILAACGTKGKFDQVDDGKIKLASSLTS
FT                   KSASKALQAIVKKYNEVKKPGDYPIEITQIAGGYDGGRSDLQTRVNVKDTTNFYNLILN
FT                   YPDLVSTLGRVGMELPFDNVKVDKLSPRFLDFNNRISAISKPGIYGIPVSLSTEVLSIN
FT                   GPVLHYILNNAKKKEGTLNQKMTSSSEGKNSSGTLTVATDTETSSLWKKIEDSAKANGK
FT                   SDEKGKGKKKDNKSATFSLVQLKQTQEKTDDSQDTKNSDDQVKKSWGEYQEVDGVLKNF
FT                   EFKASIFENWHDLLDFSTRVAKSFKKIHENSNKKGNDIQGILGVDSTPNSLFTSVFAAG
FT                   GGDYNNFFYKIENGRADFSNFKNKGTSYQNLQKVFGDFKGLIDKNGIFVNKGGSYSSNF
FT                   QKFHQLAYSISSTSGFFYSFAGKSAKRLNFGDSFIEYPRFTQEIKAPSKNGENGQTNEG
FT                   NSTNGEQNLLGTFEVKDDSKPKEEVKSNKNSGKESSQNQGKKSNNNKTIYLYETKIPDG
FT                   KTAGDNAILIKDKNVIEKLKSAAKEENKEQTAEATKAAITSNKAKSTKKESSKVIGYTT
FT                   TDSVREDGKNIFAIDRVNGENYDRKIIVGAKAETLNQSSTLQSEEAIVLPAPGKYLNGD
FT                   PKKVTITQGPNIIGIHANEKENAETQKFVDWFLNSPQTWEKQSRDKKGSSEKQTAAEFF
FT                   AESASYILPLKEIFDKNDTKTEKGKNSKTQQRTNTYAEKALELFKQISQNQIVSYSDPS
FT                   DFRSGKFRDAIGATFNAAVSSKADFNKFVQNFTATLGSDI"
FT   gene            612071..613162
FT                   /locus_tag="MPNE_0592"
FT   CDS_pept        612071..613162
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0592"
FT                   /product="type I restriction modification DNA specificity
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87129"
FT                   /db_xref="GOA:A0A0H3DPL4"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPL4"
FT                   /protein_id="ADK87129.1"
FT                   /translation="MQIRTYKIKDICDIQRGRGITKEYIKNNSGKYPVYSAATTNNGEL
FT                   GFINTYDFAGEYVTWTTNGYAGVVFYRNGKFSASQDCGVLKVRNKEINAQFLAFALSLK
FT                   TPQFVHNLGSRPKLNRNVVAEISLDFPPLEVQEKIAHFLKSFNELSSQLKAELIKRQKQ
FT                   YAFYSDYLLNPKHSQGEEYKLFKLKDIAKKILVGGEKPSDFQKEKDQVYKYPILSNSRK
FT                   ADDFLGYSKTFRIAEKSITVSARGTIGAVFYRDFSYLPAVSLICFIPKPEFNIKFLFHA
FT                   LKATKFHKQGSGTGQLTMAQFKEYQVYIPSLKKQQEIAATLDPLYYIFANSNWGIYKEI
FT                   ELRKKQMQYYQERLFQWIENQKV"
FT   gene            complement(613190..614920)
FT                   /locus_tag="MPNE_0593"
FT   CDS_pept        complement(613190..614920)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0593"
FT                   /product="MG032/MG096/MG288 family 2"
FT                   /note="identified by match to protein family HMM PF03072;
FT                   match to protein family HMM PF03086"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87199"
FT                   /db_xref="InterPro:IPR004306"
FT                   /db_xref="InterPro:IPR004319"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPT9"
FT                   /protein_id="ADK87199.1"
FT                   /translation="MVNLANASTFSEEELAVIAKNKDWKHNFEQFEKDFVKQALSPKTL
FT                   GLIDVYNLLSGFKQSVQNTVNLMNQLQAEINAANAVFPVSDSTKIPKVSQKLFGLLGDG
FT                   FFPQLHPKGLKIADNIAALFDQYNLKSIALKNFDLNLERKNDIVIQGKVCYSFSIQMDF
FT                   ATIYEGDGSTIDLQFALNASTTNFANLTDLQDSFWQSGKDLNTQLFWKPSVHKLISNGT
FT                   NDLTTLAQTALGDSLFDTKVNLTESVIEINNQTDVATKFREKVLNPFKQEREKAHAEHV
FT                   EKLRKLEEERKLQEAEAKAKAEEVKKLEAEREAFNKSLTAASEFKQYWSKKNKDVTDKK
FT                   QLAEALKISLEADRNRTFSFLIAGFRTAIDWYYNAKKENNDAKQKAFGSQGIQFPKDGL
FT                   NGIYMSDWLRGELTSKSNINLKIKELKVQNKIESPTINWIDGVGIKQDKANPFNYRFEV
FT                   DIKYTGGYQLYGFYAFAALFTKFPSSWSGEMNLKFIVDGSIPVYTVAKKDYPGSLFQFN
FT                   DKDELLFTLYVKEQISFADPNFMNLLRGQNLHDLELVTGATKPPVVDLASYLHFVLLSA
FT                   "
FT   gene            complement(615267..617204)
FT                   /locus_tag="MPNE_0594"
FT   CDS_pept        complement(615267..617204)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0594"
FT                   /product="MG032/MG096/MG288 family 2"
FT                   /note="identified by match to protein family HMM PF03072;
FT                   match to protein family HMM PF03086"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87249"
FT                   /db_xref="InterPro:IPR004306"
FT                   /db_xref="InterPro:IPR004319"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ13"
FT                   /protein_id="ADK87249.1"
FT                   /translation="MKSSKNFHFKTQAFLLSLFSATLTFSVFLVPTLSQNGSANDPHAV
FT                   NLNSSSFDKRHNKSYLLQRNSSFSQTEFETITSRTDWEQNFSEFQNKFADQLIDPQAFT
FT                   LIDVYNLFSGFQQKAQALVNLANNLQKRADTANEIFPVEDKNTIPKVPEGFFSFFGEDY
FT                   FPRLTPRGLNISDTVASLFNDYNLNSIKLKAFNLQLLKQNDIVLKNKVRYSFAIEMKFH
FT                   TVYVGKNTKIDLDFALQAQTNNFSSLEELRESFTNSGQTLSTQLFWKPVIDKLITDEGN
FT                   DLTTIARTAIGENLFDLKVNLTDSVIDGTVLTKARKSFEERILNPFIEQRKEAKRIHDE
FT                   EQARLERERKQLEEELKGKEKKVQELIREKTRFLSSFNNVKSFKDYWKGKGKNVEIKSQ
FT                   LIEVLKLAFKTDRNRTFIFLTDAFRNAVDWYYNAKKDDQDSKKKAFGDVGIELPKLGVD
FT                   GIFIPNWLRWELKHRANLKLNLQSVTTKDIHNDINGWGVPKQIFWNEAKNGIEFRQTYP
FT                   FKYAFQIRMKYTGDYGLKGIYWTLANWGLGGIPPEWKGEMELVLNVDGQLADWITSKKD
FT                   YPGTLFQFRDDKLLFTLHITQWINVQDQRFKGLLKKQQLDVLEPWGGDIKVPVVDLASY
FT                   LHFLILADKS"
FT   gene            complement(617455..618936)
FT                   /locus_tag="MPNE_0595"
FT   CDS_pept        complement(617455..618936)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0595"
FT                   /product="MG032/MG096/MG288 family 2"
FT                   /note="identified by match to protein family HMM PF03072;
FT                   match to protein family HMM PF03086"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86763"
FT                   /db_xref="InterPro:IPR004306"
FT                   /db_xref="InterPro:IPR004319"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK56"
FT                   /protein_id="ADK86763.1"
FT                   /translation="MPENFFSFFQEDYFPRLTPRGLNIADNVASLFNDYNLNSIDFTGF
FT                   NLKLLRQNDIVLKNKVRYNFALQMGFDTVYAGKNTTILKFSLQAQTINFTSLQELRDSF
FT                   ENNGNTLSTHLFWKPVVEQLTTDGGNDLTNIAKTAIGESLFNLKVNLTDSIIDQSVLQQ
FT                   AQKSFEDKILDPFHAERVEAKRIHDEEARRLEAERKRIAAELKAKEDEARRIREEHWAF
FT                   YQSTRDVKSFKEFWAKRSKNVADKKQLIEALKLSFQAKQNPTFELLTNAFRNAINWYYN
FT                   DKKHDEEAKRTAFGSGGISFAQSGLNGIFMPNWLRWELINRANIQLQLQNVKVRENNFE
FT                   VYGWGVPVSINWNDHNNGINYRATTPWTYGFEITMNYKGSYGLKGIYWTLANWGLGGIP
FT                   PEWSGDMELKFQIDGKLANWITQKQDYPGSLFQFQNDKLLFTLHVVQRITVKDQRFMNL
FT                   LKKQQLDVIEPWGGEIKVPVVDLASYLHFLILADK"
FT   gene            complement(618938..619303)
FT                   /pseudo
FT                   /locus_tag="MPNE_0596"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(619567..620349)
FT                   /locus_tag="MPNE_0597"
FT   CDS_pept        complement(619567..620349)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0597"
FT                   /product="MG032/MG096/MG288 family 1"
FT                   /note="identified by match to protein family HMM PF03072"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87011"
FT                   /db_xref="InterPro:IPR004306"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMM4"
FT                   /protein_id="ADK87011.1"
FT                   /translation="MQAFKEYWQKQKKDVTDKKQLLEALKLSFAKEQNKTFAFLIKNFQ
FT                   DGISNYYPNDQEDQSEAAKTAFGTQGIAFPQSGLKGIFMSEWLRKQLGEKAKINLDIKS
FT                   LKVTDSKISPTIKWNKDIGIKRNQDKPYNFRFEIDIEYQGNYKLSWLEAIIAKFSGIPG
FT                   EWKGKLNLKFIVDGDLSWEIVQKPDYPGSLFQFDDQKQQLLFKLHVWEKITVQEPEFME
FT                   LIKSQNLHNLELRTESTKPPVVDLASYLHYQLLKLNQQ"
FT   gene            complement(620380..621471)
FT                   /locus_tag="MPNE_0598"
FT   CDS_pept        complement(620380..621471)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0598"
FT                   /product="MG032/MG096/MG288 family 2"
FT                   /note="identified by match to protein family HMM PF03086"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86679"
FT                   /db_xref="InterPro:IPR004319"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLL9"
FT                   /protein_id="ADK86679.1"
FT                   /translation="MKLIKKKRLLLKTLSLSLAGLTTTLAIVVWPTLTEKTNQSVSDFT
FT                   LSNQRFEQNQSNRYQLQFNSGISQADLDYTTKHTNWKANFEQLQTKFKDNSLNPQQLGV
FT                   IDVYNLLSGLEQSTRDTVKLINDLNAKVLLANAVFPVHEAFQLPQVPEQLFTILGSDFF
FT                   PQLTPKGLNVTENITTVLQQYKLQSIALKQFDLKLEKQPDIVKRYKMRYSFVIQWDFET
FT                   VYTGVNSTTNLAFSVKAMTTNFANLQELQDSLVLRGQNLTTQLFWKPTVKRLVLGNNND
FT                   LTTVAKAAVGDNLFTTQANLTKSVLDQTVLKEAESRFEATVLKPFIEARQKALAEHQAH
FT                   QKVLEEQRQKQLEELKQKQKEAE"
FT   gene            complement(621622..622065)
FT                   /locus_tag="MPNE_0599"
FT   CDS_pept        complement(621622..622065)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86783"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK75"
FT                   /protein_id="ADK86783.1"
FT                   /translation="MINAKYLGKLIFLDFGQTITSLEETSDNSTFFIADEFGNFGSHYV
FT                   GVVLEQVRSFNTVVILSYQSFANLRNIGGDNFKSQIINNTSTLIAHRLIDMMEAEEVAN
FT                   LYGVDITCASEIKSLKVGQALVRSISSYYGEIKDWLVQQIDKS"
FT   gene            complement(622079..622342)
FT                   /locus_tag="MPNE_0600"
FT   CDS_pept        complement(622079..622342)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0600"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87175"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLB1"
FT                   /protein_id="ADK87175.1"
FT                   /translation="MFKKIHKEKRRKEILEMKEKGRFQPSNQIFVEKIDEYYTEHVQTI
FT                   DTKDFENLRENLRELAEIGSIDSNGVGLIDIIKLPRCCFVFH"
FT   gene            complement(622297..622554)
FT                   /locus_tag="MPNE_0601"
FT   CDS_pept        complement(622297..622554)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0601"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87270"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLK0"
FT                   /protein_id="ADK87270.1"
FT                   /translation="MFGYNDMVENTKDSAYYWRNKKAILQVLVPLVIAKEGPHNLSFKN
FT                   LARYCSKGQMKYYYVTLIFLLNLNPVCLKKFTKKNAEKKF"
FT   gene            complement(622591..622953)
FT                   /locus_tag="MPNE_0602"
FT   CDS_pept        complement(622591..622953)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0602"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87276"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLU5"
FT                   /protein_id="ADK87276.1"
FT                   /translation="MEQDINNQTGKKIFLNEECFLELEKLPQHVSVLGVSGFGKSNILL
FT                   HFLKYAIDNDHPLIFVNGKGDKELITQFEHYQTSAKQLSPEDGFDTVKLVALKNTSAKI
FT                   WSLDDRIATIKYNPFK"
FT   gene            complement(623115..626987)
FT                   /gene="rpoC"
FT                   /locus_tag="MPNE_0603"
FT   CDS_pept        complement(623115..626987)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpoC"
FT                   /locus_tag="MPNE_0603"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF00623;
FT                   match to protein family HMM PF04983; match to protein
FT                   family HMM PF04997; match to protein family HMM PF04998;
FT                   match to protein family HMM PF05000; match to protein
FT                   family HMM TIGR02386"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87036"
FT                   /db_xref="GOA:A0A0H3DMP7"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMP7"
FT                   /protein_id="ADK87036.1"
FT                   /translation="MTKRNKKNNKLYKNIKAIKLSIASNDTILNWSEGEVTKAETINYK
FT                   SLKPEPGGLFDEAIFGPVKDYECACGKFKKIKYRGVRCDRCGVWVTESIVRRERMGHIA
FT                   LVSPVAHIWMSKELPSPSKISLVLNISYKEVEQVLYFVNYIVLDTGKIKDPKIMPFKFK
FT                   EVLDLAGKGSLTTRQKMRRVIGYIFRNLIKNRSSEDYRKGKIFYESLKNSSLPFSLNDA
FT                   FNYIKKYTGFRVGIGAEAILELLNKIDLNYEFSKLNDALRKAKKDSVEYAKVKKILRQL
FT                   ETISWFRNSKLHPKNMILHTVPVIPPDIRPIIQLDGAKFTTSDINNFYRRVIIRNDRLR
FT                   RILEDGTVPAIVVNNEKRLLQESVDALFDNSSRHKPALSKDKRSLKSLTDRLKGKQGLF
FT                   RHNLLGKRVDYSGRSVIVVGPELKMYEVGIPALMILKLFKPFIIHGLINKFDSNGNEIR
FT                   PIASSIRQAEDMIKNQDDLIWGIVYDVIKDRPVLLNRAPTLHRLGIQAFEPRIVDGKAI
FT                   RLHPLVTTAFNADFDGDQMAVHVPLSENAVNEARAILLASKHILGLKDGRPIVTPTQDM
FT                   VLGNYYLTTERKGQTGEGIIFGTVHEARAAYEAGKVHLHAIVGISTKAFPNKHFEAQGT
FT                   LITTVGKIIFNDVLGDNIPYINEGEFDEHACPQKFIVPPSGDVRAAIAAHQVLPAFGKK
FT                   VISKLIDLLYTVVEFKDLPRILDNIKALGFKYSTHSSTTVSVFDIPKYSNKQQYFDEAD
FT                   QQVLKYKQFYNKGLLTDDERYKRVVKLWNGVKEKVSSEIQDLIKREEYRDNSIVVMADS
FT                   GARGNISNFTQLFGMRGLMSKSFNYERNNQSKIIKDTIEVPIKHSFLEGLTINEYFNSS
FT                   YGARKGMTDTAMKTAKSGYMTRKLVDATHELIINHDECGTRKGIVVEAIVETKTRSLVE
FT                   SLFDRIVNRYTIGPILDPETKAEIVPANSLITQELAKQICATSIKQVLVRSVIYCEREN
FT                   GVCQYCFGVDLSTGKLVELGTAVGVIAAQSIGEPGTQLTMRTFHTGGVSTENNLAQGFE
FT                   RLKQIFEVVAPKDYERCVISEVKGVVKSITTTQNAQEVLIESSVDERTYSIPFSAQLRV
FT                   KVGDAVELGSKITEGSIDIRQLLRVAGIQRVRQYMIVEIQKVYRIQGIEIADKYVEIII
FT                   RQLTSLLQVTDAGSSNLFVGQLVHSHHLNELNKSLLLSGKMPVIAINQVFGIDEAASKS
FT                   NSFLSAASFQDTKKILTDAAVKTQVDYLLGLKENVIIGGKIPAGTGFLTDEELAYLGAK
FT                   TVQEEY"
FT   gene            complement(626991..631166)
FT                   /gene="rpoB"
FT                   /locus_tag="MPNE_0604"
FT   CDS_pept        complement(626991..631166)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpoB"
FT                   /locus_tag="MPNE_0604"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF00562;
FT                   match to protein family HMM PF04560; match to protein
FT                   family HMM PF04563; match to protein family HMM PF04565;
FT                   match to protein family HMM TIGR02013"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86844"
FT                   /db_xref="GOA:A0A0H3DKT1"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKT1"
FT                   /protein_id="ADK86844.1"
FT                   /translation="MSQKPSFFQKKYSPTATRRYYGKIATDFVQPNLADIQIRSYQTFL
FT                   DHDLENLIAAYFPIKSPNDRYTINFKGLRRTAPERNEAQSRSESKTYEIGIYADLELID
FT                   SATGTIKKPRKSKKNSATSSVDGVFLTNLPLITRDGVFIVNGIEKFVIAQITRSPGIYM
FT                   LTKSQLKLSSSRKRVQEGYVCEVLPANGSVMLIYISNKKKIEDAFVQILLRDAVREGAK
FT                   IFPITTLLKAFGMSGKEILKVFKNNEFITRSLEAEVYNAKDFLNNVDPEIKNLLREFRD
FT                   GKTDLRRKGIASDQKIRSLVSDYVLLEKEHKALSEAKPNDPKVGQLEADMDELMDKIIT
FT                   ERAAKHIVHELSISLRGLENTDECPENSYHALLCSRFFRQRRYNLSAAGRYKVSRKLRI
FT                   TERIYQKTLACDLHLKNGELLLKKGTLLVKEEIDKIKQAAQNNQIDFVQKIKLTTDGSA
FT                   VNLSPESLLYESLDVYVNNDNFDVSVPVVGIHNDNDLNKAITLSDFIASISYVINIPSA
FT                   IGKYDDIDHLGNKRVKLINELISSRLESGITRMERFLKEKLTIADGVNRGQQINEEGQV
FT                   IEQAEKKELTIKSLINSKPIQIVIRDFFNTHQLTQFLDHQNPLSELSNKRRISAMGPGG
FT                   ISREDPNLDIRDVHYSQYGRICPIETPEGMNIGLIMSLASFAKIDENGFLMAPYRKIKN
FT                   GVITDEVEYLTALREDEHIIAEISSLVNIDENNKILDKEIIGRYRSMQGLYDPSKIDYI
FT                   DVAPHQVVSIGSSLIPFLENDDSARALMGTNMQRQAYPLIKPYAPVVGTGQEYKIARDS
FT                   GLTMLAPCSGTVKYVDNSKITIESDSGEQHTLDLIKFERSNQNTCYNHVPLVEKGQRVT
FT                   KDEVIADGPAVNKSELSLGQNVLVAFTTWNGYNYEDAIVISERLVKDDVLTSLTINEYV
FT                   AQCLSTKNGDEQITRDIPNVSDANKRYLDENGIIMVGAEVKEGDVLVGKVSPKGQVEVS
FT                   PEEKLFKAIFPESVQNVRDSSLKLPHGGDGIVSCVKRFSIANGNELNDGVIEMIKVYVV
FT                   QKRKIQIGDKLAGRHGNKGVISKVVPVADMPHLEDGTPVDILLNPLGVPSRMNIGQIFE
FT                   MHLGYAAHNLAKRMLISACFDDKKAQALSTEINQPQYKLDRLITGLKAQITNRGLKDEQ
FT                   AALAQLNNGDIALVLKEIGMSFDDLHFKVATPIFQGVNFQDLQDIMDEAGLKPAETHGK
FT                   FKLIDGRTGLPFEKPISLGIMYMMKLNHMVDDKIHARAVGPYSKITQQPLGGKSQNGGQ
FT                   RFGEMEVWALEAYGAAYNLQELLTIKSDDVQGRNKAYAAIVKGAAFPEPGIPESFKLLT
FT                   KELQGLALSVSFIYDDNTQQDSNNVSILQADGEQDDLFNDFEFDTEGY"
FT   gene            complement(631259..631759)
FT                   /locus_tag="MPNE_0605"
FT   CDS_pept        complement(631259..631759)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0605"
FT                   /product="flavin reductase"
FT                   /EC_number="1.7.-.-"
FT                   /note="identified by match to protein family HMM PF03358"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86923"
FT                   /db_xref="GOA:A0A0H3DKJ8"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKJ8"
FT                   /protein_id="ADK86923.1"
FT                   /translation="MSTKPLILLLANSKNSINRKFAKALEQQLNAELIELVDYQVDFYC
FT                   EDLEKDHFPEKIKSLVRKLHDHKTLIFVTPEHNGFVPAFAKNTIDWMTRDTQYGKNQFL
FT                   KELDGIICCVTPAAKSGGKTVLELLTKFFSFSGLNVKGAVLVNGYHDGFDFQPFITDVQ
FT                   KLI"
FT   gene            complement(631994..632389)
FT                   /pseudo
FT                   /locus_tag="MPNE_0606"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(632857..633303)
FT                   /pseudo
FT                   /locus_tag="MPNE_0607"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(633330..633902)
