(data stored in SCRATCH zone)

EMBL: CP002080

ID   CP002080; SV 1; circular; genomic DNA; STD; PRO; 4152543 BP.
AC   CP002080;
PR   Project:PRJNA46105;
DT   23-JUN-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
DE   Acinetobacter oleivorans DR1, complete genome.
KW   .
OS   Acinetobacter oleivorans DR1
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Moraxellaceae; Acinetobacter.
RN   [1]
RP   1-4152543
RX   DOI; 10.1128/JB.00722-10.
RX   PUBMED; 20639327.
RA   Jung J., Baek J.H., Park W.;
RT   "Complete genome sequence of the diesel-degrading Acinetobacter sp. strain
RT   DR1";
RL   J. Bacteriol. 192(18):4794-4795(2010).
RN   [2]
RP   1-4152543
RA   Jung J., Park W.;
RT   ;
RL   Submitted (13-APR-2010) to the INSDC.
RL   Division of Environmental Science and Ecological Engineering, Korea
RL   University, Anam-Dong 5Ga, Seungbuk-Ku, Seoul 136-713, South Korea
DR   MD5; 4052fe9210867827fa99977e7bfb5211.
DR   BioSample; SAMN02603211.
DR   EnsemblGenomes-Gn; AOLE_r19624.
DR   EnsemblGenomes-Gn; AOLE_r19626.
DR   EnsemblGenomes-Gn; AOLE_r19628.
DR   EnsemblGenomes-Gn; AOLE_r19630.
DR   EnsemblGenomes-Gn; AOLE_r19632.
DR   EnsemblGenomes-Gn; AOLE_r19634.
DR   EnsemblGenomes-Gn; AOLE_r19636.
DR   EnsemblGenomes-Gn; AOLE_r19638.
DR   EnsemblGenomes-Gn; AOLE_r19640.
DR   EnsemblGenomes-Gn; AOLE_r19642.
DR   EnsemblGenomes-Gn; AOLE_r19644.
DR   EnsemblGenomes-Gn; AOLE_r19646.
DR   EnsemblGenomes-Gn; AOLE_r19648.
DR   EnsemblGenomes-Gn; AOLE_r19650.
DR   EnsemblGenomes-Gn; AOLE_r19652.
DR   EnsemblGenomes-Gn; AOLE_r19654.
DR   EnsemblGenomes-Gn; AOLE_r19656.
DR   EnsemblGenomes-Gn; AOLE_r19658.
DR   EnsemblGenomes-Gn; AOLE_t19482.
DR   EnsemblGenomes-Gn; AOLE_t19484.
DR   EnsemblGenomes-Gn; AOLE_t19486.
DR   EnsemblGenomes-Gn; AOLE_t19488.
DR   EnsemblGenomes-Gn; AOLE_t19490.
DR   EnsemblGenomes-Gn; AOLE_t19492.
DR   EnsemblGenomes-Gn; AOLE_t19494.
DR   EnsemblGenomes-Gn; AOLE_t19496.
DR   EnsemblGenomes-Gn; AOLE_t19498.
DR   EnsemblGenomes-Gn; AOLE_t19500.
DR   EnsemblGenomes-Gn; AOLE_t19502.
DR   EnsemblGenomes-Gn; AOLE_t19504.
DR   EnsemblGenomes-Gn; AOLE_t19506.
DR   EnsemblGenomes-Gn; AOLE_t19508.
DR   EnsemblGenomes-Gn; AOLE_t19510.
DR   EnsemblGenomes-Gn; AOLE_t19512.
DR   EnsemblGenomes-Gn; AOLE_t19514.
DR   EnsemblGenomes-Gn; AOLE_t19516.
DR   EnsemblGenomes-Gn; AOLE_t19518.
DR   EnsemblGenomes-Gn; AOLE_t19520.
DR   EnsemblGenomes-Gn; AOLE_t19522.
DR   EnsemblGenomes-Gn; AOLE_t19524.
DR   EnsemblGenomes-Gn; AOLE_t19526.
DR   EnsemblGenomes-Gn; AOLE_t19528.
DR   EnsemblGenomes-Gn; AOLE_t19530.
DR   EnsemblGenomes-Gn; AOLE_t19532.
DR   EnsemblGenomes-Gn; AOLE_t19534.
DR   EnsemblGenomes-Gn; AOLE_t19536.
DR   EnsemblGenomes-Gn; AOLE_t19538.
DR   EnsemblGenomes-Gn; AOLE_t19540.
DR   EnsemblGenomes-Gn; AOLE_t19542.
DR   EnsemblGenomes-Gn; AOLE_t19544.
DR   EnsemblGenomes-Gn; AOLE_t19546.
DR   EnsemblGenomes-Gn; AOLE_t19548.
DR   EnsemblGenomes-Gn; AOLE_t19550.
DR   EnsemblGenomes-Gn; AOLE_t19552.
DR   EnsemblGenomes-Gn; AOLE_t19554.
DR   EnsemblGenomes-Gn; AOLE_t19556.
DR   EnsemblGenomes-Gn; AOLE_t19558.
DR   EnsemblGenomes-Gn; AOLE_t19560.
DR   EnsemblGenomes-Gn; AOLE_t19562.
DR   EnsemblGenomes-Gn; AOLE_t19564.
DR   EnsemblGenomes-Gn; AOLE_t19566.
DR   EnsemblGenomes-Gn; AOLE_t19568.
DR   EnsemblGenomes-Gn; AOLE_t19570.
DR   EnsemblGenomes-Gn; AOLE_t19572.
DR   EnsemblGenomes-Gn; AOLE_t19574.
DR   EnsemblGenomes-Gn; AOLE_t19576.
DR   EnsemblGenomes-Gn; AOLE_t19578.
DR   EnsemblGenomes-Gn; AOLE_t19580.
DR   EnsemblGenomes-Gn; AOLE_t19582.
DR   EnsemblGenomes-Gn; AOLE_t19584.
DR   EnsemblGenomes-Gn; AOLE_t19586.
DR   EnsemblGenomes-Gn; AOLE_t19588.