FT                   /pseudo
FT                   /locus_tag="MPNE_0608"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(633905..634723)
FT                   /locus_tag="MPNE_0609"
FT   CDS_pept        complement(633905..634723)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0609"
FT                   /product="hydrolase, alpha/beta domain protein"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM PF07819"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86974"
FT                   /db_xref="GOA:A0A0H3DL56"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL56"
FT                   /protein_id="ADK86974.1"
FT                   /translation="MRDKVNINTVDISQLEVFFQPAKKPAKQTIVFAHGFSVHHSYFKS
FT                   FSETLVDYDYYAPLWPGHNHHGFTDKELSPIHYAHLLVAWIEKQDLENIVLIGHSMGGA
FT                   VASYALQFLKPQRVEKLVLLAPLSYSNLLNYYKIKKAFKKKDEKLSYFKRMFQPKFPDL
FT                   QNDGQWQMELDKHTAMCKKLTFQIFKELSRLNSAYKTITIPAFLLLAQHDDFMPTKATL
FT                   NYFNRFLIKKGNLQSGVILHSQHQMFNSKHESFCKAMHDILKHNKLGKIY"
FT   gene            complement(634726..635862)
FT                   /pseudo
FT                   /locus_tag="MPNE_0610"
FT                   /note="anticodon-binding domain protein; this gene contains
FT                   a frame shift which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF06827;
FT                   match to protein family HMM PF08264"
FT   gene            complement(635913..637424)
FT                   /pseudo
FT                   /locus_tag="MPNE_0611"
FT                   /note="putative isoleucine--tRNA ligase; this gene contains
FT                   a frame shift which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF09334"
FT   gene            637467..637967
FT                   /locus_tag="MPNE_0612"
FT   CDS_pept        637467..637967
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0612"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM TIGR00185"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87161"
FT                   /db_xref="GOA:A0A0H3DLJ8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLJ8"
FT                   /protein_id="ADK87161.1"
FT                   /translation="MYKSAINIVLFCPEIPNNTGNIVRSCTAFKANLHLIKPYGFFLND
FT                   KRMVRAGLNCWDKVQMFEHKSWEHFIETTPPNKAIWLLTKSGTTTPDQINMQTDNREQL
FT                   YFVFGQETKGLPQTLMEQYSQNQVRIPIWNPVRSINLSNTVACVLYEYAKQNHYFNLDK
FT                   QCA"
FT   gene            637958..638590
FT                   /gene="trmB"
FT                   /locus_tag="MPNE_0613"
FT   CDS_pept        637958..638590
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trmB"
FT                   /locus_tag="MPNE_0613"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="identified by match to protein family HMM PF02390;
FT                   match to protein family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87232"
FT                   /db_xref="GOA:A0A0H3DNF5"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNF5"
FT                   /protein_id="ADK87232.1"
FT                   /translation="MRLRKVKDALVRVQDSPYFSNPEQLSTIESESLFVEIGCGKSWFL
FT                   SQQAQQNPKCFFVGIEREPTIVLKAINKVNRLEVKPRNLLITCLDANQLTEYLKPQSIS
FT                   KIFINFPDPWPKKRHTLRRLTAPHFLKQFHQLLKKQGLIEFKTDNDQLFEFTLEVLQKT
FT                   VAHFKIIEQTTDLHNSPLASTNIMTEYEQRFVSLGVKIKKLTLEKLN"
FT   gene            638620..638695
FT                   /locus_tag="MPNE_0614"
FT   tRNA            638620..638695
FT                   /locus_tag="MPNE_0614"
FT                   /product="tRNA-His"
FT   gene            complement(638744..639661)
FT                   /locus_tag="MPNE_0615"
FT   CDS_pept        complement(638744..639661)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87149"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPN4"
FT                   /protein_id="ADK87149.1"
FT                   /translation="MKKWFSSISKKKVSFSTLLLLGSGIVLSSCSNIDKPNVFRTLSQQ
FT                   SVENKVDYSKLPKENKTVRNLVFGTAEYNDGNYVLVVTTETDSSQINFLNGSNNQAVST
FT                   ENWAGDLGTTVKQVQNRYSTYPKGVKFLIWNDIDPNPVKWNPFARYPVIASDNELAKQT
FT                   DKDNSDKLRRNDESAIQYREIVTFIQTVYSGSVNNLINQSNVHAQTVGTDVTKAIVIAF
FT                   RKNNLDQISAHFYNPDNSNGSNAPGSNQPNQDSGNNGSTTPAASAAAAAKKSYSAGSFG
FT                   VKRHAVQVSINFLNFLDSVYTPLN"
FT   gene            complement(639676..639761)
FT                   /locus_tag="MPNE_0616"
FT   tRNA            complement(639676..639761)
FT                   /locus_tag="MPNE_0616"
FT                   /product="tRNA-Leu"
FT   gene            complement(639791..639904)
FT                   /locus_tag="MPNE_0617"
FT   CDS_pept        complement(639791..639904)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0617"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DJV5"
FT                   /protein_id="ADK86692.1"
FT                   /translation="MGFKKRQSDEKIVFYRLIYKAQSWENAKFPYQEFMDF"
FT   gene            complement(640250..640735)
FT                   /locus_tag="MPNE_0618"
FT   CDS_pept        complement(640250..640735)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0618"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01519"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87192"
FT                   /db_xref="InterPro:IPR002862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN96"
FT                   /protein_id="ADK87192.1"
FT                   /translation="MKEKISEKEYKALIRKIGKEHFDGEKEEYGDGTVGVWTYELRKYK
FT                   LKPPVKVKYVTQEQFQEYKDSNNQRLIKIETTLAAQGEQIRIQGEQIKELQIEQKAQGE
FT                   TLKLILQTLQKMSDRLDNMEVKMDKMEGKIDKIENRMDKMEVKMDKMEKRIDKLESK"
FT   gene            complement(640735..640848)
FT                   /locus_tag="MPNE_0619"
FT   CDS_pept        complement(640735..640848)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0619"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87051"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMR6"
FT                   /protein_id="ADK87051.1"
FT                   /translation="MPLINKLIKSAKQLNLVGSTAASSSFLNLCKKKGGIT"
FT   gene            641328..642569
FT                   /locus_tag="MPNE_0620"
FT   CDS_pept        641328..642569
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0620"
FT                   /product="replication initiation and membrane attachment
FT                   protein, DnaB/DnaD family"
FT                   /note="identified by match to protein family HMM PF07261"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86939"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL25"
FT                   /protein_id="ADK86939.1"
FT                   /translation="MQPNYYRVIKKATSFSGLDMISHAYGQIAGVEVVGFYLWLITEAN
FT                   AQAFNSEIRTPISRLQNAFNTTGTKNVNVPDWIYKTIGKLESLGLVRTFFSQEKSEMTF
FT                   WIVEPLGWKEFNQKKHFKEKLIESMGKLEYDRSCLSFEQIDNIQFDNALEITANFEANF
FT                   TSKQDCLSFSFDFEAFHKQLVKQNLFVSFNQKTKAVINGYFEKYQITLEGILECVIPSV
FT                   VNDEVDLELLQKLLEQLVKNNTAPIVDTVINDRNFFYDNQNLATETKDAISRCHLEYNA
FT                   EKYLFLLYGKVENEQLDLIRRLRQEFGIADKVINLIVDFSFWKNNSMWREQYILKIAES
FT                   VERYRSHNNYQATLDNFIRASSLAKKQRTKTKIEKSEPETSAAPVNETDDVNYFLNRIK
FT                   AINKKNRENGKHKR"
FT   gene            642550..643536
FT                   /locus_tag="MPNE_0621"
FT   CDS_pept        642550..643536
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87108"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN28"
FT                   /protein_id="ADK87108.1"
FT                   /translation="MENTNAKTQPAINELDKTTVQDTIKNYEQQLQKELNEEQLKAFKK
FT                   RFKYLKLTKREVIEKESRELLLQAFRDFENCEKIKGNHCPNKGNAHLNIFREPPFWTKS
FT                   NKKVLGKLIGIKMSCAKSIDKEDIFKLRYSNFIIYKPNWFKYADEFPQINQLPINKFQE
FT                   ESFEEIRNDLSELYENEKNHKENISFFNLQKVNFNHEGAKLLLCDFVERGVKTALLYCE
FT                   EFVSRFDRAYWKVDDYLDLINEANVIIFVSLGEESFVSKNYILFLTRLFDIINSKRKDV
FT                   YFFSTEYNEKNGLIQAFQKSIHFKAKWVNSFFEQLNYFFEMKREEIK"
FT   gene            643596..643677
FT                   /locus_tag="MPNE_0622"
FT   tRNA            643596..643677
FT                   /locus_tag="MPNE_0622"
FT                   /product="tRNA-Leu"
FT   gene            complement(643791..644468)
FT                   /locus_tag="MPNE_0623"
FT   CDS_pept        complement(643791..644468)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0623"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87200"
FT                   /db_xref="GOA:A0A0H3DLD7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLD7"
FT                   /protein_id="ADK87200.1"
FT                   /translation="MNGARIAFWPKKEQHQLFNLSFSAMMLALALIASFVSHFISIPFL
FT                   SALKLTIDISSVFLIACAFFVSYSWALVITVALSLCSFIWDGNNWIGILTLTIANFAIV
FT                   SFTRLYFHIFAQIKLRWLWVFSLATLSNTLLLTTLNGLLITPLYWYWFGYVPTANFVEV
FT                   AKIYNKTPYFHFFLFGVPNYWVGIFALYSLFNVIKFTLVSLIGVPVMRAFQKFYWKKAQ
FT                   IVY"
FT   gene            644523..645077
FT                   /gene="ppa"
FT                   /locus_tag="MPNE_0624"
FT   CDS_pept        644523..645077
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ppa"
FT                   /locus_tag="MPNE_0624"
FT                   /product="inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="identified by match to protein family HMM PF00719"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86747"
FT                   /db_xref="GOA:A0A0H3DNG5"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNG5"
FT                   /protein_id="ADK86747.1"
FT                   /translation="MDKFLIDVTVEIPKSSKIKYEYDRKTSQIRVDRILFGSESYPQNY
FT                   GFIANTLDWDGDELDCFIFADQAFLPGVVVPTRIVGALEMVDDGELDTKLLGVIDCDPR
FT                   YKEINSVNDLPKHRVDEIIGFFKTYKLLQKKEVIIKGVQSLEWAKKEYQVCVDLMKQYG
FT                   KLPKDEFIAKMQKLHPEHYQK"
FT   gene            645086..645604
FT                   /gene="recU"
FT                   /locus_tag="MPNE_0626"
FT   CDS_pept        645086..645604
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="recU"
FT                   /locus_tag="MPNE_0626"
FT                   /product="recombination protein U"
FT                   /note="identified by match to protein family HMM PF03838;
FT                   match to protein family HMM TIGR00648"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87176"
FT                   /db_xref="GOA:A0A0H3DLL3"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLL3"
FT                   /protein_id="ADK87176.1"
FT                   /translation="MISANRGMFLETIVNQTIVRLGDHPDIWLEKRYLPIQPTAFKETR
FT                   VQGALTAQKKSKTDYYGVYKGEIYFDFETKQTNKSNFALAQLAEHQLKHLKRINEIGGI
FT                   SFLLIYFQVQDLLYALHTKDLLQMIEAQKGKSKTIKRDLIDQKAQKINLIYPGVIDLID
FT                   VIENFIKDS"
FT   gene            complement(645601..645930)
FT                   /locus_tag="MPNE_0625"
FT   CDS_pept        complement(645601..645930)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0625"
FT                   /product="putative DNA-binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86788"
FT                   /db_xref="GOA:A0A0H3DK79"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK79"
FT                   /protein_id="ADK86788.1"
FT                   /translation="MEKTTTSSKPLSRSEINKIIAVATGVKEAKIKEIFKYLNTLLLNE
FT                   LVSRSVCILPENLGKLRITIRNARIQKDMKTGEMKHIPPKPLVRYSPSKTIKETAAKVR
FT                   WKYAD"
FT   gene            646079..646489
FT                   /locus_tag="MPNE_0628"
FT   CDS_pept        646079..646489
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0628"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86849"
FT                   /db_xref="InterPro:IPR015271"
FT                   /db_xref="InterPro:IPR035947"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKT7"
FT                   /protein_id="ADK86849.1"
FT                   /translation="MEPNNLKEELVSVFEKACSSHKERLDFICSVRESDTFSNVDVPLA
FT                   PIKTIIEIAKNEENQTEILKLAIENIKTLSTVGSGQYIASHFSTHNEVAIIFCISYFLY
FT                   HFNFLHDENKKQLLKRAFEAVAEKIADYLNEN"
FT   gene            complement(646486..648633)
FT                   /gene="clpB"
FT                   /locus_tag="MPNE_0627"
FT   CDS_pept        complement(646486..648633)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="clpB"
FT                   /locus_tag="MPNE_0627"
FT                   /product="chaperone protein ClpB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF07724; match to protein
FT                   family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87250"
FT                   /db_xref="GOA:A0A0H3DLI8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLI8"
FT                   /protein_id="ADK87250.1"
FT                   /translation="MDFSFTPTPDKRDFLKEMGRSINDEVLKNKVDPIIGRDNEIRRLI
FT                   EILSRKNKNNPVLIGEPGVGKTAIVEGFVRRVVNNDVPLNLRDVEIYELSLSGLIAGTQ
FT                   YQGEFEKRVNGILKQVKESNGKIILFIDEIHQIVGLGRNSSSGAMDIANILKPMLARGE
FT                   IKVIGATTLKEYREYVEKDGALERRFQKILVSEPSQQEALTIMRGLKTRWELFHNLTIF
FT                   DSALVAAVEMSARYIPDRNLPDKAIDLIDEASAKIKTEMASEPVVIDTLKREIINLETE
FT                   YAALKQDKENADNKKKQEHLDNLKQQLDELKKKRDSLTAEWKKEKTNFESINKLKKEIE
FT                   DLQTRLELYQTEGNYEAASKILYYDIPKLKNQLEQAQKKYVDSKHDLFKTEVSENEVAE
FT                   VVSQATGIPLKKLLETEKEKLLHLGDEIKKRVKGQDAAVETVVNTVMRGRVNLNDPNRP
FT                   IGSFIFLGSTGVGKTELAKSLAEVLFDNEKAMIRFDMSEYMEKHSVAKLIGAPPGYVGY
FT                   EQSGLLTEAVRRKPYCVLLFDEIEKAHPDVTNILLQVLDDGTLKDSQGRLVNFKNTMII
FT                   MTSNLGSNYIMENKRDLAMEALKKHFRAEFINRIDEIVFFSVLQKTTVLEIITNLLDQL
FT                   NQRLAKQNLKFTFDPKLNEFIYKSSFDEQFGARPIKRFIDRQIATLIAKQILEGIITKD
FT                   VSYNVIVEKDKVAIVANKVKS"
FT   gene            complement(648809..649657)
FT                   /locus_tag="MPNE_0629"
FT   CDS_pept        complement(648809..649657)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0629"
FT                   /product="phosphotransferase enzyme family protein"
FT                   /note="identified by match to protein family HMM PF01633;
FT                   match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86765"
FT                   /db_xref="GOA:A0A0H3DLX9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLX9"
FT                   /protein_id="ADK86765.1"
FT                   /translation="MNKGDAIAFLCEKLNLQPTAVAHVEQIHSGFTNFSFFTELKDGSK
FT                   YQVRLARKDVPLNRRNEQIILDLVTPIFGNPFVYFDVTTGNAIKKWIEGKQPKRPTRLF
FT                   LEQLVASLKKVHAVEWKQFANEIWIFDPLIYFNQTKLPDFYKKLYVELTDKHKAIPKTL
FT                   CHHDSTFDNLVYTPKKQVVLIDFEWSCVDNPYYEIANIIREELTIETANQIIDLYGSLD
FT                   KKLVFETVIYVLLFAFQWTEIMPQTQQIIDYKKWVQKRLNYFLKALFPNTWKIAKTIPL
FT                   Y"
FT   gene            complement(649665..650837)
FT                   /gene="ackA"
FT                   /locus_tag="MPNE_0630"
FT   CDS_pept        complement(649665..650837)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ackA"
FT                   /locus_tag="MPNE_0630"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="identified by match to protein family HMM PF00871;
FT                   match to protein family HMM TIGR00016"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86671"
FT                   /db_xref="GOA:A0A0H3DN72"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN72"
FT                   /protein_id="ADK86671.1"
FT                   /translation="MNDNKILVVNAGSSSIKFQLFDYHKKVLAKALCERIFVDGFFKLE
FT                   FNEQKVEEKVAFPDHHAAVTHFLNTLKKHKIIQELSDITLVGHRVVQGANYFKDSVIVD
FT                   AAALAKIKEFIKLAPLHNKPEADVIEIFFKEVPSAKNVAVFDTTFHTTIPQENYLYAVP
FT                   RSWEQKHLVRRYGFHGTSYKFINNYLEKHLNKQNLNLIVCHLGNGASVCAIKNGKSFNT
FT                   SMGFTPLEGLIMGTRSGDLDPAIIGYVAEQENMSASDVVNALNKKSGMLALTGASDMRD
FT                   VFAKPQENAVAIKMYVNRVADYIAKYLNQLEGNIDGLVFTGGIGENASDCVELFINAVK
FT                   SLGFATDLKLFVKYGDSCVVSTPQSKYKIYRVRTNEELMIVEDSIRLTQK"
FT   gene            650906..651115
FT                   /locus_tag="MPNE_0631"
FT   CDS_pept        650906..651115
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0631"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86739"
FT                   /db_xref="GOA:A0A0H3DKI3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKI3"
FT                   /protein_id="ADK86739.1"
FT                   /translation="MSAKTSYIVAAVSTAVGIILYFISSLMGVIGVSNDKTLIIVFFVL
FT                   ASIIIINACVFWIIYLFKKRNVVK"
FT   gene            651178..651600
FT                   /locus_tag="MPNE_0632"
FT   CDS_pept        651178..651600
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0632"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86836"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM71"
FT                   /protein_id="ADK86836.1"
FT                   /translation="MNTFKETLFSLKKSNYLLNESAQILNDCVVNNNEIDERLRNSIKF
FT                   ALGIINLASYCLKNEQEQLDHELNHGNEAPWEFSFNEAEQLIECTVKNNFGNEKLVDLI
FT                   FHIGDAMETYRTTNIKFRVPKSYYDAKQQIRKVIKN"
FT   gene            651606..652226
FT                   /gene="ruvA"
FT                   /locus_tag="MPNE_0633"
FT   CDS_pept        651606..652226
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ruvA"