DR   EnsemblGenomes-Gn; AOLE_t19590.
DR   EnsemblGenomes-Gn; AOLE_t19592.
DR   EnsemblGenomes-Gn; AOLE_t19594.
DR   EnsemblGenomes-Gn; AOLE_t19596.
DR   EnsemblGenomes-Gn; AOLE_t19598.
DR   EnsemblGenomes-Gn; AOLE_t19600.
DR   EnsemblGenomes-Gn; AOLE_t19602.
DR   EnsemblGenomes-Gn; AOLE_t19604.
DR   EnsemblGenomes-Gn; AOLE_t19606.
DR   EnsemblGenomes-Gn; AOLE_t19608.
DR   EnsemblGenomes-Gn; AOLE_t19610.
DR   EnsemblGenomes-Gn; AOLE_t19612.
DR   EnsemblGenomes-Gn; AOLE_t19614.
DR   EnsemblGenomes-Gn; AOLE_t19616.
DR   EnsemblGenomes-Gn; AOLE_t19618.
DR   EnsemblGenomes-Gn; AOLE_t19620.
DR   EnsemblGenomes-Gn; AOLE_t19622.
DR   EnsemblGenomes-Gn; EBG00001012857.
DR   EnsemblGenomes-Gn; EBG00001012858.
DR   EnsemblGenomes-Gn; EBG00001012859.
DR   EnsemblGenomes-Gn; EBG00001012860.
DR   EnsemblGenomes-Gn; EBG00001012861.
DR   EnsemblGenomes-Gn; EBG00001012862.
DR   EnsemblGenomes-Gn; EBG00001012863.
DR   EnsemblGenomes-Gn; EBG00001012864.
DR   EnsemblGenomes-Gn; EBG00001012865.
DR   EnsemblGenomes-Gn; EBG00001012866.
DR   EnsemblGenomes-Gn; EBG00001012867.
DR   EnsemblGenomes-Gn; EBG00001012868.
DR   EnsemblGenomes-Gn; EBG00001012869.
DR   EnsemblGenomes-Gn; EBG00001012870.
DR   EnsemblGenomes-Gn; EBG00001012871.
DR   EnsemblGenomes-Gn; EBG00001012872.
DR   EnsemblGenomes-Gn; EBG00001012873.
DR   EnsemblGenomes-Gn; EBG00001012874.
DR   EnsemblGenomes-Gn; EBG00001012875.
DR   EnsemblGenomes-Gn; EBG00001012876.
DR   EnsemblGenomes-Gn; EBG00001012877.
DR   EnsemblGenomes-Gn; EBG00001012878.
DR   EnsemblGenomes-Gn; EBG00001012879.
DR   EnsemblGenomes-Gn; EBG00001012880.
DR   EnsemblGenomes-Gn; EBG00001012881.
DR   EnsemblGenomes-Gn; EBG00001012882.
DR   EnsemblGenomes-Gn; EBG00001012883.
DR   EnsemblGenomes-Gn; EBG00001012884.
DR   EnsemblGenomes-Gn; EBG00001012885.
DR   EnsemblGenomes-Gn; EBG00001012886.
DR   EnsemblGenomes-Gn; EBG00001012887.
DR   EnsemblGenomes-Gn; EBG00001012888.
DR   EnsemblGenomes-Gn; EBG00001012889.
DR   EnsemblGenomes-Gn; EBG00001012890.
DR   EnsemblGenomes-Gn; EBG00001012891.
DR   EnsemblGenomes-Gn; EBG00001012892.
DR   EnsemblGenomes-Gn; EBG00001012893.
DR   EnsemblGenomes-Gn; EBG00001012894.
DR   EnsemblGenomes-Gn; EBG00001012895.
DR   EnsemblGenomes-Gn; EBG00001012896.
DR   EnsemblGenomes-Gn; EBG00001012897.
DR   EnsemblGenomes-Gn; EBG00001012898.
DR   EnsemblGenomes-Gn; EBG00001012899.
DR   EnsemblGenomes-Gn; EBG00001012900.
DR   EnsemblGenomes-Gn; EBG00001012901.
DR   EnsemblGenomes-Gn; EBG00001012902.
DR   EnsemblGenomes-Gn; EBG00001012903.
DR   EnsemblGenomes-Gn; EBG00001012904.
DR   EnsemblGenomes-Gn; EBG00001012905.
DR   EnsemblGenomes-Gn; EBG00001012906.
DR   EnsemblGenomes-Gn; EBG00001012907.
DR   EnsemblGenomes-Gn; EBG00001012908.
DR   EnsemblGenomes-Gn; EBG00001012909.
DR   EnsemblGenomes-Gn; EBG00001012910.
DR   EnsemblGenomes-Gn; EBG00001012911.
DR   EnsemblGenomes-Gn; EBG00001012912.
DR   EnsemblGenomes-Gn; EBG00001012913.
DR   EnsemblGenomes-Gn; EBG00001012914.
DR   EnsemblGenomes-Gn; EBG00001012915.
DR   EnsemblGenomes-Gn; EBG00001012916.
DR   EnsemblGenomes-Gn; EBG00001012917.
DR   EnsemblGenomes-Gn; EBG00001012918.
DR   EnsemblGenomes-Gn; EBG00001012919.
DR   EnsemblGenomes-Gn; EBG00001012920.
DR   EnsemblGenomes-Gn; EBG00001012921.
DR   EnsemblGenomes-Gn; EBG00001012922.
DR   EnsemblGenomes-Gn; EBG00001012923.
DR   EnsemblGenomes-Gn; EBG00001012924.
DR   EnsemblGenomes-Gn; EBG00001012925.
DR   EnsemblGenomes-Gn; EBG00001012926.
DR   EnsemblGenomes-Gn; EBG00001012927.
DR   EnsemblGenomes-Gn; EBG00001012928.
DR   EnsemblGenomes-Gn; EBG00001012929.
DR   EnsemblGenomes-Gn; EBG00001012930.
DR   EnsemblGenomes-Gn; EBG00001012931.
DR   EnsemblGenomes-Gn; EBG00001012932.