FT                   /locus_tag="MPNE_0633"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF01330;
FT                   match to protein family HMM PF07499; match to protein
FT                   family HMM TIGR00084"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86961"
FT                   /db_xref="GOA:A0A0H3DMK3"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMK3"
FT                   /protein_id="ADK86961.1"
FT                   /translation="MIASIFGKITFVGKRKIIVEANCISYWFNVKENHSFEKNLEKPRQ
FT                   VFCQIIKRMVTNQILEEGFAFNTLEEKEWFSKFIELNGIGSKTALNLLNNNLEEMRDYI
FT                   KNSNYHALTKLTGSNSKVARALLALELYDRDDGGKRIKPNTAMANDYDEMFDTLKSLGY
FT                   KPQDIQNALSKIEIKPNFDVSEVIAEVIKLMSFQNNEVTNKTA"
FT   gene            652201..653124
FT                   /gene="ruvB"
FT                   /locus_tag="MPNE_0635"
FT   CDS_pept        652201..653124
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ruvB"
FT                   /locus_tag="MPNE_0635"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF05491; match to protein
FT                   family HMM PF07728; match to protein family HMM TIGR00635"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87167"
FT                   /db_xref="GOA:A0A0H3DN66"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN66"
FT                   /protein_id="ADK87167.1"
FT                   /translation="MKLQIKPPNNFAEFVGKQEIINQIQLSIKASRINKAQLDHILLYG
FT                   PPGVGKTTLARLIASEMNTKLQIIQGGHLQRPSDFLNAVSLIKKGDVLFVDEIHAVAPS
FT                   VMELMFPVMDDFRVQVLIGKDFNSKMVEMKVNPFTLIGATTQFGKIINPLEDRFGMILN
FT                   IDYYSNQEIERIVSIYGEQMELELKPEEITQITQHSKQTPRIAIRIVKRLFEQKIVNKK
FT                   IDLAALFKSLMIYKNGLQSIDVQYLKALNGQYEPQGIKSICSMLGIDKSTVENKIEPFL
FT                   LRENMIQKTKKGRIITRTGRNYLTSC"
FT   gene            complement(653110..654348)
FT                   /locus_tag="MPNE_0634"
FT   CDS_pept        complement(653110..654348)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0634"
FT                   /product="ImpB/MucB/SamB family protein"
FT                   /note="identified by match to protein family HMM PF00817"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87100"
FT                   /db_xref="GOA:A0A0H3DL36"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL36"
FT                   /protein_id="ADK87100.1"
FT                   /translation="MIGTFTYLDPTIQADPNLLFFYFDFDAFFASVEEIENPELKNQPL
FT                   IVGNRTSRSVVSTCNYLARSYGIKSGMPIAKALELCPQAIFATSHFRNYRKYSAKIFAM
FT                   IAEQFNLEVHTLSIDEGFVCFRDLSPRKAFSLAKRIQRHVYEQLNFHISIGISNQFTLA
FT                   KIFSNQAKPFGVKSCFSKEVKRKLWPLPIVELPGIGKRQLDNAFKNNFHKIGDLAKCKD
FT                   VTLFKRVFGIAWESLHAVALGETYTQSEQDVKSRSIAVSETLEDLNYSSNQLQQKLTSI
FT                   FNELYARLQLSFQMCKGVVVQLKSNDFIVNSHSQSIKKYTADYQTLLVIVKKLFNRLLM
FT                   GVGLNIRLIGVSFFGLKNNPSSSRPEGLLFYEYQQAKPKQQTAHFALDQMIYEINQSFG
FT                   YEIIQRAKKLAAS"
FT   gene            654466..654951
FT                   /gene="rplJ"
FT                   /locus_tag="MPNE_0636"
FT   CDS_pept        654466..654951
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplJ"
FT                   /locus_tag="MPNE_0636"
FT                   /product="ribosomal protein L10"
FT                   /note="identified by match to protein family HMM PF00466"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86694"
FT                   /db_xref="GOA:A0A0H3DLP0"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLP0"
FT                   /protein_id="ADK86694.1"
FT                   /translation="MEAKKDKAQQVADVSHLLSTSAGFVIFDYTSMSAIEATSIRKKLF
FT                   KNGSKIKVIKNNILRRALKAGKFEGIDETAIKGKLAVAVGVNEIVETLKAVDGVVKAKE
FT                   AMNFVCGYFDNRAFNSADLEKIAKLPGRNELYGMFLSVLQAPLRKFLYALEAVKAAK"
FT   gene            654989..655357
FT                   /gene="rplL"
FT                   /locus_tag="MPNE_0637"
FT   CDS_pept        654989..655357
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplL"
FT                   /locus_tag="MPNE_0637"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="identified by match to protein family HMM PF00542;
FT                   match to protein family HMM TIGR00855"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86807"
FT                   /db_xref="GOA:A0A0H3DNM7"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNM7"
FT                   /protein_id="ADK86807.1"
FT                   /translation="MAKLDKNQLIESLKEMTIMEIDEIIKAVEEAFGVSATPVVAAGAV
FT                   GGTQEAASEVTVKVTGYADNAKLAVLKLYREIAGVGLMEAKTAVEKLPCVVKQDIKPEE
FT                   AEELKKRFVEVGATVEIK"
FT   gene            complement(655547..655717)
FT                   /locus_tag="MPNE_0638"
FT   CDS_pept        complement(655547..655717)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0638"
FT                   /product="putative ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87215"
FT                   /db_xref="GOA:A0A0H3DLF3"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLF3"
FT                   /protein_id="ADK87215.1"
FT                   /translation="MKNFHKEINLDNLGNVYSQADRLARKGIISTNRARRLKSRNAAVL
FT                   NKTQVTAVEGK"
FT   gene            655871..656527
FT                   /locus_tag="MPNE_0639"
FT   CDS_pept        655871..656527
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0639"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87145"
FT                   /db_xref="GOA:A0A0H3DL86"
FT                   /db_xref="InterPro:IPR035325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL86"
FT                   /protein_id="ADK87145.1"
FT                   /translation="MNGGGQQGGFFGLLVIIIPVILLIVFFSKKKNSQKTEFGGEGGSR
FT                   ASKKDEVWKTVKQFLQEQNERGKEIIKTFVAKNPNPLHSRKDRQFFNQEVQAYITAHNL
FT                   SKTAAKRYRHEQLKLKQRELYCIYFITKDAKTSVFDEARIIEAEVYQKPNKTGKGAPER
FT                   LIRILGLKNFNDEMKWIQPLMDREEKRKEKEEKRKRELAARQLKRQEKKKQKTSK"
FT   gene            656532..657467
FT                   /gene="fmt"
FT                   /locus_tag="MPNE_0640"
FT   CDS_pept        656532..657467
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="fmt"
FT                   /locus_tag="MPNE_0640"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF02911; match to protein
FT                   family HMM TIGR00460"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87283"
FT                   /db_xref="GOA:A0A0H3DNM5"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNM5"
FT                   /protein_id="ADK87283.1"
FT                   /translation="MIKVVFFGTSTLSKCCLEAIFQDPEFVVCGVVTQPDKVNERNNKI
FT                   NFSAVKQFCIENNIPCFQPEKNIQIKTELAQLQADIGVCVAFGQYIHNDIINLFPYKIA
FT                   NLHPSKLPLLRGGAPLHWTIINGFTTSSLSVIELVQKMDSGPIWKQKDFKVNPNWNTGD
FT                   LFEYVQTHAPQFLIQCLKEIVSGKSQWKEQINPPTFGLNIKKEQERLDLNLEPKAFINW
FT                   VKGLAPKPGGWLEFEGQNIKILQATYLGKMTSTTAVGQITKISKQGIEIALANDEIVLL
FT                   QIIQIPGKRAMGVSEIINGKHPFAEGKFFH"
FT   gene            657467..659461
FT                   /locus_tag="MPNE_0642"
FT   CDS_pept        657467..659461
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0642"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87014"
FT                   /db_xref="InterPro:IPR021301"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKT8"
FT                   /protein_id="ADK87014.1"
FT                   /translation="MLTKAFFLKNFDRSKELIPLSYADVFGAASQLLKKHHKQVDTEID
FT                   VQEDLIEDPVFEIDILELLNEAPELLFDSKNPRVKEAQIIIEKAKKDIASYFHLDNILD
FT                   TDNLGLKATVTEKIQFTEKQIEAAVQNKKAAIIFKPVFTVNQCLIQPDAVVVHANGLCE
FT                   FVVIKATTNTKRKFILEIIYDFLLFEKLGKYKLVNYYFCIVNYELKNKHNVSFFLNTEI
FT                   KTAKNSSTSKTKEEQVLYGHLPFNDPKKIAYIHSKKSGGVNGFLLVKLVDNIIRSGVTN
FT                   LEQIISFVFRELNAPSIRSLKQIISEVAKVQLDFWNIIDDVKQHQELQDNQITFNYSDA
FT                   FNSFWNNYLLRNLIKLVFAYKYSEIFRLSGKLAKWDEVVEAYKENKSVKIDGFLYELNQ
FT                   RKMKKTKNPATSQFNKIHFFLRAWNDKKGIAVGNKFKSVWQKLKEKKVYFDFETISSAV
FT                   RVIDKSLPFTQIVTQCSLIVDDNTESDKSKLVCQNLIFDPLTIGIEDFKTVVDVLYQKQ
FT                   CDQYSFVVYNKSFEKNRLLEMVTFINEAPYQQRVQAIIENLFDLADIFGLENDCLAFKQ
FT                   LDGFSSIKKVLPMIDQRFLDASRTVSYQSLKVQKGDVAQELTLARFLNCLDEQQWAQTA
FT                   LELKQYCENDVRAMIAIELFIKDLITNQL"
FT   gene            complement(659445..660293)
FT                   /gene="rnc"
FT                   /locus_tag="MPNE_0641"
FT   CDS_pept        complement(659445..660293)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rnc"
FT                   /locus_tag="MPNE_0641"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="identified by match to protein family HMM PF00636;
FT                   match to protein family HMM TIGR02191"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87079"
FT                   /db_xref="GOA:E1QCT1"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:E1QCT1"
FT                   /protein_id="ADK87079.1"
FT                   /translation="MKNKKDKTQKPKVIDEKFVAFFKSLNIEPQNWQFYEDAFVHSSYV
FT                   NENEDARASYDRLEFLGDALIDFIVAKKLFELYPNYNEGMLTRTKIEIVKGENLNRIGK
FT                   ELNFGNFIKLGKGMPYTETLFGDVLEALVAAIYEDLGIEKANQFVEEHIFKKTYSEILK
FT                   YNFFSLFQEQKLPEPRVRVSLTSNNLVLSIIELNGDIIWSQAVPNSKHYDDKSVLEHNA
FT                   MSAFTQFLKSGKGINFFSDIKNKLDSQKPMRALTVRPKKINWKARKPKLKALKNKVKAD
FT                   S"
FT   gene            complement(660283..661269)
FT                   /gene="plsX"
FT                   /locus_tag="MPNE_0643"
FT   CDS_pept        complement(660283..661269)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="plsX"
FT                   /locus_tag="MPNE_0643"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="identified by match to protein family HMM PF02504;
FT                   match to protein family HMM TIGR00182"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86898"
FT                   /db_xref="GOA:A0A0H3DKI2"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKI2"
FT                   /protein_id="ADK86898.1"
FT                   /translation="MAFRLAVDCLGFENHPREAIDAVLEYWSYHQELEFILVGDEKTFD
FT                   GLDYLPKNITKQLASSCIDMTDTPLTARRKVNNSMQKAINLVRDGAADVVISAGSSAVY
FT                   ASLTYDGFGKIHKDVKSAFMSYVPTANNDWFYFLDVGANKNFTGKELYFLGLMADIFVK
FT                   KTTNKISPRIALLNIGTEINKGFDYHQEGYQLLNEDKHLNFTGFIEPRFLLDGVCDILV
FT                   ADGYSGNLVLKSMEGTFKTIARLLKQGYKRNPLAGLFSLGILKRIAKRFDYKNNAGAVV
FT                   IGLNKLALKTHGSADKQQFLSTIRLAHTSLKSDLINAIKSSLDNYEK"
FT   gene            complement(661269..662651)
FT                   /pseudo
FT                   /locus_tag="MPNE_0644"
FT                   /note="DAK2 domain fusion protein YloV; this gene contains
FT                   a frame shift which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF02734;
FT                   match to protein family HMM TIGR03599"
FT   gene            complement(662609..662944)
FT                   /pseudo
FT                   /locus_tag="MPNE_0645"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(662999..663979)
FT                   /locus_tag="MPNE_0646"
FT   CDS_pept        complement(662999..663979)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0646"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="5.4.99.-"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00005"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87153"
FT                   /db_xref="GOA:A0A0H3DN76"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN76"
FT                   /protein_id="ADK87153.1"
FT                   /translation="MSTAKFVVPKAVENVRIEKFCLKLLPNIKLSQFFKLLRLGKVLLN
FT                   NTKAKLGQRVSSGDTIVFQFAIEPYLHNHSEVVDLTQVQDDLQVIFEDEQLIVVDKPAG
FT                   VVCQPDAKHELFNLANSLLKHCGYNQYFKNSLSFIPRFAHRIDRNTCGLVIGAKTNQAL
FT                   QELEAVFRHNLLMKQYQGLVFGPFNFKGTQKAYWAKDAYQALVTVKAKPFPNAKPITTI
FT                   FENSKYLTKLDLSLLTIRLVSGKTHQIRACLNLLNTQLVGDRKYQLLQFKNRNRDFKHQ
FT                   ALHATNLSFAQLDKQKFPLLANYSQRQFKSQLVPWFASLIKGVSI"
FT   gene            complement(663966..664943)
FT                   /locus_tag="MPNE_0647"
FT   CDS_pept        complement(663966..664943)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0647"
FT                   /product="DHHA1 domain protein"
FT                   /note="identified by match to protein family HMM PF01368;
FT                   match to protein family HMM PF02272"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87286"
FT                   /db_xref="GOA:A0A0H3DLV0"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLV0"
FT                   /protein_id="ADK87286.1"
FT                   /translation="MINIDPHFIHNLTNKLKTFDNFSLYVHVNPDFDAFGAAFAFKAFL
FT                   AVYFPHKKAYVMGSHNIKADGKDLFPFEAAPIDDAFVKNSLAIIFDTSNQERVLTQKHK
FT                   LAKETVRIDHHPKTESFADLEWIDPAFSAAAEMVGYLILQMGYELNAEMAAYIYAGIIT
FT                   DTQRFSSSATTPQTFALTAKLLETGFNRNKVHDAVYLKPLLEHKYFSYVLNKAKITPNG
FT                   LAYALLKKGTYKQFGVVSPLPMVHALNNIKGVKIWTTCYFNEDIKKWIGSIRSRSIPIN
FT                   NFAQMFGGGGHKYAAAFVLDDKRQFMKLVEIMDDFLAKQKHVNS"
FT   gene            complement(664936..666099)
FT                   /gene="thiI"
FT                   /locus_tag="MPNE_0648"
FT   CDS_pept        complement(664936..666099)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="thiI"
FT                   /locus_tag="MPNE_0648"
FT                   /product="thiamine biosynthesis/tRNA modification protein
FT                   ThiI"
FT                   /note="identified by match to protein family HMM PF02568;
FT                   match to protein family HMM PF02926; match to protein
FT                   family HMM PF06508; match to protein family HMM TIGR00342"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87158"
FT                   /db_xref="GOA:A0A0H3DN81"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN81"
FT                   /protein_id="ADK87158.1"
FT                   /translation="MGLHNEPNTILICRYGELVLKGKNRLQFVKQLKKNVKQAFKKLSI
FT                   TNPVDYQFDMLVVGEVISTQRSLLKNLFTRLPGLSVCLFALQIPHDEAQLLALLQQVVQ
FT                   SHPSFKIEVRRRDKLFACNSSAFKKYLALQLWEKYQLKGKLVDPAITVHVEVTKEHFLI
FT                   ISESFNGIGGLPVFTSGTALALLSGGIDSPVAASLVLQRGFNVDFITFINEPGHNAATI
FT                   GKIQRLANLVSLNQTLCTGRLFVFDFTDLQKELSHISLEGYRIVLMRRCFYKIASLFKY
FT                   DCLITGEALGQVASQTIDNLKVIQAVVPNTFVIRPLIGLSKDKIIEWAKALGTFETSIE
FT                   HHMDTCTVFAPKKPTTKAKLAIVEKLESELLFVRELIEAGVKKLQND"
FT   gene            complement(666086..666931)
FT                   /locus_tag="MPNE_0649"
FT   CDS_pept        complement(666086..666931)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0649"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87091"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLG0"
FT                   /protein_id="ADK87091.1"
FT                   /translation="MGFTKQYKIDFDIIDNQIVLSNNYFQKHKGSFRKITGTRFGKVIG
FT                   ISEYETSLKTWANMVKIYEDEFDETLSRAGQVIEPKIRDYVIAKTGFNFHSYDPKEVKW
FT                   DLFPENPVFGGIPDGEPVDVYGKLAYDTNAPMLEIKTTSCDSLVYKKINGNLKIVFDEN
FT                   GMPIVKKINGKKDSWFDSNGKIVISPAYYCQIGLYLYLRNITKGMFAIAFLEPQDYVHP
FT                   EWFEAKQRDIRLVPVQIDRKAFEVLTNKAQLWYNSFIRTGKSPQLTSQDWEWLRENGIA
FT                   "
FT   gene            complement(666938..667747)
FT                   /locus_tag="MPNE_0650"
FT   CDS_pept        complement(666938..667747)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86719"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKE2"
FT                   /protein_id="ADK86719.1"
FT                   /translation="MDRKIVALDINPANFFDAANDLAIWKDFFNKAQEKHQLVFISSCW
FT                   QQTIVYLLDLLSLNNVDVIAESGAITWFCKTNQYDYQAFLDLASINVIIHHAVITNSGI
FT                   FTMGKSRVDDTANLSANYFISLQKYKDFKSLWLTDFEQTLKYENFLKQLGKLELSSIYV
FT                   FSPQYHMDLAFIDQIASGQPRFTHSNFYPNNLLFTSNKVTKFNALEKYTKTQGLMLKDV
FT                   HYINLDETLVQNSEQLASAVFIKKQNNEGLTVQDIPDVLQKLCAQLL"
FT   gene            complement(667740..669434)
FT                   /gene="thrS"
FT                   /locus_tag="MPNE_0651"
FT   CDS_pept        complement(667740..669434)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="thrS"
FT                   /locus_tag="MPNE_0651"
FT                   /product="threonine--tRNA ligase"
FT                   /EC_number="6.1.1.3"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM TIGR00418"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86967"
FT                   /db_xref="GOA:A0A0H3DP31"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP31"
FT                   /protein_id="ADK86967.1"
FT                   /translation="MLAGVLLLQSWLKANYPQVQFGSYGVQEGEFYLDFKVEKSFSIKE
FT                   FEQLEQDLNAYFNQLNNVVQTKIDKTKSLKFFQADPFTTTLIESIESNSLVVTTVNEQT
FT                   FWVHDLVLPLPKQGFVKLLNVSANYFLGDPTKPQLQRLVGIFAASKEQLKSLIAANEQK
FT                   YQNDHRAIGKRLEIFTFDPLVGAGFPIWLEKGAVLKKIIGDFVHYQQLMFGFKTVSSPV
FT                   LANLELYKISGHYVHYSEDMFPSVKLENQMMMLRPMTCPHHCLIFKHKRRSYKELPQRF
FT                   CEDSILHRFEASGGLTGLERVRCMTLLDNHIFCRTDQIKAEIKNAFKLIQTVNNKFGFS
FT                   FDRIDLALHDPNNKAKFIDNDQLWANSESQIESVFKELNVPYKIDVGAAAFYGPKIDFQ
FT                   FKTALNKMITIATIQLDFLLPERFELRYFDEQSNAQTPVIIHVGIVGTYERFIAALLEK
FT                   THGNLPLWMAPVQVVVIPVNIDKHEKAAKKLYQKLLKENIRVSLDESEDRLGKKVRTAI
FT                   VNKIPLQIIVGDKEMQDLTRITCRGFKGEKVQKLYWANFVKKVRKDG"
FT   gene            complement(669434..669748)
FT                   /locus_tag="MPNE_0652"
FT   CDS_pept        complement(669434..669748)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0652"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86915"
FT                   /db_xref="InterPro:IPR024506"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMB9"
FT                   /protein_id="ADK86915.1"
FT                   /translation="MLNRVFLEGEIESSCWSVKKTGFLVTIKQMRFFGERLFTDYYVIY
FT                   ANGQLAYELEKHTKKYKTISIEGILRTYLERKSEIWKTTIEIVKIFNPKNEIVIDYKEI
FT                   "
FT   gene            complement(669750..670331)
FT                   /locus_tag="MPNE_0653"
FT   CDS_pept        complement(669750..670331)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0653"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86691"
FT                   /db_xref="GOA:A0A0H3DN93"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN93"
FT                   /protein_id="ADK86691.1"
FT                   /translation="MATNLKSTAKLVKPIQYDKVIEVERIFADPAFIEQHRQRILASFK
FT                   DAKESALYHELTHIVIKDNLFSCAMNAIVGYFEFNIDEAELKNVMEGLKRDVIQGAEDN
FT                   TVQAIAEKIIKKALVFNHLQKEWKVEITDEVVKNVISLYYEKTNQSVREYLDDKQKFEG
FT                   VRTALLEERMVLETINHFKFHFNLTGQLPN"
FT   gene            complement(670374..671987)
FT                   /gene="argS"
FT                   /locus_tag="MPNE_0654"
FT   CDS_pept        complement(670374..671987)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="argS"
FT                   /locus_tag="MPNE_0654"
FT                   /product="arginine--tRNA ligase"
FT                   /EC_number="6.1.1.19"
FT                   /note="identified by match to protein family HMM PF00750;
FT                   match to protein family HMM PF05746; match to protein
FT                   family HMM TIGR00456"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87128"
FT                   /db_xref="GOA:A0A0H3DN49"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN49"
FT                   /protein_id="ADK87128.1"
FT                   /translation="MLFINTDLQECLNALNLEFDEHKELVKLVKNNSFSGFASTVVFHL
FT                   KGVNQKETAQQIAAWLLKHKKAHYRRVFVANNNFINFEISPQKYLDFLKTKPTFAPKPT
FT                   KVLIEWVSANPTGELHLGHVRNAFFGHVLNNLMVFLGFQTVREYWVNDYGQQARVFGFS
FT                   VYQALHLQQNIKVTPHPDGYEGELVDSIAKTITGIPLDNISFEEFLQQPFLDQLLADCT
FT                   AKVLEVIKQDLATIHIHFDSWKFESQVVKETDYKKLLTQFKDEAHYEKDGAIWLKTTLY
FT                   GDDKDRVLVRQDNRPSYFGTDVAYHLDKAARGFDLLYDIWGSDHEGHIKRMHCVYEGLK
FT                   IHQKCQLKITALQLVMLYKNKEIVRLSKRAGNVITIKQMLQMLSEDAARWFMLSQTNNS
FT                   IIKIDLDTANLQNSSNPVYYVQYAYARMCSVLKVVDQAALAQVNDCSLLTHEKEIALLD
FT                   QLVYFKSLLEKVQVSHELHLLTNYLYETATLFHSWYKACKINDPAQYNLTQQRLLLLQS
FT                   LHHVFGQLLQILNITAPQQM"
FT   gene            672015..673853
FT                   /gene="gidA"
FT                   /locus_tag="MPNE_0655"
FT   CDS_pept        672015..673853
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gidA"
FT                   /locus_tag="MPNE_0655"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /note="identified by match to protein family HMM PF01134;
FT                   match to protein family HMM TIGR00136"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86883"
FT                   /db_xref="GOA:A0A0H3DKG8"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKG8"
FT                   /protein_id="ADK86883.1"
FT                   /translation="MSFTLTVIGGGHAGLEAAFIASKLGLKVNLLVLDPNHVGSCPCNP
FT                   AIGGPAKGIVTREIDVLGGMQGKAADATALQYKLLNSSKGPAVQAIRAQIDKIAYQKWF
FT                   RQQIDQTPNIELIAGEAVDILESNGKVKGVVLADGSELASDAVIVTTGTYLKAKTYCGS
FT                   LSKEEGPDRAKRSEYLSTNLIKRGFKTLRLKTGTPPRILRESLDFSQMAVEANTTPHLA
FT                   FSFTTKNYLPLEQQVICHLIHTNPQIHQLILANLKQSAVFNGSIKANGPLYCPSIEDKV
FT                   FRFQDKERHQIFVEPESLSLETVYLAGFSTSFPPEVQEHIVRLLPGFKNARFQKYGYAI
FT                   EYDAFSSIQLKSTLETKLIQNLYFAGQINGTSGYEEAAGQGLIAGINAALKLQRKPEFV
FT                   LQRNEAYLGVMINDLVTKEISDPYRLLTSRAEHRLWLRNDNLQERLIEKSRALGLVEAD
FT                   VYANYLEQQQKKKQLIDYLQTTTVGQIAALKLNFKNTAQTLFDFTKRAEIKLVDLVQLL
FT                   PKRFDLDVQSLNQIDIDIKYAGYIKKSEKYFKSLNNLSSVKIPLKLNYHKVPNLASEAI
FT                   VKLSKIRPTDLSVASQVAGINFNDILAIKHFLDNHE"
FT   gene            673846..674421
FT                   /gene="gidB"
FT                   /locus_tag="MPNE_0656"
FT   CDS_pept        673846..674421
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gidB"
FT                   /locus_tag="MPNE_0656"
FT                   /product="16S rRNA methyltransferase GidB"
FT                   /EC_number="2.1.-.-"
FT                   /note="identified by match to protein family HMM PF02527;
FT                   match to protein family HMM TIGR00138"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86988"
FT                   /db_xref="GOA:A0A0H3DKQ7"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKQ7"
FT                   /protein_id="ADK86988.1"
FT                   /translation="MNNSKLKQYVQLVQTANQNFNLTGLKTEGEIYEHLVQEIIELFNE
FT                   YDSYFDHKKVADLGSGNGCPGVILKLLFPQIKTLDLIDSKHKKVNFLKEVIQTLELNNT
FT                   QALCARIENHTEQYDTLCSRGLGSIIEVNAFALKLLKPNGIIFHIKQSLDQYLEFEDSE
FT                   QKDQFKPLFFKFFHGKRQQILIAMKKNV"
FT   gene            674414..674881
FT                   /pseudo
FT                   /locus_tag="MPNE_0657"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            674845..675081
FT                   /pseudo
FT                   /locus_tag="MPNE_0658"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(675082..675157)
FT                   /locus_tag="MPNE_0659"
FT   tRNA            complement(675082..675157)
FT                   /locus_tag="MPNE_0659"
FT                   /product="tRNA-Arg"
FT   gene            complement(675159..676475)
FT                   /locus_tag="MPNE_0660"
FT   CDS_pept        complement(675159..676475)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0660"
FT                   /product="amidinotransferase"
FT                   /note="identified by match to protein family HMM PF02274"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86670"
FT                   /db_xref="GOA:A0A0H3DLK9"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLK9"
FT                   /protein_id="ADK86670.1"
FT                   /translation="MSKKQLVKTDGHNQLDQPNTKALQLKKKQFNSGVRVTSEISFLRE
FT                   VIAHHPGIETERVIDNQTFGSAMYLERAQKEHQLFIKILRQHGTKVHYLQDLLLEALSA
FT                   ADPNVRQDFIKNFLLESGIKSVSTFEACLNFFRSLDSLVDVIKVMFGGIKVSDVPPITP
FT                   QRFADIHVSNSPFLIKPLSFSLYPHKFFNTLGTGVALFVTNDSELKRHSLVYEYIMRFH
FT                   PRFDGVKLYTNRDFKNCLINSSDIIQISNEILLIGISHDTDVLGIESLARNLLSDHTNP
FT                   IKQIIAINIHKFGAKTNLNKLIAMVDVDKFIIARKVLQATEIFELTATAQRDVDGLAQI
FT                   KFKPLKFNFGEIIEAIIDKQPRFVIIGGGDEVAERKELLDCGMGVLNLSPGEIVVFDRN
FT                   HYTNNLLNELGLIIHKIPASELSRGPSGPLEMVCSLWRE"
FT   gene            676529..677170
FT                   /gene="udk"
FT                   /locus_tag="MPNE_0662"
FT   CDS_pept        676529..677170
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="udk"
FT                   /locus_tag="MPNE_0662"
FT                   /product="uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /note="identified by match to protein family HMM PF00485;
FT                   match to protein family HMM TIGR00235"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86835"
FT                   /db_xref="GOA:A0A0H3DM37"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM37"
FT                   /protein_id="ADK86835.1"
FT                   /translation="MDSKKGILVAIGGGSCSGKTTIADMIYQLLRKKLKVAILPQDNYY
FT                   KPYKNKSMAQRKAINFDHPDAFDWKLLWSHLDNLLMGKTVAVPMYDYVNYTRKKETIEI
FT                   GPLNVVILEGLMPWFDERIAKLCKLKIFVEATGEERLIRRIERDWERGRDVASIIKQWR
FT                   EAVSPMYEIFVEKMKQKADLIIPWSERHEVSTNVLDFAIEHLFRKHVDPN"
FT   gene            complement(677167..677913)
FT                   /gene="nadE"
FT                   /locus_tag="MPNE_0661"
FT   CDS_pept        complement(677167..677913)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="nadE"
FT                   /locus_tag="MPNE_0661"
FT                   /product="NAD+ synthase"
FT                   /EC_number="6.3.1.5"
FT                   /note="identified by match to protein family HMM PF02540;
FT                   match to protein family HMM PF06508; match to protein
FT                   family HMM TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86882"
FT                   /db_xref="GOA:A0A0H3DNU5"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNU5"
FT                   /protein_id="ADK86882.1"
FT                   /translation="MTKNLLNYLNELEAWLTNYVNEAHAQGVVVGLSGGVDSAVVAAMA
FT                   KKLFPQNHLTLVMHINNSELDHKATTALVEQLQLNNKQVDLEPPYRAMLQALTIDPQKE
FT                   LMVAGNLKARLRMACLYTHAQKHNYLVLGTGNFIEYSLGYFTKWGDGACDVAPLAFLLK
FT                   SDVYALSQHFNVPELVIERAPTASLFAGQTDEAEMGLTYKELDQYFQGHLQLSATKQQR
FT                   VDHLRQSSQHKRSLPKTFKPLYSFQI"
FT   gene            complement(677906..679207)
FT                   /gene="cgtA"
FT                   /locus_tag="MPNE_0663"
FT   CDS_pept        complement(677906..679207)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="cgtA"
FT                   /locus_tag="MPNE_0663"
FT                   /product="Obg family GTPase CgtA"
FT                   /note="identified by match to protein family HMM PF01018;
FT                   match to protein family HMM PF01926; match to protein
FT                   family HMM PF09269; match to protein family HMM TIGR02729;
FT                   match to protein family HMM TIGR03595"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87162"
FT                   /db_xref="GOA:A0A0H3DN61"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN61"
FT                   /protein_id="ADK87162.1"
FT                   /translation="MGLTDYCECRFSAGNGGNGIIAWRREAHYDKGGPGGGNGGNGGNV
FT                   VLQADHNCDSLFFLKNKKHLFAESGGNGKPDLAHGKNGEDLVIKVPVGTTVRDLDTNQI
FT                   LMDFVHDQQSFILCYGGKGGKGNAAFKSPIMRAPNLYENGDKGQSLHVSLEIKYLANVG
FT                   IVGFPNTGKSTLISKLSNAKPKIANYRFTTLVPVLGVVKHNDQSLVFADIPGLIENASE
FT                   GSGLGHYFLRHIERCEILIHLISLDPVDHDDPCQAYEQIMRELSKYSQLLVKKKMLVVA
FT                   NKTDVDLDGTRFQKLAQYLENKGIPLFKISALKQELGDLVAQVFALHQKTLAQFGANKF
FT                   HLPMEMEKHYVFEQASETDHDPLNIERDALGRWHVECKRLHYWFDKIPQTTLDNIRRLG
FT                   NKIKEVGIEDQLKVAGAKKGDVIVFAGQEFVIND"
FT   gene            complement(679411..679926)
FT                   /pseudo
FT                   /locus_tag="MPNE_0664"
FT                   /note="oxidoreductase, zinc-binding dehydrogenase family
FT                   protein; this gene contains a frame shift which may be the
FT                   result of a sequencing error; identified by match to
FT                   protein family HMM PF00107"
FT   gene            complement(679926..680465)
FT                   /pseudo
FT                   /locus_tag="MPNE_0665"
FT                   /note="GroES-like protein; this gene contains a frame shift
FT                   which may be the result of a sequencing error; identified
FT                   by match to protein family HMM PF08240"
FT   gene            complement(680679..681305)
FT                   /locus_tag="MPNE_0666"
FT   CDS_pept        complement(680679..681305)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0666"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87210"
FT                   /db_xref="GOA:A0A0H3DLE7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLE7"
FT                   /protein_id="ADK87210.1"
FT                   /translation="MEQFFQSTAKRKTPAWLTGSFSFFLVFVYYIIVWVLLGEINALGF
FT                   NFVIAPNNRTLMGREVEPIFDLVLLWFLLVPLVVYALLLLLLFFTTPYLIVEAIPFFYG
FT                   IALMMISLFMSGMFPQAWNVWVIFGRFVLVLVVLMLSFFVINKLTNLVLLRSRYAMVVA
FT                   QGLVHTGKVKQQSQQAMSDIKTKWDKEKSKTVVVTIKKKRVKSSD"
FT   gene            complement(681307..682020)
FT                   /locus_tag="MPNE_0667"
FT   CDS_pept        complement(681307..682020)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0667"
FT                   /product="glycerophosphodiester phosphodiesterase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86945"
FT                   /db_xref="GOA:A0A0H3DME9"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DME9"
FT                   /protein_id="ADK86945.1"
FT                   /translation="MRKQFLIAHRGYSTIAPENTHLAFAAAQLFGFDGLWMEVQLTKDK
FT                   QIVVTNLDNYKVGNKTHKLSDINLVDLKKINLAKQFKVNVQEQTILTLKEVLMEFLTPF
FT                   RFLLLFIKGEEEQQNQVLVEQLAQLLEGFELAKEKLILLSSHFSTIKYLNEKLKSFKTS
FT                   FVFNSKKQLVHLTKDEITQNCRFLAPNDSFYHKNCAELQSYGLPIILWVIKGLLRYQFY
FT                   ENDRFVKFQIAAQLY"
FT   gene            complement(682024..685140)
FT                   /locus_tag="MPNE_0668"
FT   CDS_pept        complement(682024..685140)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0668"
FT                   /product="EAGR box"
FT                   /note="identified by match to protein family HMM TIGR03834"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86878"
FT                   /db_xref="InterPro:IPR022466"
FT                   /db_xref="InterPro:IPR038145"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKG6"
FT                   /protein_id="ADK86878.1"
FT                   /translation="MLMPKTIKKQNPSNTTLQYKKYLEQSKEKTAKAKNKDVSIDDLLK
FT                   KPFLEEIKTNVLKKNKTTRASTATRGTSKVKKQIVESSIDFFDEKKRGVFIVPPAGTSV
FT                   INDDRGDNKAVEETVSKTAISQNQLAHYANSELVETEQFELKPVALEQNQVLTSTRHSQ
FT                   ERESIFEKAQLFWQIFVGDVRFGFWKNHTWIWLGFFDQHQNWYYFEVVETVELPQEHTA
FT                   FIKRKQIDSCFWKPLVGNPNYGYIQNNIWVWKGFFDTKLNWIPDPVRFTLPMVEKATTT
FT                   TPVVQIELPAPPTVTVVDQTSPPTAAVTVSTSQPVIEEQTTVFNQTTQLEQLSVSAPLL
FT                   DQSEVETEMVEVPFVAPSTTTTQPQVVTVQAQPASSSIQFQEPIIKVEFVNESFDFKKP
FT                   SQTAAAASQAPSQAINIALNEADLIDELVAVGTTATTALPQSELIQEVVVIDNGQPQQA
FT                   GFHYVVDFLTSTAPLTVAEIELQEQELVNEFVTTTSRETTTFASTPVFEPVVIPTVEPE
FT                   EQLLENEFVESTVVSATSNEPNVASTPVVETVELTETPVSLEPLETVQLETAPVVTETV
FT                   TVTEKAVEPEVLAVVEEAPLAVEPIVETSTTLAAETVEEAQVEQESTAVAVEPAIETES
FT                   KATSEAQAELDWEALIGNSEYGYFDAEQNWIWTGYFDEDNKWVSTATAQTEANAEEVVL
FT                   TADAETSELNTESDPSFETEVEIQPEPEPNFDLETIPEPESIETTEPEPNFEPEVELEP
FT                   EIEPNFESETEVQQELAQESSFESEPEPNFETEVEVQPESEIEFKFEAEVQSEPKVSLN
FT                   SDFETKPEAQAEVTPETLEVEATSEAPELQPETEATKVVDDVEEEQLDWELLIGNSNYG
FT                   HYEPSGEWVWAGYFDDNQIWTPDASVEWARESDYTDLIGDEIYGRYNRKGEWIWYGYYD
FT                   ETGEWVLVDEHYQNHQPRISEAPRFWEQLIGNEDYGYYEDNEWKWYDGEFDSEGNWLVF
FT                   HSSNAEDAKNIDIAKDIPVFESFDVDSIDADEWLDQFSDSDAKEVFGED"
FT   gene            complement(685234..686109)
FT                   /gene="era"
FT                   /locus_tag="MPNE_0669"
FT   CDS_pept        complement(685234..686109)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="era"
FT                   /locus_tag="MPNE_0669"
FT                   /product="GTP-binding protein Era"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF07650; match to protein
FT                   family HMM TIGR00436"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86876"
FT                   /db_xref="GOA:A0A0H3DMA8"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMA8"
FT                   /protein_id="ADK86876.1"
FT                   /translation="MESIRIGVLGLTNAGKSTLVNQLHKANNLLVSPMNNTTLLAVSTN
FT                   TITHEKQNITFIDVPGFSEKRHSSYELISQEIRKALSGIDVLLLVVRSDQQQKLPLLQT
FT                   QLQPLKRYRDLTRVLLINNFFDVVLQAEDKQAIVLDFKPQAVLETDLLHFDATSFWNQF
FT                   NEVKLQANEFRKDVEFLDADTDNFKILEALREQIIKYCSEEIPHVVRLEIVDKSFDQAK
FT                   NLLKLHLSISVPKLSQKKIIIGRNAQMVKKIGMQMRQKLLEYYDCNVFVELFVRTYDPK
FT                   QKKSPYGSLI"
FT   gene            complement(686097..686528)
FT                   /gene="ybeY"
FT                   /locus_tag="MPNE_0670"
FT   CDS_pept        complement(686097..686528)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ybeY"
FT                   /locus_tag="MPNE_0670"
FT                   /product="translation metalloprotein YbeY"
FT                   /note="identified by match to protein family HMM PF02130;
FT                   match to protein family HMM TIGR00043"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86840"
FT                   /db_xref="GOA:A0A0H3DM43"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM43"
FT                   /protein_id="ADK86840.1"
FT                   /translation="MFKRFFGKNFEAGIELCLQIIKDSLQLSFQPEFALMIVSPWKMKR
FT                   LNRQFLNRKGVTDVISICYNENEAGFSPAIGEIFLCPKHIFKQAKQFGCTPWFLLTRNL
FT                   IHGLLHLFEFDHEQSLAFESVTMFFQDEIHETVLKLWNR"
FT   gene            complement(686545..686934)