DR   EnsemblGenomes-Gn; EBG00001012933.
DR   EnsemblGenomes-Gn; EBG00001012934.
DR   EnsemblGenomes-Gn; EBG00001012935.
DR   EnsemblGenomes-Gn; EBG00001012936.
DR   EnsemblGenomes-Gn; EBG00001012937.
DR   EnsemblGenomes-Gn; EBG00001012938.
DR   EnsemblGenomes-Gn; EBG00001012939.
DR   EnsemblGenomes-Gn; EBG00001012940.
DR   EnsemblGenomes-Gn; EBG00001012941.
DR   EnsemblGenomes-Gn; EBG00001012942.
DR   EnsemblGenomes-Gn; EBG00001012943.
DR   EnsemblGenomes-Gn; EBG00001012944.
DR   EnsemblGenomes-Gn; EBG00001012945.
DR   EnsemblGenomes-Gn; EBG00001012946.
DR   EnsemblGenomes-Gn; EBG00001012947.
DR   EnsemblGenomes-Gn; EBG00001012948.
DR   EnsemblGenomes-Gn; EBG00001012949.
DR   EnsemblGenomes-Gn; EBG00001012950.
DR   EnsemblGenomes-Gn; EBG00001012951.
DR   EnsemblGenomes-Gn; EBG00001012952.
DR   EnsemblGenomes-Gn; EBG00001012953.
DR   EnsemblGenomes-Gn; EBG00001012954.
DR   EnsemblGenomes-Gn; EBG00001012955.
DR   EnsemblGenomes-Gn; EBG00001012956.
DR   EnsemblGenomes-Gn; EBG00001012957.
DR   EnsemblGenomes-Gn; EBG00001012958.
DR   EnsemblGenomes-Gn; EBG00001012959.
DR   EnsemblGenomes-Gn; EBG00001012960.
DR   EnsemblGenomes-Gn; EBG00001012961.
DR   EnsemblGenomes-Gn; EBG00001012962.
DR   EnsemblGenomes-Gn; EBG00001012963.
DR   EnsemblGenomes-Gn; EBG00001012964.
DR   EnsemblGenomes-Gn; EBG00001012965.
DR   EnsemblGenomes-Gn; EBG00001012966.
DR   EnsemblGenomes-Gn; EBG00001012967.
DR   EnsemblGenomes-Gn; EBG00001012968.
DR   EnsemblGenomes-Gn; EBG00001012969.
DR   EnsemblGenomes-Gn; EBG00001012970.
DR   EnsemblGenomes-Gn; EBG00001012971.
DR   EnsemblGenomes-Gn; EBG00001012972.
DR   EnsemblGenomes-Gn; EBG00001012973.
DR   EnsemblGenomes-Gn; EBG00001012974.
DR   EnsemblGenomes-Gn; EBG00001012975.
DR   EnsemblGenomes-Gn; EBG00001012976.
DR   EnsemblGenomes-Gn; EBG00001012977.
DR   EnsemblGenomes-Gn; EBG00001012978.
DR   EnsemblGenomes-Gn; EBG00001012979.
DR   EnsemblGenomes-Gn; EBG00001012980.
DR   EnsemblGenomes-Gn; EBG00001012981.
DR   EnsemblGenomes-Gn; EBG00001012982.
DR   EnsemblGenomes-Gn; EBG00001012983.
DR   EnsemblGenomes-Gn; EBG00001012984.
DR   EnsemblGenomes-Gn; EBG00001012985.
DR   EnsemblGenomes-Gn; EBG00001012986.
DR   EnsemblGenomes-Gn; EBG00001012987.
DR   EnsemblGenomes-Gn; EBG00001012988.
DR   EnsemblGenomes-Gn; EBG00001012989.
DR   EnsemblGenomes-Gn; EBG00001012990.
DR   EnsemblGenomes-Gn; EBG00001012991.
DR   EnsemblGenomes-Gn; EBG00001012992.
DR   EnsemblGenomes-Tr; AOLE_r19624-1.
DR   EnsemblGenomes-Tr; AOLE_r19626-1.
DR   EnsemblGenomes-Tr; AOLE_r19628-1.
DR   EnsemblGenomes-Tr; AOLE_r19630-1.
DR   EnsemblGenomes-Tr; AOLE_r19632-1.
DR   EnsemblGenomes-Tr; AOLE_r19634-1.
DR   EnsemblGenomes-Tr; AOLE_r19636-1.
DR   EnsemblGenomes-Tr; AOLE_r19638-1.
DR   EnsemblGenomes-Tr; AOLE_r19640-1.
DR   EnsemblGenomes-Tr; AOLE_r19642-1.
DR   EnsemblGenomes-Tr; AOLE_r19644-1.
DR   EnsemblGenomes-Tr; AOLE_r19646-1.
DR   EnsemblGenomes-Tr; AOLE_r19648-1.
DR   EnsemblGenomes-Tr; AOLE_r19650-1.
DR   EnsemblGenomes-Tr; AOLE_r19652-1.
DR   EnsemblGenomes-Tr; AOLE_r19654-1.
DR   EnsemblGenomes-Tr; AOLE_r19656-1.
DR   EnsemblGenomes-Tr; AOLE_r19658-1.
DR   EnsemblGenomes-Tr; AOLE_t19482-1.
DR   EnsemblGenomes-Tr; AOLE_t19484-1.
DR   EnsemblGenomes-Tr; AOLE_t19486-1.
DR   EnsemblGenomes-Tr; AOLE_t19488-1.
DR   EnsemblGenomes-Tr; AOLE_t19490-1.
DR   EnsemblGenomes-Tr; AOLE_t19492-1.
DR   EnsemblGenomes-Tr; AOLE_t19494-1.
DR   EnsemblGenomes-Tr; AOLE_t19496-1.
DR   EnsemblGenomes-Tr; AOLE_t19498-1.
DR   EnsemblGenomes-Tr; AOLE_t19500-1.
DR   EnsemblGenomes-Tr; AOLE_t19502-1.
DR   EnsemblGenomes-Tr; AOLE_t19504-1.