FT                   /locus_tag="MPNE_0671"
FT   CDS_pept        complement(686545..686934)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0671"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86766"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM12"
FT                   /protein_id="ADK86766.1"
FT                   /translation="MKQKIIGLTLAFFVLFLTAVAILFTVKVQRYLTTSLWAKLSEQTF
FT                   LVFKNEQDEAQFNQVSWTNFQAETTKKEDKKAFRLYKKKISLEQLENENQQQLFQAVNL
FT                   SINLKQGWYNITILLPSKALFETVF"
FT   gene            complement(686936..687244)
FT                   /pseudo
FT                   /locus_tag="MPNE_0672"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(687238..688914)
FT                   /pseudo
FT                   /locus_tag="MPNE_0673"
FT                   /note="peptidase, C39 family; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF03412"
FT   gene            complement(689018..690355)
FT                   /locus_tag="MPNE_0674"
FT   CDS_pept        complement(689018..690355)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0674"
FT                   /product="cytosol aminopeptidase family, catalytic domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00883"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87188"
FT                   /db_xref="GOA:A0A0H3DNB9"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNB9"
FT                   /protein_id="ADK87188.1"
FT                   /translation="MKLNKLFDSKTVVFKKSDKYGKSDCCKTKCVEGQIEFGVKIPTDF
FT                   PAFNRALVTFLKTQKNQLNVDLDSFVELYKAENLCYKTALKVVVASITFCETTPFTMKT
FT                   EPQKNVEVAVKCDSEHTSLIKEYEVVGNYVNMARQLQDTPSDQLYPEEFVKRFEKAATG
FT                   LGVKITVLKQADLIKKKMGLLLGVNKGSEREARLLVISYNNNKKSSETLALVGKGITYD
FT                   SGGMNIKTGDYMRGMKYDMSGAAIVCSTVLALAKNKVKTNVVAVAALTENLPGPHAQRP
FT                   DDIQTAYNGKTVEIDNTDAEGRLVLADAISYAAKDLKATQIIDVATLTGLMSYILSTTY
FT                   TGIFSTCDMAWDAFKKAACCAGEPVWRLPMHPDYLKPLESKLADLQNSTSVKGAGSSRA
FT                   ACFLAEFREGVPLIHCDIASTASIQDLGQGVLVRTLYERAAQQAKE"
FT   gene            complement(690369..692000)
FT                   /gene="groL"
FT                   /locus_tag="MPNE_0675"
FT   CDS_pept        complement(690369..692000)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="groL"
FT                   /locus_tag="MPNE_0675"
FT                   /product="chaperonin GroL"
FT                   /note="identified by match to protein family HMM PF00118;
FT                   match to protein family HMM TIGR02348"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87193"
FT                   /db_xref="GOA:A0A0H3DNC3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNC3"
FT                   /protein_id="ADK87193.1"
FT                   /translation="MAKELVFGKNARNKLLAGINKLADAVKVTVGPKGQNVILGRKFSN
FT                   PLITNDGVTIAKEIELTDPLENIGAKVISVAAVSTNDIAGDGTTTATILAQEMTNRGVE
FT                   AVNNGANPVNVRRGIEDASQLIITELDKRSKKINTNEEIEQVAAISSGSKEIGKLIAQA
FT                   MALVGKNGVITTDDAKTINTTLETTEGIEFKGTYASPYMVSDQEKMEVVLDQPKILVSA
FT                   MKINTIKEILPLLEGSMENGNPLLIVAPDFAEEVVTTLAVNKLRGTINVVAVKCNEYGE
FT                   RQKAALEDLAISTGTLAYNNELGGGFKDVTVNHLGEARRVQVAKEKTTVIGGKGSKETI
FT                   QKHLDLLNGRLKQTTEKYDTDLLKERIAHLSQGVAVVRVGGATELAQKELKLRIEDALN
FT                   STKAAVEEGIISGGGIALLNVSTILNDSKLADKYKAETSAENLKEILVGYEIVRKSLEA
FT                   PVRQIIENSGVNPVKVFAELRSEADGVGFDAETKKKVDMIRSGIIDPTKVTKTALEKAA
FT                   SVASSLITTSVAVYDIKENKEGSFQE"
FT   gene            complement(692003..692353)
FT                   /gene="groS"
FT                   /locus_tag="MPNE_0676"
FT   CDS_pept        complement(692003..692353)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="groS"
FT                   /locus_tag="MPNE_0676"
FT                   /product="chaperonin GroS"
FT                   /note="identified by match to protein family HMM PF00166"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87242"
FT                   /db_xref="GOA:A0A0H3DNG4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNG4"
FT                   /protein_id="ADK87242.1"
FT                   /translation="MKITPIHDNILVSLVESNKEEVSQKGIITALANPDKNESAHKGTV
FT                   VALGAGPAYGKSEKPKYAFGIGDTIYFKEYSGISFEEEGTKYKIISLEDVLAFEKHGNT
FT                   KTTTVKKGAKKK"
FT   gene            complement(692541..692927)
FT                   /locus_tag="MPNE_0677"
FT   CDS_pept        complement(692541..692927)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0677"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86993"
FT                   /db_xref="GOA:A0A0H3DKR4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKR4"
FT                   /protein_id="ADK86993.1"
FT                   /translation="MLQNLALSFPFITRFFQKQMLGSQNSSGKTPGFNEAEGITSNIFQ
FT                   IAGGISLLVILLLIIGFLSCLLGGIFLHKHKHAEVGSPAHAKTKNLFVAFFVVGSLLLL
FT                   VAVVMLIAFGVLDASLPLPKENNS"
FT   gene            complement(693361..694581)
FT                   /gene="glyA"
FT                   /locus_tag="MPNE_0678"
FT   CDS_pept        complement(693361..694581)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="glyA"
FT                   /locus_tag="MPNE_0678"
FT                   /product="glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="identified by match to protein family HMM PF00464"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87280"
FT                   /db_xref="GOA:A0A0H3DLK7"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLK7"
FT                   /protein_id="ADK87280.1"
FT                   /translation="MEPKIRRILNKELQRQRDCICLIASENYVSRDILEVTGSILTNKY
FT                   AEGYPTRRFYEGCEVVDESESLAINTCKELFGAKWANVQPHSGSSANYAVYLALLKPGD
FT                   AILGLDLNCGGHLTHGNKFNFSGKQYQPYSYTINPETEMLDYDEVLRVAREVKPKLIIC
FT                   GFSNYSRTVDFERFSAIAKEVGAYLLADIAHIAGLVAAGLHPNPLPYADVVTSTTHKTL
FT                   RGPRGGLIMSNNEAIIRKLDSGVFPGCQGGPLQHVIAAKYVCFKEALQPKYKQYIQNVK
FT                   TNAASMASWFKQQGYRVISNGTDTHLFSLDVGKGKDVSQWLQQANIVLNMNTVPFDKNP
FT                   AINPSGIRIGTPAMTTRGFKEKHFLYVAALIDKIIKSDGNKKVIKEVKKAVLKLLERFP
FT                   LYKGLEY"
FT   gene            complement(694743..695903)
FT                   /locus_tag="MPNE_0679"
FT   CDS_pept        complement(694743..695903)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0679"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01727;
FT                   match to protein family HMM PF01732"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86734"
FT                   /db_xref="GOA:A0A0H3DKI0"
FT                   /db_xref="InterPro:IPR001850"
FT                   /db_xref="InterPro:IPR022381"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKI0"
FT                   /protein_id="ADK86734.1"
FT                   /translation="MKTVTAAGGVKRKEWKTNYLINTIPKKSEALHDLYDLSFSMQLAN
FT                   NKWRVFGTGWLIDWKKPKRTHNLSEPFYLYLATNLHIAVALSNPKDYAPFNKASIGNSL
FT                   TTVFCLGKYINPQLFKLRTDVSNAFVSIQTSTIPKTAFVARDFVPLQNRGNQWVAPVRA
FT                   SEDDPALAKSYLDFAIIEVPLFLHNQMDKQIYDHFMRPAINTYERLGNSVGIFAYQPMA
FT                   SFKRDSYFALGYPQVESNIAALNLNQTEVKPTRPEDVAQVTFKEPWSVDHHREIPTLTT
FT                   NQLTTIKTKHFSGSKLSWPFDHTKSFKIKNKWLGQNYQMYGHGLGIDQVNLRKGTSSSL
FT                   VINQKRQIVGIYFATVITNPKKAVRNDVGLVQMLRFQGEGNSLNPN"
FT   gene            complement(696539..696868)
FT                   /locus_tag="MPNE_0680"
FT   CDS_pept        complement(696539..696868)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86855"
FT                   /db_xref="GOA:A0A0H3DM59"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM59"
FT                   /protein_id="ADK86855.1"
FT                   /translation="MENKEQNNTDQLQTGDLNKARKLHKCYLWLFVVSLIIWLGFISLF
FT                   FLYYLPISLVIALVVIAFIFVLVFLGFLETWRKNINQEEEFLRLEGLLITSPTDTQSAI
FT                   HKDNQ"
FT   gene            complement(697010..697432)
FT                   /pseudo
FT                   /locus_tag="MPNE_0681"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01727"
FT   gene            complement(697500..698297)
FT                   /locus_tag="MPNE_0682"
FT   CDS_pept        complement(697500..698297)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0682"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01732"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87076"
FT                   /db_xref="InterPro:IPR022381"
FT                   /db_xref="InterPro:IPR022382"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMU2"
FT                   /protein_id="ADK87076.1"
FT                   /translation="MQLEKVPRAEYQTKWATNTVPKPTDFYHQLYNLSFSLTLTSQRWN
FT                   TYGTGWLIDWKDTSTNENKFTAYLATNFHVADTLKNPHDYPPYNQVDNTQDLTTSFRIG
FT                   KYTDPSLFGLYTNVKHAFVDVQLAALPKMAYAAVDFVDYRFDNKHWKSLNEICPEVGLK
FT                   PYADFAVLEVPLYLNNKLDYQVWENFIKPAIATYKALGDSTNLFASTSSSDLQNDTYFA
FT                   LGYPLLESNIDAIHFNQTGATLTSVPVKDRIKVKNQSFWTLNK"
FT   gene            complement(698426..699793)
FT                   /locus_tag="MPNE_0683"
FT   CDS_pept        complement(698426..699793)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0683"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01727;
FT                   match to protein family HMM PF01732"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87168"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR022381"
FT                   /db_xref="InterPro:IPR022382"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN94"
FT                   /protein_id="ADK87168.1"
FT                   /translation="MWVALKRFCFLSGLLALTVLSACSAFRKPDKFEGYYINNIPGSAE
FT                   IDHANYDLTFSLGFFNRIEKTEKDKSQIDFGSIHGTGWLIDWKEVDKKDKKANKFTVYL
FT                   ATNLHVIQALKNREDHPPYNQFDINFVRTVDFRIGKYTDVKQFVAPSKLGLPNSTQAFV
FT                   AAQPTVLPKTAFIAHDFVNYTLSKDQKNKKQREQQWKVQIKPNKDEVHPYADFAVLELP
FT                   LFLNNSSDRQIFDHFIQPAIRAYKQLGDSLNIFAYPTLDQFKHSHYYVLGYPYIAKKLP
FT                   TLFVNQTGKEKTVPGETAQIPNDQPFVSTINEEGPHLGRIKSDKFNGGTWAWNHDNTKN
FT                   FPFNRQFRGKEYQMYGKGIGITNGSLSRGASGSLVLNNKRQIVAIYFASRITETQEWGL
FT                   AQLLRWKPRSVLNEEKDSVAYDLIFGNSNTKKYYAQFAKKITLTFMGKLNLRETLV"
FT   gene            complement(699868..700908)
FT                   /pseudo
FT                   /locus_tag="MPNE_0684"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01727"
FT   gene            complement(701082..701348)
FT                   /pseudo
FT                   /locus_tag="MPNE_0685"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(701412..701819)
FT                   /pseudo
FT                   /locus_tag="MPNE_0686"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01727"
FT   gene            complement(701881..702789)
FT                   /pseudo
FT                   /locus_tag="MPNE_0687"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01732"
FT   gene            complement(702863..704233)
FT                   /pseudo
FT                   /locus_tag="MPNE_0688"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01727; match to
FT                   protein family HMM PF01732"
FT   gene            complement(704291..705886)
FT                   /locus_tag="MPNE_0689"
FT   CDS_pept        complement(704291..705886)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0689"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01727;
FT                   match to protein family HMM PF01732"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86677"
FT                   /db_xref="InterPro:IPR022381"
FT                   /db_xref="InterPro:IPR022382"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DJT8"
FT                   /protein_id="ADK86677.1"
FT                   /translation="MRLQFKLLGFLTLLGTSTILSACAATQPNFEPNNIEESGPITPTT
FT                   PTTDVPKPTAEVVPVNRGFHFQTNKVPSESDVFKHNYDLTFSLNFTNKSNDIYGTGWLF
FT                   DWKGDEKALGIDGSFVPSITSNIDNSLLKDDQFTVYLATNLHVADALRNDQDYEPYKKD
FT                   QNKQDFTENTKTEFFSLGKYLEGEQLKQYISKEENQSANQTDKALVSIQASNIPKTAYT
FT                   ATDFVDMNSYSYNNITTSLPGNYADFAVIEVNLNLKNQRDQQILHDFVKPAIKAYKALG
FT                   DTLELFSAKPLNQFIEQNYYLLGYPVINKGNNTANLLLAQQKSFDHNNSDHNQKSQWFT
FT                   KDQSYINKLDRIPVLTNNYRAYNESTGSQLFANQQNESWLNGVVIQDKGVVNFASFSNF
FT                   TLKYHEKRFQQYGYGLMLNDTNFPGGSSGSPLIGKDNKLNSIYFGVLEIYQSGSLARND
FT                   IGMSQILRTPQNDKGSSISKGSYDLIFGDKNTKNYYAKFAKDHQTHLYQKIKESKDEQF
FT                   RFVEAQETTNNLGN"
FT   gene            complement(706099..706572)
FT                   /pseudo
FT                   /locus_tag="MPNE_0690"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01727"
FT   gene            complement(706713..707366)
FT                   /locus_tag="MPNE_0691"
FT   CDS_pept        complement(706713..707366)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0691"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01732"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87261"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR022381"
FT                   /db_xref="InterPro:IPR022382"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLT9"
FT                   /protein_id="ADK87261.1"
FT                   /translation="MPITKATPLFLRYRLKGFVFLTLLLVQGVFTACAPAVPVNNKSVS
FT                   AVQPEDKQALKPDPALGEYTSDLKFNTNFIPKKDDPFRPFYDLSFTLQFQDPYTATYGT
FT                   GWLIDWKDNNQPNKFTAYIATNLHVADNLRNVNDYEFFNQFDYFDDPTESFTLGKFVDG
FT                   NEIKQIVPDAMHEPSLVRIETSKLPKTAYTATLFINDLGEYRLPAADFAVLESI"
FT   gene            complement(707523..708584)
FT                   /locus_tag="MPNE_0692"
FT   CDS_pept        complement(707523..708584)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0692"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01727"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86755"
FT                   /db_xref="GOA:A0A0H3DLW9"
FT                   /db_xref="InterPro:IPR001850"
FT                   /db_xref="InterPro:IPR022381"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLW9"
FT                   /protein_id="ADK86755.1"
FT                   /translation="MANSLRNVNDYDPFKYRPSYFDLEAPTESFALGKFVDAIEVKQMA
FT                   LDAFSESSMVSIATSQLPKTAYTATSFIESEYYSFPYLFNDQKYYWDYFDYKIPAADFA
FT                   VLELELDLNNQQDQQIKDHFIDPAIKAYKQLGDSTGLFATKPLTEYQNDTHYLLGYPVV
FT                   PTDHTQLWECKQGAERFSYGYFYSNMARLTKNLRQGDPNAGSKTHIEYSNELLDKDSMD
FT                   QGIVRFSTFLGANINYHDYDYRQQGYGLTLTDTNLPGGSSGSLVFNQDKKISSIYSAAT
FT                   ESDSVGYAQLLRTPRDVNGISVVSQSYDLIFGDSNTKRYYAMFAKKQQTHLYSEILKST
FT                   DEQYRYVVDKQFN"
FT   gene            complement(709107..710672)
FT                   /locus_tag="MPNE_0693"
FT   CDS_pept        complement(709107..710672)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0693"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01727;
FT                   match to protein family HMM PF01732"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87056"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR022381"
FT                   /db_xref="InterPro:IPR022382"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMS0"
FT                   /protein_id="ADK87056.1"
FT                   /translation="MGFKLKGFGFLTLFASQAFLTACSATLTVANTNHKNESDKFVIFE
FT                   PQPPLSQTIPKPEAEPVIEPDAVATPPVQNAEVQIKPDSSKGVYSPGFKFNTNFIPKVN
FT                   TKYRPGYDLSFALKFGTSWKEAYGTGWLIDWKDVKQDNKFTAYLATNLHVADSLRNKDD
FT                   YKPYNKDGNQKEFLPGDITTEFSLGKYIDAQTVQKLTPEYQNLKHLNNRNSDALVSIQT
FT                   SKLPKTAYTATDFIKTAQYKYNHIVGNTVYELDLFQNAVSYADFAVLELELNLANNRDQ
FT                   QIFDSFINPAVTAYEKLGNSLGLFSNLQLDQYVDDTHYLLGYPLLKREKTSYWNLPQKG
FT                   YSSPLYENSNKEVSRITRNIRKDDEIPGSRLVQNQINYLPFAQNDPKGVMDFSKYFNYV
FT                   FNYHEKQYQHHGYGLLLEDTDFPGGSSGSPLFNQNKQINSIYFAALPSKSYGVSQILRA
FT                   TQNKDKSKNYDLIFGDSNTKKYYAQFAKEHKTHLYHQILQSNDEQFRFVENDQTVTSQT
FT                   PFKS"
FT   gene            complement(710773..711141)
FT                   /locus_tag="MPNE_0694"
FT   CDS_pept        complement(710773..711141)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0694"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86955"
FT                   /db_xref="GOA:A0A0H3DMG1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMG1"
FT                   /protein_id="ADK86955.1"
FT                   /translation="MNKKESTTTKKQWFKKCSFKKLKAEICNMLPTTPHNTKRTLIWVI
FT                   VFSFITFLSFIFAYVCFNYAPVSTGFLYFLGAVFLLIGFAFAILSFVAMVKFVADYFAN
FT                   RFSNTQLKMDCDCAKTKK"
FT   gene            complement(711367..711669)
FT                   /locus_tag="MPNE_0695"
FT   CDS_pept        complement(711367..711669)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0695"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86888"
FT                   /db_xref="GOA:A0A0H3DKH2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKH2"
FT                   /protein_id="ADK86888.1"
FT                   /translation="MRGKNRNKCNSIIFLTVGLLLFIAALALGVLVLFNGYQVNVNANG
FT                   VDLKPFEIVHFPFAVKTFLSVLTFVLAAFGFVCMVASFLYFVSFKKLKPKANSAS"
FT   gene            complement(711653..712105)
FT                   /gene="rpiB"
FT                   /locus_tag="MPNE_0696"
FT   CDS_pept        complement(711653..712105)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpiB"
FT                   /locus_tag="MPNE_0696"
FT                   /product="ribose-5-phosphate isomerase B"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by match to protein family HMM PF02502;
FT                   match to protein family HMM TIGR00689; match to protein
FT                   family HMM TIGR01120"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87234"
FT                   /db_xref="GOA:A0A0H3DQ04"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DQ04"
FT                   /protein_id="ADK87234.1"
FT                   /translation="MNHPIYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDDY
FT                   PDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDA
FT                   NVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYEREK"
FT   gene            complement(712111..713820)
FT                   /locus_tag="MPNE_0697"
FT   CDS_pept        complement(712111..713820)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0697"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87156"
FT                   /db_xref="GOA:A0A0H3DLJ5"
FT                   /db_xref="InterPro:IPR010379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLJ5"
FT                   /protein_id="ADK87156.1"
FT                   /translation="MVVIAALLGSLAVLAFLFYLWYLTIFIIVHKNQQYLEQTKALYNK
FT                   LKLSNFNSVIVPFQLLRSEKKALEQPVKLLKSFQESFNSEINSALEQLLVFSEPKALYN
FT                   CFWFNRNIKLLRKNLQGLHDKQQRYVKLTKNAIAYFDSSYDTLVFYRQAFCLLVSFIND
FT                   FLVHKYDSLFYLNIINRISLLFKDVELHIKNKDVKQQNQALNKLHNNLAQTIITASRQY
FT                   FFDVKVGYLNYHFQILSQKVTQLRSMKNKAINSQEVAKFQELITNIGATLAECSQALGN
FT                   INLALCEHRINQAKEQIDVLSNAVSVKEKAISLVVSNVDSFLKSINHYQQQNALLQTLM
FT                   KEIELMFQNNLDTVNIINQINEHSLLIAQKTQLLNQENALTEFIDYEKLFRLMSEAMKL
FT                   LDGLKNLLNELFALSANKFDDYRFFVYTLDDFRFKFFQIENLIANEELIISEKTLKIIS
FT                   QAKHQFDDIFTQAKNDYEGAFSYLNEKVRFFQNQLTHVIVDVVGLMNLRSMCKHTFIFA
FT                   NKYRQESPQINESLETLTQFYQQQNYSETLSGLISLLGKIKSSAKQHHLDLN"
FT   gene            complement(713820..714221)
FT                   /gene="atpC"
FT                   /locus_tag="MPNE_0698"
FT   CDS_pept        complement(713820..714221)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="atpC"
FT                   /locus_tag="MPNE_0698"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF02823;
FT                   match to protein family HMM TIGR01216"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87066"
FT                   /db_xref="GOA:A0A0H3DMT1"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMT1"
FT                   /protein_id="ADK87066.1"
FT                   /translation="MQPLRFLVLSPSGIKLDQAIISAQVKTTNGYLGLNYNRAPLIAAV
FT                   QSHFCKILFANNTRRNAIIGAGLVLIKKTEAKIFTENFVFEDEIDLEATLKRKAELERQ
FT                   MNHSKDLKLNIKIEQNLMFELLKLSNKQR"
FT   gene            complement(714224..715651)
FT                   /gene="atpD"
FT                   /locus_tag="MPNE_0699"
FT   CDS_pept        complement(714224..715651)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="atpD"
FT                   /locus_tag="MPNE_0699"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86820"
FT                   /db_xref="GOA:A0A0H3DM25"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM25"
FT                   /protein_id="ADK86820.1"
FT                   /translation="MKKENITYGKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAGEEL
FT                   FLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDG
FT                   KEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKT
FT                   VLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGA
FT                   RMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLAT
FT                   EMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFP
FT                   AINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVE
FT                   RARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQ
FT                   EAVEKAKRLKKATVEEK"
FT   gene            complement(715651..716490)
FT                   /gene="atpG"
FT                   /locus_tag="MPNE_0700"
FT   CDS_pept        complement(715651..716490)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="atpG"
FT                   /locus_tag="MPNE_0700"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00231;
FT                   match to protein family HMM TIGR01146"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86930"
FT                   /db_xref="GOA:A0A0H3DMD4"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMD4"
FT                   /protein_id="ADK86930.1"
FT                   /translation="MAFIQEIKRKMTTVQSTIKITNAMKMVSRAKFVRFKKQFKEVNYF
FT                   FNEFYKAVGQVVLSLKKMPKPLENPKTLWVMMSSSLGLCGQHNTNMNKLLQTKFQPGDK
FT                   IFFLGRKNQSFWNKGDTDNPTVGYVDIQDRDLSFDYCQQVSDQIMEQFDLHQLDRICII
FT                   YTQFKNPLIQHANSFQVFPFDVAMFKAFNPVKMEQKLDFEPDEETIIKLISPQFFDIAL
FT                   YGGLVETKLCESASRQNAMDAAAKNAKDLYEKYSIQFNKLRQNSITQEIIEIIGGIS"
FT   gene            complement(716490..718046)
FT                   /gene="atpA"
FT                   /locus_tag="MPNE_0701"
FT   CDS_pept        complement(716490..718046)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="atpA"
FT                   /locus_tag="MPNE_0701"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM PF09378;
FT                   match to protein family HMM TIGR00962"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86681"
FT                   /db_xref="GOA:A0A0H3DN85"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN85"
FT                   /protein_id="ADK86681.1"
FT                   /translation="MADKLNEYVALIKNEIKKYSKQIFNSEIGKVISVADGIAKVSGLE
FT                   NALLNELIEFENNVQGIALNLEQNTVGVALFGDYSKIREGSTAKRTHNVMQTPVGDVML
FT                   GRIVNALGEPVDGRGPIKAEEFDQVEKIAPGVMTRKTVNQPLETGILTIDALFPIGKGQ
FT                   RELIVGDRQTGKTSIAIDTIINQRGKDVYCVYVAMGQKNSSVAQIVHQLEVTDSMKYTT
FT                   VVCATASNPASMIYLTPFTGITIAEYWLKQGKDVLIVFDDLSKHAIAYRTLSLLLRRPP
FT                   GREAFPGDVFYLHSRLLERACRLNEEHGGGSITALPIIETQAGDISAYIPTNVISITDG
FT                   QLFMVSNLFNSGQRPAIHVGLSVSRVGSAAQIKAIKQQTGSLKLELAQYSELDSFSQFG
FT                   SDLDENTKQILERGKRVMEMIKQPNGKPYSQTHEALFLFAIAKSFIKFIPLDYIAKFKQ
FT                   RIMEEFDKEHPIYKEIATQKSFSEALEAQTNTAFKALVKRFVSALPDYDITKYGTMEEL
FT                   E"
FT   gene            complement(718049..718585)
FT                   /gene="atpH"
FT                   /locus_tag="MPNE_0702"
FT   CDS_pept        complement(718049..718585)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="atpH"
FT                   /locus_tag="MPNE_0702"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00213;
FT                   match to protein family HMM TIGR01145"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86803"
FT                   /db_xref="GOA:A0A0H3DK94"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK94"
FT                   /protein_id="ADK86803.1"
FT                   /translation="MINAQAFGMALFQLSEEEKKVKKVYDQSHDFLKLARNFKDGSLAA
FT                   LLNTYTLTKKEKLKLIDKLFKNHFCDLFVDFLKTIVLKGYFNLVEQALKYFFDCVENEK
FT                   HVQFIRIITAFELSAPQLKRIVAAMEKKLNSKIVYKTEIDKSLISGIRIESSAQLFEKN
FT                   IRDQLSRLMEQFKGN"
FT   gene            complement(718578..719201)
FT                   /gene="atpF"
FT                   /locus_tag="MPNE_0703"
FT   CDS_pept        complement(718578..719201)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="atpF"
FT                   /locus_tag="MPNE_0703"
FT                   /product="ATP synthase F0, B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00430;
FT                   match to protein family HMM TIGR01144"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87271"
FT                   /db_xref="GOA:A0A0H3DLU3"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLU3"
FT                   /protein_id="ADK87271.1"
FT                   /translation="MKLRATFVFKTTLVALSFALFALFLVSCTENVKEIKSESVINELF
FT                   PNLWVFLAHLLAFVILLFLLLFLFWKPTQKFLNQRKALLEEQVNQANSLEQQAQALLQQ
FT                   ANQRHENSLVVAKEIVDQANYEALQLKSEIEKKANRQANLMIFQARQEIEKEKRLIQEQ
FT                   SLKESVELAMLAAKELIIKKVDVKADKAFIEEFIRELEAEDDHD"
FT   gene            complement(719204..719521)
FT                   /pseudo
FT                   /gene="atpE"
FT                   /locus_tag="MPNE_0704"
FT                   /note="ATP synthase F0, C subunit; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00137; match to
FT                   protein family HMM TIGR01260"
FT   gene            complement(719524..720405)
FT                   /gene="atpB"
FT                   /locus_tag="MPNE_0705"
FT   CDS_pept        complement(719524..720405)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="atpB"
FT                   /locus_tag="MPNE_0705"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00119;
FT                   match to protein family HMM TIGR01131"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87113"
FT                   /db_xref="GOA:A0A0H3DN34"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN34"
FT                   /protein_id="ADK87113.1"
FT                   /translation="MSPRAIVLKEPNGVNLVPHEGIFDISPVAGWKPLLPTDQVFGIFV
FT                   VFIVLLTLFLVYWIKLRKADPLRNHSSFVLLMQMLFVWAQDTTADLIGEENKKFTPYFL
FT                   MLLLYLVSSNLIGLLGGISPPTSSLTFTFSLGLATFLGIVIMGIRYQRWSFFKSFTFNI
FT                   TIKGKKYSTLIPNPLSFLGEFAPLFSISLRLWGNILGGTLILALFYNFWFFAFSTLSNK
FT                   PLALSLGAIFAGILTPALHVYFDVVVGTLQGYVFVMLTYNYWAKMRNIGLEESQEAAQR
FT                   LQNLEVAKEIIN"
FT   gene            complement(720371..720844)
FT                   /locus_tag="MPNE_0706"
FT   CDS_pept        complement(720371..720844)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0706"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87196"
FT                   /db_xref="GOA:A0A0H3DLM9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLM9"
FT                   /protein_id="ADK87196.1"
FT                   /translation="MYNWTNKKLTKAIALIILVLWLVVLVGILVWALTTQHLKVLYGWL
FT                   LPFPFVALSVVGLLKLGDFFEKFKHLSKQRVTVFFGSFFVARYLLYLIPVLLAFFIRPQ
FT                   YFHVIATIISTLFFPLLKIVISFAWLPLEYHCKNLISKLNKKHVTTGDSFKRT"
FT   gene            complement(720850..722220)
FT                   /gene="eno"
FT                   /locus_tag="MPNE_0707"
FT   CDS_pept        complement(720850..722220)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="eno"
FT                   /locus_tag="MPNE_0707"
FT                   /product="phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /note="identified by match to protein family HMM PF00113;
FT                   match to protein family HMM PF03952; match to protein
FT                   family HMM TIGR01060"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87137"
FT                   /db_xref="GOA:A0A0H3DN38"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN38"
FT                   /protein_id="ADK87137.1"
FT                   /translation="MSAQTGTDLFKIADLFAYQVFDSRGFPTVACVVKLASGHTGEAMV
FT                   PSGASTGEKEAIELRDGDPKAYFGKGVSQAVQNVNQTIAPKLIGLNATDQAAIDALMIQ
FT                   LDGTPNKAKLGANAILAVSLAVAKAAASAQKTSLFKYLANQVMGLNKTEFILTVPMLNV
FT                   INGGAHADNNIDFQEFMIMPLGANSMHQALKMASETFHALQKLLKQRGLNTNKGDEGGF
FT                   APNLKLAEEALDLMVEAIKAAGYQPGSDIAIALDVAASEFYDDTTKRYVFKKGIKAKIL
FT                   DEKEWSLTTAQMIAYLKKLTEQYPIISIEDGLSEHDWEGMETLTKTLGQHIQIVGDDLY
FT                   CTNPAIAEKGVAHKATNSILIKLNQIGTLTETIKAINIAKDANWSQVISHRSGETEDTT
FT                   IADLAVAACTGQIKTGSMSRSERIAKYNRLLQIELELGNNAKYLGWNTFKNIKPQKA"
FT   gene            722275..722748
FT                   /gene="msrA"
FT                   /locus_tag="MPNE_0709"
FT   CDS_pept        722275..722748
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="msrA"
FT                   /locus_tag="MPNE_0709"
FT                   /product="peptide-methionine (S)-S-oxide reductase"
FT                   /note="identified by match to protein family HMM PF01625;
FT                   match to protein family HMM TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87134"
FT                   /db_xref="GOA:A0A0H3DPL8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPL8"
FT                   /protein_id="ADK87134.1"
FT                   /translation="MKQIYFGGGCFWGTQKYFDLIKGVQKTSVGYLNSNMKNPTYEQVC
FT                   SGQTNAVEAVFVEYDENKVSLNELIDAFFKVIDPTIRNRQGNDIGTQYRTGVYWVDPQD
FT                   EQLITQKFRELQANYPKPIVTENRAMENYFLAEEYHQDYLKKNPHGYCHIKFD"
FT   gene            complement(722745..723422)
FT                   /gene="phoU"
FT                   /locus_tag="MPNE_0708"
FT   CDS_pept        complement(722745..723422)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="phoU"
FT                   /locus_tag="MPNE_0708"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /note="identified by match to protein family HMM PF01895;
FT                   match to protein family HMM TIGR02135"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87059"
FT                   /db_xref="GOA:A0A0H3DKZ1"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKZ1"
FT                   /protein_id="ADK87059.1"
FT                   /translation="MESINYQILKRSEKKLLGLFFDYFQHVIKMHETLNKLLCEADVTK
FT                   REKLIQAIYEMEDFSNKSEFKLINESIWAISKNSPLTNHLRLTITIIMCSRDLERICDY
FT                   ANNLTKFVKHYQHLDVSIFSKLVNLHKSVLNNLKQTFASLQDKEKPLTIQFENVTKILT
FT                   EFEQQYRVVLTEYYDKVKDEKLSDRIFLIDLILSVKHIERINDYCYNIIKAFLFVKNPE
FT                   VFN"
FT   gene            complement(723425..724414)
FT                   /gene="pstB"
FT                   /locus_tag="MPNE_0710"
FT   CDS_pept        complement(723425..724414)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pstB"
FT                   /locus_tag="MPNE_0710"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00972"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86847"
FT                   /db_xref="GOA:A0A0H3DNR5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNR5"
FT                   /protein_id="ADK86847.1"
FT                   /translation="MKKGLKTIWHNFIQKREKVKQYRALYEKQIKQYQQKVAKLDPTTK
FT                   AEEIANLQSEIDVLQRLIKIKNTKDDVVKQDFDKKNVFEIENLNFWYNKDKQVLFDINL
FT                   KIKRNKITALIGKSGCGKSTFIRCLNKLNDLNENVRWNGKIFFLGKNINSGIINDLTLR
FT                   TRVGMVFQQLTPFNFSIFENIAYGLRAHGIHNKQAIHEIVEQALKSTALWDEVKDNLHR
FT                   NANTLSGGQQQRLCIARAIALQPDVLLMDEPTSALDSIATNSIELLIQQLKEKYTIIIV
FT                   THSMAQTIRITDETIFFANGRVVEQGTTKQIFTRPKQKETNRYISGRN"
FT   gene            complement(724399..726354)
FT                   /gene="pstA"
FT                   /locus_tag="MPNE_0711"
FT   CDS_pept        complement(724399..726354)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pstA"
FT                   /locus_tag="MPNE_0711"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00974"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86933"
FT                   /db_xref="GOA:A0A0H3DKK4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKK4"
FT                   /protein_id="ADK86933.1"
FT                   /translation="MKQKIKSRLKKDNWLRYLSQTVAVCFLLLFISFFIFLLIEAAKTG
FT                   PDFTKSLLGLEFNLGAKKASIWFPLLVSFVVSIGSLIIASYIGVRTSIFLVYRCKPRIR
FT                   KKLLLVIDILSGIPSVIFGLFATQILSSIFRDVLHLPPLSLLNVIVMLSFMIIPIVISL
FT                   TTNALLHVESSLMTVAISLGENKTSVIYKVIKKEIKAQLVVILVLAFGRAISETMAVNF
FT                   ILQSVNYQEVIANDRFFTSDLKTLGSVISTFIFSENGDEQVSGVLYTFGIIIFVLISFL
FT                   NFFAIWSTRPKTLERYPFLKKISNFIYQVVWFIPNNIGALFTDLTARRQQVKKITAANV
FT                   EQRATFFKERMQTNHLNKVYTSWKILQEIFCAVLAFGFVLGILLFVFINGSQAIQRSGS
FT                   TVFSFGVDTTGRALVNTLVIILVAIGITFPIALLIAIWLNEYTKSRIAKNTFSFVIDSL
FT                   SSMPSIIYGLFGLSFFLRTLQLSAGGANGTSLMAGILTISVVVLPFLIRTCQEALNNVS
FT                   WDLRVSAYALGVSKREVIWKIVLPGALKGLIIALILTINRIIAETAPFFITAGLASSNL
FT                   FDLSLPGQTLTTRIYGQLFSTNSTAVDVMLETALVSIVFLMFLIFLSSYLIPYLFSFNK
FT                   QKWLQIKSKLQLWKKA"
FT   gene            complement(726354..727511)
FT                   /locus_tag="MPNE_0712"
FT   CDS_pept        complement(726354..727511)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0712"
FT                   /product="bacterial extracellular solute-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86708"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKD3"
FT                   /protein_id="ADK86708.1"
FT                   /translation="MPVFLKLTHTIRKVLRVARLSRLALLSLTAVIFSGCANINLISAV
FT                   GSSSVQPLLSKLSSHYVLNHNDKDNLVEISVQAGGSSAGVKAITKGLADIGNVSKNTKS
FT                   YAEENKQLWMDKKLKTITLGKDAIAVIYKAPSEFKGKLVLTKDNLNDLYDLFAGSKSVD
FT                   INKFVENGQTTKNSNHNLIGFPRTGGAFASGTAEAFLKFSGLTQTKTLDKDSKEILEGQ
FT                   RNYGPNARPTSETNIEAFNTFVTTLRQPNLYGMVYLSLGFVNNNMNLIKSEGFEVLKVK
FT                   YDNNAVTPSSQAVSSNTYKWVRPLNSVVSLLPKQKTLPSIQRFFNWLLFSNNSEIKKIY
FT                   DDFGVLELTADEKKKMFKTGNAEMSNIANFWVDDYSLNNQTFGAL"