DR   EnsemblGenomes-Tr; AOLE_t19506-1.
DR   EnsemblGenomes-Tr; AOLE_t19508-1.
DR   EnsemblGenomes-Tr; AOLE_t19510-1.
DR   EnsemblGenomes-Tr; AOLE_t19512-1.
DR   EnsemblGenomes-Tr; AOLE_t19514-1.
DR   EnsemblGenomes-Tr; AOLE_t19516-1.
DR   EnsemblGenomes-Tr; AOLE_t19518-1.
DR   EnsemblGenomes-Tr; AOLE_t19520-1.
DR   EnsemblGenomes-Tr; AOLE_t19522-1.
DR   EnsemblGenomes-Tr; AOLE_t19524-1.
DR   EnsemblGenomes-Tr; AOLE_t19526-1.
DR   EnsemblGenomes-Tr; AOLE_t19528-1.
DR   EnsemblGenomes-Tr; AOLE_t19530-1.
DR   EnsemblGenomes-Tr; AOLE_t19532-1.
DR   EnsemblGenomes-Tr; AOLE_t19534-1.
DR   EnsemblGenomes-Tr; AOLE_t19536-1.
DR   EnsemblGenomes-Tr; AOLE_t19538-1.
DR   EnsemblGenomes-Tr; AOLE_t19540-1.
DR   EnsemblGenomes-Tr; AOLE_t19542-1.
DR   EnsemblGenomes-Tr; AOLE_t19544-1.
DR   EnsemblGenomes-Tr; AOLE_t19546-1.
DR   EnsemblGenomes-Tr; AOLE_t19548-1.
DR   EnsemblGenomes-Tr; AOLE_t19550-1.
DR   EnsemblGenomes-Tr; AOLE_t19552-1.
DR   EnsemblGenomes-Tr; AOLE_t19554-1.
DR   EnsemblGenomes-Tr; AOLE_t19556-1.
DR   EnsemblGenomes-Tr; AOLE_t19558-1.
DR   EnsemblGenomes-Tr; AOLE_t19560-1.
DR   EnsemblGenomes-Tr; AOLE_t19562-1.
DR   EnsemblGenomes-Tr; AOLE_t19564-1.
DR   EnsemblGenomes-Tr; AOLE_t19566-1.
DR   EnsemblGenomes-Tr; AOLE_t19568-1.
DR   EnsemblGenomes-Tr; AOLE_t19570-1.
DR   EnsemblGenomes-Tr; AOLE_t19572-1.
DR   EnsemblGenomes-Tr; AOLE_t19574-1.
DR   EnsemblGenomes-Tr; AOLE_t19576-1.
DR   EnsemblGenomes-Tr; AOLE_t19578-1.
DR   EnsemblGenomes-Tr; AOLE_t19580-1.
DR   EnsemblGenomes-Tr; AOLE_t19582-1.
DR   EnsemblGenomes-Tr; AOLE_t19584-1.
DR   EnsemblGenomes-Tr; AOLE_t19586-1.
DR   EnsemblGenomes-Tr; AOLE_t19588-1.
DR   EnsemblGenomes-Tr; AOLE_t19590-1.
DR   EnsemblGenomes-Tr; AOLE_t19592-1.
DR   EnsemblGenomes-Tr; AOLE_t19594-1.
DR   EnsemblGenomes-Tr; AOLE_t19596-1.
DR   EnsemblGenomes-Tr; AOLE_t19598-1.
DR   EnsemblGenomes-Tr; AOLE_t19600-1.
DR   EnsemblGenomes-Tr; AOLE_t19602-1.
DR   EnsemblGenomes-Tr; AOLE_t19604-1.
DR   EnsemblGenomes-Tr; AOLE_t19606-1.
DR   EnsemblGenomes-Tr; AOLE_t19608-1.
DR   EnsemblGenomes-Tr; AOLE_t19610-1.
DR   EnsemblGenomes-Tr; AOLE_t19612-1.
DR   EnsemblGenomes-Tr; AOLE_t19614-1.
DR   EnsemblGenomes-Tr; AOLE_t19616-1.
DR   EnsemblGenomes-Tr; AOLE_t19618-1.
DR   EnsemblGenomes-Tr; AOLE_t19620-1.
DR   EnsemblGenomes-Tr; AOLE_t19622-1.
DR   EnsemblGenomes-Tr; EBT00001540007.
DR   EnsemblGenomes-Tr; EBT00001540011.
DR   EnsemblGenomes-Tr; EBT00001540013.
DR   EnsemblGenomes-Tr; EBT00001540016.
DR   EnsemblGenomes-Tr; EBT00001540020.
DR   EnsemblGenomes-Tr; EBT00001540024.
DR   EnsemblGenomes-Tr; EBT00001540029.
DR   EnsemblGenomes-Tr; EBT00001540033.
DR   EnsemblGenomes-Tr; EBT00001540037.
DR   EnsemblGenomes-Tr; EBT00001540041.
DR   EnsemblGenomes-Tr; EBT00001540046.
DR   EnsemblGenomes-Tr; EBT00001540050.
DR   EnsemblGenomes-Tr; EBT00001540054.
DR   EnsemblGenomes-Tr; EBT00001540058.
DR   EnsemblGenomes-Tr; EBT00001540061.
DR   EnsemblGenomes-Tr; EBT00001540064.
DR   EnsemblGenomes-Tr; EBT00001540067.
DR   EnsemblGenomes-Tr; EBT00001540071.
DR   EnsemblGenomes-Tr; EBT00001540074.
DR   EnsemblGenomes-Tr; EBT00001540078.
DR   EnsemblGenomes-Tr; EBT00001540080.
DR   EnsemblGenomes-Tr; EBT00001540081.
DR   EnsemblGenomes-Tr; EBT00001540084.
DR   EnsemblGenomes-Tr; EBT00001540088.
DR   EnsemblGenomes-Tr; EBT00001540091.
DR   EnsemblGenomes-Tr; EBT00001540094.
DR   EnsemblGenomes-Tr; EBT00001540100.
DR   EnsemblGenomes-Tr; EBT00001540105.
DR   EnsemblGenomes-Tr; EBT00001540109.
DR   EnsemblGenomes-Tr; EBT00001540114.
DR   EnsemblGenomes-Tr; EBT00001540119.
DR   EnsemblGenomes-Tr; EBT00001540122.
DR   EnsemblGenomes-Tr; EBT00001540126.
DR   EnsemblGenomes-Tr; EBT00001540128.
DR   EnsemblGenomes-Tr; EBT00001540134.
DR   EnsemblGenomes-Tr; EBT00001540139.
DR   EnsemblGenomes-Tr; EBT00001540142.
DR   EnsemblGenomes-Tr; EBT00001540145.
DR   EnsemblGenomes-Tr; EBT00001540148.
DR   EnsemblGenomes-Tr; EBT00001540153.
DR   EnsemblGenomes-Tr; EBT00001540158.
DR   EnsemblGenomes-Tr; EBT00001540163.
DR   EnsemblGenomes-Tr; EBT00001540166.
DR   EnsemblGenomes-Tr; EBT00001540173.
DR   EnsemblGenomes-Tr; EBT00001540176.
DR   EnsemblGenomes-Tr; EBT00001540179.
DR   EnsemblGenomes-Tr; EBT00001540182.
DR   EnsemblGenomes-Tr; EBT00001540186.
DR   EnsemblGenomes-Tr; EBT00001540188.
DR   EnsemblGenomes-Tr; EBT00001540191.
DR   EnsemblGenomes-Tr; EBT00001540195.
DR   EnsemblGenomes-Tr; EBT00001540201.
DR   EnsemblGenomes-Tr; EBT00001540205.
DR   EnsemblGenomes-Tr; EBT00001540207.
DR   EnsemblGenomes-Tr; EBT00001540213.
DR   EnsemblGenomes-Tr; EBT00001540217.
DR   EnsemblGenomes-Tr; EBT00001540220.
DR   EnsemblGenomes-Tr; EBT00001540223.
DR   EnsemblGenomes-Tr; EBT00001540230.
DR   EnsemblGenomes-Tr; EBT00001540234.
DR   EnsemblGenomes-Tr; EBT00001540240.
DR   EnsemblGenomes-Tr; EBT00001540246.
DR   EnsemblGenomes-Tr; EBT00001540251.
DR   EnsemblGenomes-Tr; EBT00001540256.
DR   EnsemblGenomes-Tr; EBT00001540261.
DR   EnsemblGenomes-Tr; EBT00001540266.
DR   EnsemblGenomes-Tr; EBT00001540273.
DR   EnsemblGenomes-Tr; EBT00001540281.
DR   EnsemblGenomes-Tr; EBT00001540285.
DR   EnsemblGenomes-Tr; EBT00001540289.
DR   EnsemblGenomes-Tr; EBT00001540297.
DR   EnsemblGenomes-Tr; EBT00001540303.
DR   EnsemblGenomes-Tr; EBT00001540309.
DR   EnsemblGenomes-Tr; EBT00001540315.
DR   EnsemblGenomes-Tr; EBT00001540321.
DR   EnsemblGenomes-Tr; EBT00001540326.
DR   EnsemblGenomes-Tr; EBT00001540332.
DR   EnsemblGenomes-Tr; EBT00001540337.
DR   EnsemblGenomes-Tr; EBT00001540342.
DR   EnsemblGenomes-Tr; EBT00001540349.
DR   EnsemblGenomes-Tr; EBT00001540350.
DR   EnsemblGenomes-Tr; EBT00001540352.
DR   EnsemblGenomes-Tr; EBT00001540357.
DR   EnsemblGenomes-Tr; EBT00001540359.
DR   EnsemblGenomes-Tr; EBT00001540364.
DR   EnsemblGenomes-Tr; EBT00001540368.
DR   EnsemblGenomes-Tr; EBT00001540374.
DR   EnsemblGenomes-Tr; EBT00001540380.
DR   EnsemblGenomes-Tr; EBT00001540385.
DR   EnsemblGenomes-Tr; EBT00001540390.
DR   EnsemblGenomes-Tr; EBT00001540396.
DR   EnsemblGenomes-Tr; EBT00001540400.
DR   EnsemblGenomes-Tr; EBT00001540403.
DR   EnsemblGenomes-Tr; EBT00001540409.
DR   EnsemblGenomes-Tr; EBT00001540415.
DR   EnsemblGenomes-Tr; EBT00001540422.
DR   EnsemblGenomes-Tr; EBT00001540427.
DR   EnsemblGenomes-Tr; EBT00001540442.
DR   EnsemblGenomes-Tr; EBT00001540447.
DR   EnsemblGenomes-Tr; EBT00001540454.
DR   EnsemblGenomes-Tr; EBT00001540460.
DR   EnsemblGenomes-Tr; EBT00001540465.
DR   EnsemblGenomes-Tr; EBT00001540470.
DR   EnsemblGenomes-Tr; EBT00001540474.
DR   EnsemblGenomes-Tr; EBT00001540487.
DR   EnsemblGenomes-Tr; EBT00001540490.
DR   EnsemblGenomes-Tr; EBT00001540499.
DR   EnsemblGenomes-Tr; EBT00001540502.
DR   EnsemblGenomes-Tr; EBT00001540505.
DR   EnsemblGenomes-Tr; EBT00001540512.
DR   EnsemblGenomes-Tr; EBT00001540517.
DR   EnsemblGenomes-Tr; EBT00001540522.
DR   EnsemblGenomes-Tr; EBT00001540526.
DR   EnsemblGenomes-Tr; EBT00001540530.
DR   EnsemblGenomes-Tr; EBT00001540537.
DR   EnsemblGenomes-Tr; EBT00001540550.
DR   EnsemblGenomes-Tr; EBT00001540558.
DR   EnsemblGenomes-Tr; EBT00001540561.
DR   EnsemblGenomes-Tr; EBT00001540568.
DR   EnsemblGenomes-Tr; EBT00001540570.
DR   EnsemblGenomes-Tr; EBT00001540574.