FT   gene            727607..727756
FT                   /locus_tag="MPNE_0714"
FT   CDS_pept        727607..727756
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0714"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87071"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMT6"
FT                   /protein_id="ADK87071.1"
FT                   /translation="MPIVSFANFFLREAAFLLIIQPMAVAPKANTPAIADKDQVNIWLV
FT                   LALV"
FT   gene            complement(727753..728700)
FT                   /locus_tag="MPNE_0713"
FT   CDS_pept        complement(727753..728700)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0713"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87267"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNI6"
FT                   /protein_id="ADK87267.1"
FT                   /translation="MEKLNDFEKQQIVFVIKNSFAGVDKTVLDVDANSLTFVEDPRQYK
FT                   LDLGNMNENKGFFYVLADIHNSNELFKLGSTIDPEIIKGQMYFVKQNQIKPNTRTYLFK
FT                   INTRKLLLDKQKLWFKPHLETQTVSFMFDEFEIGKLDIETSNIQLIDDYEFEFQSDFSL
FT                   QDEQVLLEKLNIVLSQMNLHVETKNARLNPVNKMAYLTVLKNNQKFNLEFHVDRYTSQL
FT                   SIQAMLGSQRLFAINYDLKLSQNKQMLYLINKDGLEKSVWFNIKNDSQTKLAQQLARFL
FT                   KENNFQFRQKPVFDFHTQNKAFALEKLDNKDDTD"
FT   gene            complement(728767..730677)
FT                   /locus_tag="MPNE_0715"
FT   CDS_pept        complement(728767..730677)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0715"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL66"
FT                   /protein_id="ADK86984.1"
FT                   /translation="MDKNLVDSSLYISNSAHHNQGFTVGIKLKDSYFRKDFNFENPLIY
FT                   KPNNKTTFGWNYSTLWTQLADGYYDRYNQLLRENNFNWYNNIYYIKDVNLGIESSYTSS
FT                   LAWNKTFSYPGVRNSFKSDIHDLQYFHFHNDSKSGFGPSRINDPWYPQHDKYVTLSAGR
FT                   TAEEAKNAGWSIPYNLETQRLFSPVWNRNKDFKWINVFFGFMNRSLSVKSPNINDIVQN
FT                   AKWIKQGKNGNYFIIFNAYAITQNDGFFEDRPNNIFIATLWNNWWLESTPIYIYRVFWE
FT                   VELIKTPRVFEQDNVQWNEPVLPKETWVFSIDNKQANAYWSSSNGFKDKVIKDRKIMEA
FT                   FTRNRQVTQSILNMGKNVVVKPLTDDEEQSLFSNKWDIFKYTPIIPVNAQRFGVDFYVE
FT                   QHNADLKPPISFSQLSRLWLSQLQFDPNSVVDTLSKTFNEKDLSQKDQLQIMFKKEFTQ
FT                   AIAQISKLNEEIDLATDKATALQKFDSLKSKDSNVNFASLQYLYDLLGMEPTNKEHLIF
FT                   IRNLPEMLQTIFARAKLLAKVKIGDTLQEITLLKNNVNVFDIKTWEKYLTPQQHASNEY
FT                   TINFLSLDFIVDGYESENLHFQVVDQLFGAVKNLPTINKIPEGYQYKFKYRSNFSNQQF
FT                   K"
FT   gene            complement(730861..731691)
FT                   /locus_tag="MPNE_0716"
FT   CDS_pept        complement(730861..731691)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0716"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87025"
FT                   /db_xref="GOA:A0A0H3DLA2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLA2"
FT                   /protein_id="ADK87025.1"
FT                   /translation="MYFLKKETKIPTIRTYLFQMRTHKIALNANDVWFQANNDKVKVIV
FT                   DGIELDQFDPKLPNVAFFNDYQVDLVSTLTLADKQLLIRRLNLALVGMNLMVDEQATNI
FT                   ETFPKQIRLTTKSIDQSFDFDVEFNPKASELNVIVKVDEQPLFKLDYELVIKNSNTLQL
FT                   VNRNKHLGMYIWSVADQRYQAKLLDTLQLFLQSKQMYLKEKIPLKLQDNTATFKIAKQA
FT                   QPNNGENKNTNFIGYLVIAASSLFLVVVAFSFYFYKRKKSLKSHKQKAVVKTDK"
FT   gene            complement(731831..732301)
FT                   /pseudo
FT                   /locus_tag="MPNE_0717"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(732411..732809)
FT                   /pseudo
FT                   /locus_tag="MPNE_0718"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(732922..733119)
FT                   /locus_tag="MPNE_0719"
FT   CDS_pept        complement(732922..733119)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0719"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86738"
FT                   /db_xref="GOA:A0A0H3DK34"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DK34"
FT                   /protein_id="ADK86738.1"
FT                   /translation="MAEIELSFPPLEIQEKIADILFAFEKLCNDLVEGIPAEIEMRKKQ
FT                   LDYYYHLIFSKIAHFSKQLA"
FT   gene            complement(733578..734027)
FT                   /pseudo
FT                   /locus_tag="MPNE_0720"
FT                   /note="type I restriction modification DNA specificity
FT                   domain protein; this gene contains a frame shift which may
FT                   be the result of a sequencing error; identified by match to
FT                   protein family HMM PF01420"
FT   gene            complement(734100..734498)
FT                   /gene="rpsI"
FT                   /locus_tag="MPNE_0721"
FT   CDS_pept        complement(734100..734498)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsI"
FT                   /locus_tag="MPNE_0721"
FT                   /product="ribosomal protein S9"
FT                   /note="identified by match to protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86926"
FT                   /db_xref="GOA:A0A0H3DMF8"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMF8"
FT                   /protein_id="ADK86926.1"
FT                   /translation="MEKQSYYGLGRRKSSSAKVYLTPTQDKGKITVNRRDPSEYFPNKI
FT                   VIQDMEQPLDLTDLKKNFDINVVVKGGGFTGQAGAIRLGIVRALLQFNPELKKILKSKK
FT                   LTTRDKRVKERKKFGLYGARRAPQFTKR"
FT   gene            complement(734504..734929)
FT                   /gene="rplM"
FT                   /locus_tag="MPNE_0722"
FT   CDS_pept        complement(734504..734929)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplM"
FT                   /locus_tag="MPNE_0722"
FT                   /product="ribosomal protein L13"
FT                   /note="identified by match to protein family HMM PF00572;
FT                   match to protein family HMM TIGR01066"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87111"
FT                   /db_xref="GOA:A0A0H3DLH1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLH1"
FT                   /protein_id="ADK87111.1"
FT                   /translation="MLTKEQANKRRQWYIVDAAGLVLGKLAVKAADLIRGKNKVDFTPN
FT                   QDCGDYLIIINSDQVVLTGNKKENEFWYHHSQYIGGIKKVSGRDMLKKQSDKLVYNAVK
FT                   GMLPDNRLSRRWITKVHVFKGDKHNMEAQKPTTLNWS"
FT   gene            complement(734975..737020)
FT                   /gene="dnaX"
FT                   /locus_tag="MPNE_0723"
FT   CDS_pept        complement(734975..737020)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dnaX"
FT                   /locus_tag="MPNE_0723"
FT                   /product="DNA polymerase III, subunit gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF06144; match to protein
FT                   family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87063"
FT                   /db_xref="GOA:A0A0H3DPC9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPC9"
FT                   /protein_id="ADK87063.1"
FT                   /translation="MRKVLYQKYRPTKFSDTVGQDSIKRIIVNAITQDQLPHGYIFAGE
FT                   RGTGKTTFAKIIAKAINCLNWNGDVCNQCEACQAINSNSAIDVFEIDAASKNGINDIRE
FT                   LAENVFNLPFKFKKKVYILDEAHMLTPQSWSGLLKTLEEAPDYVLFIFATTEFNKIPIT
FT                   ILSRCQSFFFKQITNDLIQQRLAEVAAKESIKITTDALVKLADLAQGSLRDGLSLLDQI
FT                   SNFSESKTISLADVEKTFNLLDKEQKFGFIEAVLSGDLKQSFHLIDNFESQGINFVHFL
FT                   RELFALTVDLYGYVKTGQIAVVKPSDQTMAAKLRFHPKQYALLVQAIEANNGYGPSQLS
FT                   LSDQIKAIVIHYKNAVSKEPHIPAYTPVVQTQSPAKEPVPSKTVEEAKPQLPAKEPVLY
FT                   KVIEEPKVSSFVKDPVASKLIEQPQTIVQPEAQQEITEVEQPTETSPAPATDLFGLAIK
FT                   PEVVRKRGRRPLSVENTDFFQPAVKKLIQPVSKPAPIKLIEPSDNNPVSIPIKLNRAVI
FT                   AVSVYGHNDPKLVAHFQQLLDSFKREFTQAEKTKDSSYLKQFSDKFTASDLSKAIKVLA
FT                   ASPFGLVLIFEDKEIATRLWKEALTEATAQATLLEIFQQNLFLSSFTLSEYETKVLAKV
FT                   EQLTHKPQVLQLQQLEQLSSTVVKKAQKTAAQEIADTFFKGLYEEK"
FT   gene            complement(737029..739875)
FT                   /gene="uvrA"
FT                   /locus_tag="MPNE_0724"
FT   CDS_pept        complement(737029..739875)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="uvrA"
FT                   /locus_tag="MPNE_0724"
FT                   /product="excinuclease ABC, A subunit"
FT                   /EC_number="3.1.25.-"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00630"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87253"
FT                   /db_xref="GOA:A0A0H3DNJ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNJ5"
FT                   /protein_id="ADK87253.1"
FT                   /translation="MKPELKTNDFIRVKGARENNLKNVNIDIPKNQFVVITGLSGSGKS
FT                   SLAFNTIYAEGRRRYLESLSSYARQFLGNSDKPDVDSIEGLSPAISIDQKTTSHNPRST
FT                   VGTVTEIYDYLRLLWARIGIPFCPNGHGAIQTQTVNQIANQIFNLPVKSRIQILAPTIK
FT                   NQRGTFANEFAKYQQLGFLRVWVDGQVYTLDEEIKLDKNTKHNLSVVVDRIVINQDKQT
FT                   LGRIVDAIEGVIKLTEGRIEVLLEDGKILSFNKNHGCDQCGFSISELEPRLFSFNSPLG
FT                   SCEYCKGLGFSYEPDVEKIIPNPLLSINEGGIDIFKNIVHGTSLDWQRFLSLINHYQIP
FT                   LDQPLGQMDTDLVRMILEGSDEPIEIKTVSNSGAKNVRFEHYEGVAHLIKRRHLETSSQ
FT                   ASREWYSAYMSEITCKKCQGKKLTTNSLSVKLGGLDIISFTELSIDKAIEFLLQIELNQ
FT                   EQKKIGELALKEIINRLSFLKNVGLEYLNLARRASTLSGGEAQRIRLATQIGSQLTGVL
FT                   YVLDEPSIGLHQKDNDRLINTMMVMRDLGNTLLVVEHDSETMLAADYLIDIGPKAGNQG
FT                   GEVVAAGTPLEVMENTDSLTGQYLSGKKQIEVPKTRHAGNGRTLTLKGAKGNNLKNINV
FT                   TIPLNKLVLVTGVSGSGKSTLINQTLVPILERLVNYKNVKPAPYKEIIGVNHIDKVVVV
FT                   SQDPIGRTPRSNPATYVSVFDDIRELFANTKEAKARGYTNSRFSFNVAGGRCDKCFGDG
FT                   VIRIEMHFLPDVYVTCEMCDGKKYNPQTLEVKYLGKSIFDVLQMSCQEAYDFFKAIPNI
FT                   ARKLKLLCDVGLEYLQLGLNVTFLSGGEAQRIKLAKFLQKKATGKTLYVLDEPSTGLHI
FT                   EDINKLLTVIQRIIKNGDSVIIIEHNLDIIKMADYIIDLGPEGGEKGGQIIAQGTPEQL
FT                   LNQVDKSYTAQYLAKILK"
FT   gene            complement(739853..742372)
FT                   /locus_tag="MPNE_0725"
FT   CDS_pept        complement(739853..742372)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0725"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87180"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLB6"
FT                   /protein_id="ADK87180.1"
FT                   /translation="MLKQISTTTKKEPWVNLSLLMVHNSFLDINYFWTTNLSIHKYGNY
FT                   LVNNLNKAQWNTLSSVLQLKKAPHSGFLWTDQHNYIPLHRVKTNLCEKIELAAVQQSHP
FT                   FHQTIHDFLRQSTCPKKRQRLIEKLQIPNELRWFLGFNALKKLSQFVVFELDNTNKLTS
FT                   ETLSQFFTTKFVNKVYFNQIQFEYNNFVGLLEDHERDLVEFSTHFFNSFFEQPDHLTKS
FT                   FFEQYYALTRQRERLLHNLKVQSYETKHGVNTYFENLQITRAQQQANQLKRAFKKQQRN
FT                   SVQLINRFMSSLWWSQTKIKFKSIFNFYKTRILEKRIVAKRIQIKIWLLKELKQMRLLN
FT                   PDLLVSTIAESERLVEQLMSNIQRLYQQILQLKPGQSLNWKYQAISFELEKLTKPIVLT
FT                   HDAVIGFLIKSRLAFLQEYAKGLNRCEQHNKLVNELKQNVLLNQNQYKGEVSQSYSVVN
FT                   QKAVFKGFIQTVKAALNYTKLKHTLDPFNLMNIVQERCFEQLLTTYEKLDWTKYELNQL
FT                   YFVCRALWTNLHKQTQHFFTKYQFITHGVVDFVFNQGRNQTQFASLKANLNRDWNSPKW
FT                   KLLVDKTVNKYFEANLHHPQAYLLLPNRNATTLTEANTTTINQLNLKTQLKQWRAHYHL
FT                   LLQDIRLIQWLYKKEIKQKQQQIKALLKNYGTLNKLLNTQISKVNNVVRKTFFVDSEEC
FT                   DLNRLQASNKLHFNLLNAMVNVISFCLKKCRQNPKKLNRTANLKMLLDNTFKNGIPSWM
FT                   IFSDLNKINTKQRFKLYLLFKLLLHPQLVLVDSFVNFNKHTYNFTRGLLIAHQNQQGIA
FT                   YLFNDPHNNLVKDFFTQTINFETRAKN"
FT   gene            complement(742418..744103)
FT                   /locus_tag="MPNE_0726"
FT   CDS_pept        complement(742418..744103)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0726"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR00649"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86721"
FT                   /db_xref="GOA:A0A0H3DLS4"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLS4"
FT                   /protein_id="ADK86721.1"
FT                   /translation="MAKINFFAFGGQDERGKNCFVLEINNDVFIFNVGSLTPTTAVLGV
FT                   KKIIPDFSWIQENQARIKGIFIGNPVTENIGSLEFLFHTVGFFPIYTSTIGAVVIKTKI
FT                   HENKLNIPHDELEIHELKPLETVKIGHHNITPFKVSSSIPSSFGFALHTDDGYIVYVDD
FT                   FIVLNDKNIAFENQLNQIIPQVANKTLLLITGVGLVGRNTGFTTPKHKSLEQLNRIIAS
FT                   AKGRVFAACYDSNAYSVMTLAQIARMQNRPFVIYSHSFVHLFNAIVRQKLFNNTHLNTI
FT                   SIEEINNSTNAIVVLTAPPDKLYAKLFKIGTNEDERVRYRKTDSFIFMIPRIAGYEELE
FT                   AQILDDVARNEVSYYNLGREILSINASDEDMKFLVTSLKPKYIIPTSGLYRDFINFTMV
FT                   MKQAGVEQSQVLIPFNGEVLAINHKQIDNKKRELKLNPKCVDSAGLQEIGASIMFERDQ
FT                   MSEAGVVTIIIYYDSKKSEFLNEITYSFLGVSLDSNNQVKLKTKMEELIRKQINDIKDF
FT                   TTIKRRLGKDTSKELKVSIKRAVMNLFTKMTAKAPLILSTIISI"
FT   gene            complement(744108..744368)
FT                   /gene="rpsO"
FT                   /locus_tag="MPNE_0727"
FT   CDS_pept        complement(744108..744368)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsO"
FT                   /locus_tag="MPNE_0727"
FT                   /product="ribosomal protein S15"
FT                   /note="identified by match to protein family HMM PF00312;
FT                   match to protein family HMM TIGR00952"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86949"
FT                   /db_xref="GOA:A0A0H3DL33"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL33"
FT                   /protein_id="ADK86949.1"
FT                   /translation="MQIDKNGIIKSAQLHDKDVGSIQVQVSLLTSQIKQLTDHLLANKK
FT                   DFISKRGLYAKVSKRKRLLKYLKHNDLEAYRNLVKTLNLRG"
FT   gene            744526..745878
FT                   /locus_tag="MPNE_0728"
FT   CDS_pept        744526..745878
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0728"
FT                   /product="DEAD/DEAH box helicase"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86977"
FT                   /db_xref="GOA:A0A0H3DP41"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP41"
FT                   /protein_id="ADK86977.1"
FT                   /translation="MDSTFNELGVSPALIATLKDNNINQPTTIQQLAIPQFLQHQNLIV
FT                   HSPTGTGKTAVFAIPVIETLLKKPSKGTTQTLVVAPTRELAEQIKTTFINFAKHTHLKV
FT                   VSLIGGIPIWQQLKQLENQPEIVVGTMGRVMDLLERGVIKFEHLEHLIIDEVDLMLDRG
FT                   FKRKLFDLLGRIEKFEQIAVYSASYNEETIETAKQITKNGIFLAAPELKQNAPEPDNKL
FT                   IDQFVCYLFSNRKKQALYSLVSQTRAKSIIVFCDTKKLVDELCIFLRKNDVKTYPLHGD
FT                   KAQFIRERNLKLFANTTAPIVLVTTDLIGRGIHVEGVDMVVNYSACVNFETYLHRMGRT
FT                   GRNNHKGSCITFCTSHEKQAFLKLLEQVNDKRISPLRPMRLRLIPLKCKTQPKKGKLSL
FT                   QSVQKIYVNPRSNGTFKRVPLAGDLFKSRMRQPERDMQKNKLHDSDWQSNM"
FT   gene            745900..746097
FT                   /gene="rpmB"
FT                   /locus_tag="MPNE_0729"
FT   CDS_pept        745900..746097
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmB"
FT                   /locus_tag="MPNE_0729"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by match to protein family HMM PF00830;
FT                   match to protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86749"
FT                   /db_xref="GOA:A0A0H3DKJ1"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKJ1"
FT                   /protein_id="ADK86749.1"
FT                   /translation="MAKKDQLTLRGPLYGNNRSHSKTITRRKWNVNLQPCKVKTADGKT
FT                   TRILVSTRTLRTLKKHNRLS"
FT   gene            746141..746566
FT                   /locus_tag="MPNE_0730"
FT   CDS_pept        746141..746566
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0730"
FT                   /product="OsmC-like protein"
FT                   /note="identified by match to protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86800"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM10"
FT                   /protein_id="ADK86800.1"
FT                   /translation="MDKKYDITAVLNEDSSMTAISDQFQITLDARPKHTAKGFGPLAAL
FT                   LSGLAACELATANLMAPAKMITINKLLMNVTGSRSTNPTDGYFGLREINLHWEIHSPNS
FT                   ETEIKEFIDFVSKRCPAHNTLQGVSQLKINVNVTLVH"
FT   gene            746797..747219
FT                   /locus_tag="MPNE_0732"
FT   CDS_pept        746797..747219
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0732"
FT                   /product="putative LuxR bacterial regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87004"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DKS7"
FT                   /protein_id="ADK87004.1"
FT                   /translation="MSIALHAEHDSKKRYDPKYGLSFETYLKLNGANFIKSSYRSLMNK
FT                   VDDWIDFKDMKTLEEQNTVSYTPENYLRSVEFREMVHLAFKKAKNEDERQVFALYVKGY
FT                   KNLEIAKKLNLTTRRVRYLISIFKDHIKVLTKRYGY"
FT   gene            complement(747216..748934)
FT                   /gene="ptsP"
FT                   /locus_tag="MPNE_0731"
FT   CDS_pept        complement(747216..748934)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ptsP"
FT                   /locus_tag="MPNE_0731"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="identified by match to protein family HMM PF00391;
FT                   match to protein family HMM PF02896; match to protein
FT                   family HMM PF05524; match to protein family HMM TIGR01417"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87207"
FT                   /db_xref="GOA:A0A0H3DNB4"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNB4"
FT                   /protein_id="ADK87207.1"
FT                   /translation="MKKLSGIGVSDGMALAKAFLVKTPEFAVNKYLKHQLTKAQAKRLL
FT                   DSAFKKAVKDLEEIKEITVNNINTEAGMIFDAHIQILNDPTITEQLEQQLAQNVHPVIA
FT                   VDTVFSQTATMFSQMQDKYFQERAADILDLRQRLLAYLTGQKPHDLVKIKSDVIIVAHD
FT                   LTPSQTATLNKKYVKGFLTEIGGRTSHAAIMARSLEIPAVVGIKGITTKVKDGQIVGVD
FT                   GRKGIAGLDLNSKDTTEWKKQKALEEKYQQELKQYTNKETVTLDGHAVVVAANIGNVKD
FT                   MELACQYNTNGVGLFRTEFLYMNSQEWPDEETQYQAYKAVLEQAHGDLVIIRTLDIGGD
FT                   KKLNYYEFPHEDNPFLGYRALRLTLDKQDIFKTQLRALLRAADHGQLGIMFPMVATLDE
FT                   LLQAKQLLNQVHQELGGNKQFKLGIMIEIPAAVLAANTLSHHVDFFSIGTNDLIQYSFA
FT                   ADRMNKNVSYLYQPLNPALLKLIYLTIEGGKVNDIWTGMCGEMAGEPLAIPLLLGLGLK
FT                   EFSMSASSMFKARMIIAKLNYTECQTLAQKALTLANAKEVEKLVEKFFKKKDIFI"
FT   gene            complement(748939..750465)
FT                   /gene="gpmI"
FT                   /locus_tag="MPNE_0733"
FT   CDS_pept        complement(748939..750465)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gpmI"
FT                   /locus_tag="MPNE_0733"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="identified by match to protein family HMM PF01676;
FT                   match to protein family HMM PF06415; match to protein
FT                   family HMM TIGR01307"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87073"
FT                   /db_xref="GOA:A0A0H3DPE1"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPE1"
FT                   /protein_id="ADK87073.1"
FT                   /translation="MHKKVLLAILDGYGISNKQHGNAVYHAKTPALDSLIKDYPCVMLE
FT                   ASGEAVGLPQGQIGNSEVGHLNIGAGRIVYTGLSLINQNIKTGAFHHNQVLLEAIARAK
FT                   ANNAKLHLIGLFSHGGVHSHMDHLYALIKLAAPQVKMVLHLFGDGRDVAPCTMKSDLEA
FT                   FMVFLKDYHNVIIGTLGGRYYGMDRDQRWDREEIAYNAILGNSKASFTDPVAYVQSAYD
FT                   QKVTDEFLYPAVNGNVDKEQFALKDHDSVIFFNFRPDRARQMSHMLFQTDYYDYTPKAG
FT                   RKHNLFFVTMMNYEGIKPSAVVFPPETIPNTFGEVIAHNKLKQLRIAETEKYAHVTFFF
FT                   DGGVEVDLPNETKCMVPSLKVATYDLAPEMACKGITDQLLNQINQFDLTVLNFANPDMV
FT                   GHTGNYAACVQGLEALDVQIQRIIDFCKANHITLFLTADHGNAEEMIDSNNNPVTKHTV
FT                   NKVPFVCTDTNIDLQQDSASLANIAPTILAYLGLKQPAEMTANSLLISKK"
FT   gene            complement(750458..751192)
FT                   /gene="tpiA"
FT                   /locus_tag="MPNE_0734"
FT   CDS_pept        complement(750458..751192)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tpiA"
FT                   /locus_tag="MPNE_0734"
FT                   /product="triose-phosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="identified by match to protein family HMM PF00121;
FT                   match to protein family HMM TIGR00419"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86901"
FT                   /db_xref="GOA:A0A0H3DMD2"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMD2"
FT                   /protein_id="ADK86901.1"
FT                   /translation="MRTKYLIGNWKTNKDLHQALAFVEQFKQHPAKTKAVLGIAPVHVH
FT                   LTEVNKVLPNNLLLLAQDANFIASGSYTGTVSYTQLQDIKVNSVIIGHSERRKYFNETA
FT                   QVINQKLKACLQAGMLVVLCIGETEGQPISFLKEDLTQVLQGIDLSLLKQLVIAYEPIW
FT                   AIGTGKTATPEIANNTIAQIRVYLSELYNKEIAQQTSILYGGSVAKDNIKELAQTEQID
FT                   GFLVGKASLDVNDFLVMAQVYA"
FT   gene            complement(751245..752459)
FT                   /locus_tag="MPNE_0735"
FT   CDS_pept        complement(751245..752459)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0735"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02588"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86850"
FT                   /db_xref="GOA:A0A0H3DM54"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM54"
FT                   /protein_id="ADK86850.1"
FT                   /translation="MQDKNVKIQGNLVRVHLSGSFLKFQAIYKVKKLYLQLLILSVIAF
FT                   FWGLLGVVFVQFSGLYDIGIASISQGLARLANYLIRSNKVSVDADTIYNVIFWLSQILI
FT                   NIPLFVLGWYKISKKFTLLTLYFVVVSNVFGFAFSYIPGVENFFLFANLTELTKANGGL
FT                   EQAINNQGVQLIFWEQTAEKQISLMFYALIWGFLQAVFYSVILIIDASSGGLDFLAFWY
FT                   SEKKHKDIGGILFIVNTLSFLIGYTIGTYLTGSLLAQGFQGDRQKPFGVAFFLSPNLVF
FT                   TIFMNIILGIFTSYFFPKYQFVKVEVYGKHMEQMRNYLLSSNQSFAVTMFEVEGGYSRQ
FT                   KNQVLVTNCLFTKTAELLEAVRRVDPDALFSITFIKKLDGYIYERKAPDKVVPPVKDPV
FT                   KAQEN"
FT   gene            752546..753442
FT                   /gene="tsf"
FT                   /locus_tag="MPNE_0736"
FT   CDS_pept        752546..753442
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tsf"
FT                   /locus_tag="MPNE_0736"
FT                   /product="translation elongation factor Ts"
FT                   /note="identified by match to protein family HMM PF00627;
FT                   match to protein family HMM PF00889; match to protein
FT                   family HMM TIGR00116"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86760"
FT                   /db_xref="GOA:A0A0H3DLX4"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLX4"
FT                   /protein_id="ADK86760.1"
FT                   /translation="MATKIELIKELRKTTQASMMDCKKALEQNNDDLEKAIKWLRENGI
FT                   VKSAKKLGKVAADGCIVLHSDHHKAVMVEINSQTDFVARSQELTDFAQLMISEVFKKAT
FT                   PTTTIEEVTQYELQGKEKVAERLALVASKTDEKIVLRRLMVFESKTNHIFSYLHANKRI
FT                   GVILEVEGKFDEQDGKHLAMHIAANSPQFIDQDNVDQTWLANETSIIKSQAKLEVQDNP
FT                   KKAAFLDKTIAGRVNKLLIDICLVNQKYLVDESKTVGQFLKEKNSKVIHFVRFEVGEGI
FT                   VKEAVDFASEVSAQMKK"
FT   gene            753444..754151
FT                   /gene="pyrH"
FT                   /locus_tag="MPNE_0737"
FT   CDS_pept        753444..754151
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pyrH"
FT                   /locus_tag="MPNE_0737"
FT                   /product="UMP kinase"
FT                   /EC_number="2.7.4.22"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR02075"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86931"
FT                   /db_xref="GOA:A0A0H3DMG5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DMG5"
FT                   /protein_id="ADK86931.1"
FT                   /translation="MRLKILIKLSGAGMSADSSEPFSNQFLETVIAQLKQLVPNYQIGI
FT                   VIGGGNIMRGKSCSDYNITEIAGHHLGIMATVINGAFLKAKFDSHKLNSTLLSAVSCPS
FT                   LATHIVSQATIDDAFKNHDIVIFAGGTGNPYFSTDTAVALRATQMQADIILIGKNGVDG
FT                   VYTADPKKDKHAKFLASLTYAEAIKNDLQIMDITAFTMCKENNLKVIIFNINAEHAIIK
FT                   ALSKQGKYTLIEK"
FT   gene            754254..755624
FT                   /locus_tag="MPNE_0738"
FT   CDS_pept        754254..755624
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0738"
FT                   /product="putative D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87282"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNJ9"
FT                   /protein_id="ADK87282.1"
FT                   /translation="MRYLDLNIKSILADWEIADAIRELIANAIDEHRLSNTAFPVIELQ
FT                   KGFLNSSLVIKDYGRGIKSNHFIQNESREKVQSEKTIGKFGIGLKDAIAVLFRHNVKVS
FT                   FTSSEGTFTPVERMKEGMKDGTKTIQITVDETKKIDKGTDILISKISRSDYEKAIAIFL
FT                   ELRTGYQKLASSKKGDIYRSENGSEIFLNGMKIGTDENFLFSYDIKEPNKKLQKSLNRE
FT                   RKTLSRDSYRDNIISILKSSINKNTQTLINQLIDNRDQFETGEWSFIDVKKLVMQNTNR
FT                   KILWTSNESSDIAAPAYQTWAQEEGYEIISIGSSQYQSMENDAEFKSYTLNDFGDRFVN
FT                   EFQTEEVPFHKLTEIEKDNWNWVMAKVKELTRVWSNWKNLYKHYEFSIIKKHPNAEGLH
FT                   SNGRIQIVRKILNERSHLFNTIMHEICHATSFSPDVSKRFEQGLTSAFYPVMKLKPE"
FT   gene            756096..756695
FT                   /pseudo
FT                   /locus_tag="MPNE_0739"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            756705..757238
FT                   /locus_tag="MPNE_0740"
FT   CDS_pept        756705..757238
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86912"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNX5"
FT                   /protein_id="ADK86912.1"
FT                   /translation="MDTKKYEILALNSLQYRSMENDDRLKKQTLMHVSEKLKQQRIEEE
FT                   AEKIKVKEQKPRKRFEEEDLPIEDLNPIEREGWDWAMEKARELCGFIRGWEKLYEEYQF
FT                   VLMEKNHKYVGLCYTDQKIIKLSREILKDEYSLLNTLVHEICHATTNGRDGTKKFERGL
FT                   TDAFHPLFKLGQSK"
FT   gene            757312..757869
FT                   /gene="frr"
FT                   /locus_tag="MPNE_0741"
FT   CDS_pept        757312..757869
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="frr"
FT                   /locus_tag="MPNE_0741"
FT                   /product="ribosome recycling factor"
FT                   /note="identified by match to protein family HMM PF01765;
FT                   match to protein family HMM TIGR00496"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86825"
FT                   /db_xref="GOA:A0A0H3DM30"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DM30"
FT                   /protein_id="ADK86825.1"
FT                   /translation="MMSPEKYLNFFKETADKKFQWLKEELSKIRTGRPNPKLFDNILVE
FT                   SYGDRMPMVALAQIAVNPPREIVIKPFDVKNNINAIYSEIQRANLGVQPVIDGDKIRIN
FT                   FPPMTQESRLESIKQAKKVVEQIHQELRSVRRDTLQMIKKDDHKDEDFEEFLKEEVEKV
FT                   NKQYIAQLETIQKQKEKELLVV"
FT   gene            757869..759056
FT                   /gene="cdsA"
FT                   /locus_tag="MPNE_0742"
FT   CDS_pept        757869..759056
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="cdsA"
FT                   /locus_tag="MPNE_0742"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="identified by match to protein family HMM PF01148"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87120"
FT                   /db_xref="GOA:A0A0H3DL60"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="InterPro:IPR016720"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DL60"
FT                   /protein_id="ADK87120.1"
FT                   /translation="MDLKDNSFAKKRSTVFVVLLIVFCFFLMFSAFADGFNFWSPWSTD
FT                   FNSRVIHIKSDGNIETTSIVSHELHPDFKAVRFAFGLVIVLFISVIAVLMNWELSNSIF
FT                   KNYEKLNLSLSLLSGIMVSGGMIPTFFVIYFREWNATVNWIWTASLAGMIVFLWAVYMI
FT                   STSFIKIRPSLQVIYSLGAVICFIACIGTIYFSVIRGWTTIFLLIAIGVCTDTFAYLFG
FT                   KRFGKNPLIKISPSKTWEGAFFGVTGTVLTISIICVLYSIPNYVRQPSIKDASKTALQT
FT                   PQNYDVHNLITNVFLISFISGGSTFYIYWWVSTLALIFTASIFAIGGDLFFSYIKRLTK
FT                   IKDFSKLLGKHGGILDRFDSSSFLISFFFIYHVIAGISSNQRLLMEPNTYFSAVS"
FT   gene            759076..760203
FT                   /locus_tag="MPNE_0744"
FT   CDS_pept        759076..760203
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0744"
FT                   /product="type I restriction modification DNA specificity
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87208"
FT                   /db_xref="GOA:A0A0H3DND6"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DND6"
FT                   /protein_id="ADK87208.1"
FT                   /translation="MTPKLKLNTNSNWTKKTLGSLFELKKGEMLEKELLAPDGKYEYFN
FT                   GGIKASGRTNEFNTFKNTISIIIGGSCGYVRLADKDYFCGQSSCTLTVLDPLEIDLKFA
FT                   YYALKSQEEKITSLASGTTIKNIRLSDLKDLPIPLVKSIQDQRTIAHALSVFDLRIEHL
FT                   NELIEVNRKLRDEYAHKLFTLDPDFLTHWNLHELHEQMGEISLGEVFHLKSGKYLKADE
FT                   RFEDGKFPYYGAGIESTSFVNEPNTKGDTLSMIANGYSIGNIRYHTIPWFNGTGGIAME
FT                   ALKPNETYVPFFYCALKYMQKDLKERFKRDESPFISLKLAGEIKVPFVKSFALQRKAGK
FT                   IIYLLDKTLEEYKEEAKSLISIRDNLLGKLFPTLS"
FT   gene            complement(760200..761051)
FT                   /locus_tag="MPNE_0743"
FT   CDS_pept        complement(760200..761051)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0743"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00938"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87045"
FT                   /db_xref="InterPro:IPR001595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLC1"
FT                   /protein_id="ADK87045.1"
FT                   /translation="MALKLRKWIWASIPSLALILSSCSALVASVELKSLSELQNLADRN
FT                   TELTKNKRTLITTLRESYGLNPKGTLNLLFEGWRYTLLSQRILERWQTEVGRFAKSFGN
FT                   GSNQNSVQPNATLKGLKLSERSTTEIQLLAEQAITVSKQEVKEFTYKVESNKQFEATVK
FT                   IKADLKIDPTKAMSHIENIFKDDETKKKDAQNSLTMSMGQNEALEATFTYSPATQGIFG
FT                   RASFDRFTSNIKLNTKLRIQVSSTSDLMKKLLENSLTSSLKDQSFDNEGVNLFPYTLFA
FT                   LL"
FT   gene            complement(761120..761974)
FT                   /locus_tag="MPNE_0745"
FT   CDS_pept        complement(761120..761974)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0745"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00938"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87070"
FT                   /db_xref="InterPro:IPR001595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DLE5"
FT                   /protein_id="ADK87070.1"
FT                   /translation="MKLKLLLIPLLGSSLLLSACSSATSQVISSLSSAQKYFEANKGEL
FT                   NKKNVINILKDGYNSDPNKTVNALLAGWKYTLMDQKLLERNLDASRFASAFGSTSKKDD
FT                   ITPNISEKSLFLADTFPGISSEIAKVFKVEKQTVSGFSYSWNSPKKFQVNIQIKMDGKI
FT                   DESSKALIKSFLEGNSSGGKGSNGKNSIDESEYTGEKAKFTGNFIFTYTPPTGGARNFS
FT                   DKSFDVPTSSINFPANVKIDVTTSHTKLNELLESNEQVKKMKSRQLTGKLFNLLPFFYY
FT                   ALL"
FT   gene            complement(761974..762102)
FT                   /pseudo
FT                   /locus_tag="MPNE_0746"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(762141..762755)
FT                   /pseudo
FT                   /locus_tag="MPNE_0747"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00938"
FT   gene            complement(762806..763645)
FT                   /locus_tag="MPNE_0748"
FT   CDS_pept        complement(762806..763645)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0748"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00938"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87089"
FT                   /db_xref="InterPro:IPR001595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DPH0"
FT                   /protein_id="ADK87089.1"
FT                   /translation="MKLKLYLIPLLASGIILSACSSTTSQVISSLSSAQKYFEANKGEL
FT                   NKNNVINILKDGYNSDPNKTVNALLAGWKYTLMDQKLLENNLDPSRFKNTFGPNKNKDD
FT                   VTPNISEKGLFLNETFTGLGSQIAEVFNVQKQIVSGFSYSWTSPKSFKVNIHIKMEGMI
FT                   NEKSKETIKSFLSNKDSNGSNSVEESEYTGDKAKFTADFIFSYTPPTGGTRSLTDKSFD
FT                   VITNMINFPADVKIDVNTSHNKLNELLEKNDQVKRMKSRTFNGRNIDLLPFFYYALL"
FT   gene            complement(763645..764424)
FT                   /locus_tag="MPNE_0749"
FT   CDS_pept        complement(763645..764424)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0749"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00938"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86997"
FT                   /db_xref="InterPro:IPR001595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DP62"
FT                   /protein_id="ADK86997.1"
FT                   /translation="MLFGTALTACSNSGFEANLTSLNQLRTSASKNTNLTQNKADLVTA
FT                   LKSAFENNPEGTTRVLLDAWKFTLLDAQILEKQDFSKFSKSFGSGRSIEDVEPSAGVRG
FT                   LRLVERYTQDTANIINNVIKLDKQKVEAFSIQYKDPKNFRVQVKINAKGNYKKDTVKTY
FT                   LSQVGLSDGDLNDTGTLEAEIIYTYMPPAASFFSASKFDKLTRAINFNTNLRIQIIGKD
FT                   SVMTKLLQQSSFVKQLADQKFQDQSINLLPYVLYSIL"
FT   gene            complement(764474..765274)
FT                   /locus_tag="MPNE_0750"
FT   CDS_pept        complement(764474..765274)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0750"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00938"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ADK86887"
FT                   /db_xref="InterPro:IPR001595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DNV1"
FT                   /protein_id="ADK86887.1"
FT                   /translation="MFGTALSACSSTATNVISSLSSAQKYFDAHKSELIKKNVINLLKE
FT                   GYSTDSKATVNSLFAGWKYTLMDQKILERNLDASRFTKAFGTNKGKDDVIPSISEKGLF
FT                   LDETYSGVSQQIVKVLGVQSQKVTGFSYSWSSTTNFKVVISFMMQGIVGSGEESNSLIK
FT                   SFLSSGNNGNVTENDFNNGNANFDGTFIFTFTPPTDGRRFAFSNFDPITGTINFPANLQ
FT                   IDASTTHEKLNILMQNNEHVKKIKSRSFTGKSFDLLPFYFYALL"
FT   gene            complement(765328..766179)
FT                   /locus_tag="MPNE_0751"
FT   CDS_pept        complement(765328..766179)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MPNE_0751"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00938"
FT                   /db_xref="EnsemblGenomes-Gn:MPNE_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ADK87147"
FT                   /db_xref="InterPro:IPR001595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DN46"
FT                   /protein_id="ADK87147.1"
FT                   /translation="MKLKLKFLLIPLLGSSLLLSACSSAATQVISSLSSAQKYFESSQG
FT                   ELNKKNVIKILKEGYESDANKAVHALLAGWKYTLMDQQLLSKEVDSRFIKAFGSGRDKG
FT                   DVTPSVSEKGLYLNETYTGFSIQIAKVLGVQSQTVKQFNYKWSSNSDFKVQIQISMKGK
FT                   VGSDSESQQLIKSFLSSDNNGSNQNGGVKETDFNGDSANFDGFFTFTYTPPTQSRKFGA
FT                   TSFDPLTTKINFPADLQIDVSTTHQKLNTLMEANEQVKQIKSRKFTGKTFDLLPFFYYA
FT                   LL"
FT   gene            complement(766179..767012)
FT                   /locus_tag="MPNE_0752"
FT   CDS_pept