DR   EnsemblGenomes-Tr; EBT00001540579.
DR   EnsemblGenomes-Tr; EBT00001540584.
DR   EnsemblGenomes-Tr; EBT00001540590.
DR   EnsemblGenomes-Tr; EBT00001540596.
DR   EnsemblGenomes-Tr; EBT00001540602.
DR   EnsemblGenomes-Tr; EBT00001540608.
DR   EnsemblGenomes-Tr; EBT00001540613.
DR   EnsemblGenomes-Tr; EBT00001540619.
DR   EnsemblGenomes-Tr; EBT00001540629.
DR   EnsemblGenomes-Tr; EBT00001540638.
DR   EnsemblGenomes-Tr; EBT00001540645.
DR   EnsemblGenomes-Tr; EBT00001540650.
DR   EnsemblGenomes-Tr; EBT00001540657.
DR   EnsemblGenomes-Tr; EBT00001540661.
DR   EnsemblGenomes-Tr; EBT00001540668.
DR   EuropePMC; PMC2937415; 20639327.
DR   EuropePMC; PMC4298557; 25428154.
DR   EuropePMC; PMC4319608; 25657268.
DR   EuropePMC; PMC4756669; 26884212.
DR   EuropePMC; PMC4993456; 27548264.
DR   EuropePMC; PMC5217672; 27895125.
DR   EuropePMC; PMC5923157; 29463529.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002080.
DR   SILVA-SSU; CP002080.
CC   Genome was manually curated based on annotation generated by the
CC   NCBI Prokaryotic Genomes Automatic Annotation Pipeline Group.
CC   Information about the Pipeline can be found here:
CC   http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html.
FH   Key             Location/Qualifiers
FT   source          1..4152543
FT                   /organism="Acinetobacter oleivorans DR1"
FT                   /strain="DR1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:436717"
FT                   /culture_collection="JCM:16667"
FT                   /culture_collection="KCTC:23045"
FT   gene            324..1730
FT                   /gene="dnaA"
FT                   /locus_tag="AOLE_00005"
FT   CDS_pept        324..1730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="AOLE_00005"
FT                   /product="chromosomal replication initiation protein"
FT                   /note="COG0593 ATPase involved in DNA replication
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88904"
FT                   /db_xref="GOA:D8JKL4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKL4"
FT                   /protein_id="ADI88904.1"
FT                   YKNLLRLLQS"
FT   gene            1828..2976
FT                   /locus_tag="AOLE_00010"
FT   CDS_pept        1828..2976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00010"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /note="COG0592 DNA polymerase sliding clamp subunit (PCNA
FT                   homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88905"
FT                   /db_xref="GOA:D8JKL5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKL5"
FT                   /protein_id="ADI88905.1"
FT   gene            2991..4073
FT                   /locus_tag="AOLE_00015"
FT   CDS_pept        2991..4073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00015"
FT                   /product="recombination protein F"
FT                   /note="COG1195 Recombinational DNA repair ATPase (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88906"
FT                   /db_xref="GOA:D8JKL6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKL6"
FT                   /protein_id="ADI88906.1"
FT   gene            4126..6594
FT                   /locus_tag="AOLE_00020"
FT   CDS_pept        4126..6594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00020"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="COG0187 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88907"
FT                   /db_xref="GOA:D8JKL7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKL7"
FT                   /protein_id="ADI88907.1"
FT                   ENALNADIDA"
FT   gene            6635..7024
FT                   /locus_tag="AOLE_00025"
FT   CDS_pept        6635..7024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00025"
FT                   /product="putative of cytochrome b(562) (CybC)"
FT                   /note="COG3783 Soluble cytochrome b562"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88908"
FT                   /db_xref="GOA:D8JKL8"
FT                   /db_xref="InterPro:IPR009155"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKL8"
FT                   /protein_id="ADI88908.1"
FT   gene            7160..8086
FT                   /locus_tag="AOLE_00030"
FT   CDS_pept        7160..8086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00030"
FT                   /product="hypothetical protein"
FT                   /note="COG0823 Periplasmic component of the Tol biopolymer
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88909"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKL9"
FT                   /protein_id="ADI88909.1"
FT   gene            complement(8137..10068)
FT                   /locus_tag="AOLE_00035"
FT   CDS_pept        complement(8137..10068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00035"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88910"
FT                   /db_xref="GOA:D8JKM0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKM0"
FT                   /protein_id="ADI88910.1"
FT                   EEMEASFD"
FT   gene            10322..11326
FT                   /locus_tag="AOLE_00040"
FT   CDS_pept        10322..11326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88911"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKM1"
FT                   /protein_id="ADI88911.1"
FT   gene            11582..12589
FT                   /locus_tag="AOLE_00045"
FT   CDS_pept        11582..12589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88912"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKM2"
FT                   /protein_id="ADI88912.1"
FT   gene            12942..13946
FT                   /locus_tag="AOLE_00050"
FT   CDS_pept        12942..13946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00050"
FT                   /product="RND type efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88913"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKM3"
FT                   /protein_id="ADI88913.1"
FT   gene            14071..14406
FT                   /locus_tag="AOLE_00055"
FT   CDS_pept        14071..14406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00055"
FT                   /product="iron-sulfur cluster insertion protein ErpA"
FT                   /note="COG0316 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88914"
FT                   /db_xref="GOA:D8JKM4"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKM4"
FT                   /protein_id="ADI88914.1"
FT                   CGSSFSI"
FT   gene            complement(14466..15308)
FT                   /locus_tag="AOLE_00060"
FT   CDS_pept        complement(14466..15308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00060"
FT                   /product="alpha/beta hydrolase fold family protein"
FT                   /note="COG0596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88915"
FT                   /db_xref="GOA:D8JKM5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKM5"
FT                   /protein_id="ADI88915.1"
FT   gene            complement(15436..16563)
FT                   /gene="anmK"
FT                   /locus_tag="AOLE_00065"
FT   CDS_pept        complement(15436..16563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="anmK"
FT                   /locus_tag="AOLE_00065"
FT                   /product="anhydro-N-acetylmuramic acid kinase"
FT                   /note="COG2377 Predicted molecular chaperone distantly
FT                   related to HSP70-fold metalloproteases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88916"
FT                   /db_xref="GOA:D8JKM6"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKM6"
FT                   /protein_id="ADI88916.1"
FT   gene            16625..17857
FT                   /locus_tag="AOLE_00070"
FT   CDS_pept        16625..17857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00070"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG0162 Tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88917"
FT                   /db_xref="GOA:D8JKM7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKM7"
FT                   /protein_id="ADI88917.1"
FT                   KKAIARVTFTD"
FT   gene            18767..20303
FT                   /locus_tag="AOLE_r19636"
FT   rRNA            18767..20303
FT                   /locus_tag="AOLE_r19636"
FT                   /product="16S ribosomal RNA"
FT   gene            20363..20439
FT                   /locus_tag="AOLE_t19482"
FT   tRNA            20363..20439
FT                   /locus_tag="AOLE_t19482"
FT                   /product="tRNA-Ile"
FT   gene            20495..20570
FT                   /locus_tag="AOLE_t19484"
FT   tRNA            20495..20570
FT                   /locus_tag="AOLE_t19484"
FT                   /product="tRNA-Ala"
FT   gene            20923..23825
FT                   /locus_tag="AOLE_r19648"
FT   rRNA            20923..23825
FT                   /locus_tag="AOLE_r19648"
FT                   /product="23S ribosomal RNA"
FT   gene            23995..24109
FT                   /locus_tag="AOLE_r19624"
FT   rRNA            23995..24109
FT                   /locus_tag="AOLE_r19624"
FT                   /product="5S ribosomal RNA"
FT   gene            24275..24871
FT                   /locus_tag="AOLE_00075"
FT   CDS_pept        24275..24871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00075"
FT                   /product="glutathione S-transferase"
FT                   /note="COG0625 Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88918"
FT                   /db_xref="GOA:D8JKM8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKM8"
FT                   /protein_id="ADI88918.1"
FT   gene            complement(24936..25664)
FT                   /locus_tag="AOLE_00080"
FT   CDS_pept        complement(24936..25664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88919"
FT                   /db_xref="InterPro:IPR026387"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKM9"
FT                   /protein_id="ADI88919.1"
FT   gene            26279..27757
FT                   /locus_tag="AOLE_00085"
FT   CDS_pept        26279..27757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00085"
FT                   /product="Hypothetical sodium-dependent transporter HI0736"
FT                   /note="COG0733 Na+-dependent transporters of the SNF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88920"
FT                   /db_xref="GOA:D8JKN0"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKN0"
FT                   /protein_id="ADI88920.1"
FT   gene            27770..27913
FT                   /locus_tag="AOLE_00090"
FT   CDS_pept        27770..27913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88921"
FT                   /db_xref="GOA:D8JKN1"
FT                   /db_xref="InterPro:IPR031596"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKN1"
FT                   /protein_id="ADI88921.1"
FT                   TL"
FT   gene            complement(27953..29257)
FT                   /locus_tag="AOLE_00095"
FT   CDS_pept        complement(27953..29257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00095"
FT                   /product="tRNA and rRNA cytosine-C5-methylase"
FT                   /note="COG0144 tRNA and rRNA cytosine-C5-methylases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88922"
FT                   /db_xref="GOA:D8JKN2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKN2"
FT                   /protein_id="ADI88922.1"
FT   gene            complement(29254..30216)
FT                   /locus_tag="AOLE_00100"
FT   CDS_pept        complement(29254..30216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00100"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="COG0223 Methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88923"
FT                   /db_xref="GOA:D8JKN3"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKN3"
FT                   /protein_id="ADI88923.1"
FT   gene            30565..32394
FT                   /locus_tag="AOLE_00105"
FT   CDS_pept        30565..32394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00105"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number=""
FT                   /note="COG0129 Dihydroxyacid dehydratase/phosphogluconate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88924"
FT                   /db_xref="GOA:D8JKN4"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKN4"
FT                   /protein_id="ADI88924.1"
FT   gene            32715..34004
FT                   /locus_tag="AOLE_00110"
FT   CDS_pept        32715..34004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88925"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKN5"
FT                   /protein_id="ADI88925.1"
FT   gene            34083..34814
FT                   /locus_tag="AOLE_00115"
FT   CDS_pept        34083..34814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00115"
FT                   /product="hypothetical protein"
FT                   /note="COG0730 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88926"
FT                   /db_xref="GOA:D8JKN6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKN6"
FT                   /protein_id="ADI88926.1"
FT   gene            complement(34811..35713)
FT                   /locus_tag="AOLE_00120"
FT   CDS_pept        complement(34811..35713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00120"
FT                   /product="LysR substrate binding domain protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88927"
FT                   /db_xref="GOA:D8JKN7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKN7"
FT                   /protein_id="ADI88927.1"
FT   gene            complement(35793..37088)
FT                   /locus_tag="AOLE_00125"
FT   CDS_pept        complement(35793..37088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00125"
FT                   /product="Putative pyrimidine permease rutG (Pyrimidine
FT                   utilization protein G)"
FT                   /note="COG2233 Xanthine/uracil permeases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88928"
FT                   /db_xref="GOA:D8JKN8"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKN8"
FT                   /protein_id="ADI88928.1"
FT   gene            complement(37386..40070)
FT                   /locus_tag="AOLE_00130"
FT   CDS_pept        complement(37386..40070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00130"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number=""
FT                   /note="COG2352 Phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88929"
FT                   /db_xref="GOA:D8JKN9"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKN9"
FT                   /protein_id="ADI88929.1"
FT   gene            complement(40241..40864)
FT                   /locus_tag="AOLE_00135"
FT   CDS_pept        complement(40241..40864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00135"
FT                   /product="transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88930"
FT                   /db_xref="GOA:D8JKP0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKP0"
FT                   /protein_id="ADI88930.1"
FT   gene            41014..42120
FT                   /locus_tag="AOLE_00140"
FT   CDS_pept        41014..42120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00140"
FT                   /product="putative RND efflux membrane fusion protein
FT                   precursor"
FT                   /note="COG0845 Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88931"
FT                   /db_xref="GOA:D8JKP1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKP1"
FT                   /protein_id="ADI88931.1"
FT   gene            42117..45242
FT                   /locus_tag="AOLE_00145"
FT   CDS_pept        42117..45242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00145"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /note="COG0841 Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88932"
FT                   /db_xref="GOA:D8JKP2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKP2"
FT                   /protein_id="ADI88932.1"
FT   gene            45382..45759
FT                   /locus_tag="AOLE_00150"
FT   CDS_pept        45382..45759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00150"
FT                   /product="hypothetical protein"
FT                   /note="COG1271 Cytochrome bd-type quinol oxidase, subunit
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88933"
FT                   /db_xref="GOA:D8JKP3"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKP3"
FT                   /protein_id="ADI88933.1"
FT   gene            45863..46975
FT                   /locus_tag="AOLE_00155"
FT   CDS_pept        45863..46975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00155"
FT                   /product="chaperone protein DnaJ"
FT                   /note="COG0484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88934"
FT                   /db_xref="GOA:D8JKP4"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKP4"
FT                   /protein_id="ADI88934.1"
FT   gene            complement(47090..47449)
FT                   /locus_tag="AOLE_00160"
FT   CDS_pept        complement(47090..47449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88935"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKP5"
FT                   /protein_id="ADI88935.1"
FT                   PTVSVNDIDVAHPTE"
FT   gene            47633..48454
FT                   /locus_tag="AOLE_00165"
FT   CDS_pept        47633..48454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00165"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number=""
FT                   /note="COG0289 Dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88936"
FT                   /db_xref="GOA:D8JKP6"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKP6"
FT                   /protein_id="ADI88936.1"
FT   gene            48505..49158
FT                   /locus_tag="AOLE_00170"
FT   CDS_pept        48505..49158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00170"
FT                   /product="START domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88937"
FT                   /db_xref="GOA:D8JKP7"
FT                   /db_xref="InterPro:IPR002913"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR028347"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKP7"
FT                   /protein_id="ADI88937.1"
FT   gene            complement(49200..50390)
FT                   /locus_tag="AOLE_00175"
FT   CDS_pept        complement(49200..50390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00175"
FT                   /product="MFS family transporter"
FT                   /note="COG2814 Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88938"
FT                   /db_xref="GOA:D8JKP8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKP8"
FT                   /protein_id="ADI88938.1"
FT   gene            complement(50395..51198)
FT                   /gene="dkgB"
FT                   /locus_tag="AOLE_00180"
FT   CDS_pept        complement(50395..51198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dkgB"
FT                   /locus_tag="AOLE_00180"
FT                   /product="2,5-diketo-D-gluconate reductase B"
FT                   /EC_number=""
FT                   /note="COG0656 Aldo/keto reductases, related to
FT                   diketogulonate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88939"
FT                   /db_xref="GOA:D8JKP9"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKP9"
FT                   /protein_id="ADI88939.1"
FT   gene            51319..52221
FT                   /locus_tag="AOLE_00185"
FT   CDS_pept        51319..52221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00185"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88940"
FT                   /db_xref="GOA:D8JKQ0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKQ0"
FT                   /protein_id="ADI88940.1"
FT   gene            complement(52205..52579)
FT                   /locus_tag="AOLE_00190"
FT   CDS_pept        complement(52205..52579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88941"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKQ1"
FT                   /protein_id="ADI88941.1"
FT   gene            52670..54094
FT                   /locus_tag="AOLE_00195"
FT   CDS_pept        52670..54094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00195"
FT                   /product="transcriptional regulator"
FT                   /note="COG1167 Transcriptional regulators containing a
FT                   DNA-binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88942"
FT                   /db_xref="GOA:D8JKQ2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKQ2"
FT                   /protein_id="ADI88942.1"
FT                   ISDLAEWSRQQMKTLS"
FT   gene            complement(54097..55125)
FT                   /locus_tag="AOLE_00200"
FT   CDS_pept        complement(54097..55125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00200"
FT                   /product="putative alcohol dehydrogenase"
FT                   /note="COG1064 Zn-dependent alcohol dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88943"
FT                   /db_xref="GOA:D8JKQ3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKQ3"
FT                   /protein_id="ADI88943.1"
FT                   AE"
FT   gene            complement(55164..55724)
FT                   /locus_tag="AOLE_00205"
FT   CDS_pept        complement(55164..55724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00205"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /note="COG2818 3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88944"
FT                   /db_xref="GOA:D8JKQ4"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKQ4"
FT                   /protein_id="ADI88944.1"
FT   gene            complement(55755..56000)
FT                   /locus_tag="AOLE_00210"
FT   CDS_pept        complement(55755..56000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88945"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKQ5"
FT                   /protein_id="ADI88945.1"
FT   gene            complement(56010..56546)
FT                   /locus_tag="AOLE_00215"
FT   CDS_pept        complement(56010..56546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00215"
FT                   /product="peptidoglycan hydrolase"
FT                   /note="COG0739 Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88946"
FT                   /db_xref="GOA:D8JKQ6"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKQ6"
FT                   /protein_id="ADI88946.1"
FT                   DGKGRGAVNPYSYLR"
FT   gene            complement(56594..57628)
FT                   /locus_tag="AOLE_00220"
FT   CDS_pept        complement(56594..57628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00220"
FT                   /product="A/G specific adenine glycosylase"
FT                   /note="COG1194 A/G-specific DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88947"
FT                   /db_xref="GOA:D8JKQ7"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKQ7"
FT                   /protein_id="ADI88947.1"
FT                   TSRS"
FT   gene            complement(57769..58131)
FT                   /locus_tag="AOLE_00225"
FT   CDS_pept        complement(57769..58131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00225"
FT                   /product="HIT domain protein"
FT                   /note="COG0537 Diadenosine tetraphosphate (Ap4A) hydrolase
FT                   and other HIT family hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88948"
FT                   /db_xref="GOA:D8JKQ8"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKQ8"
FT                   /protein_id="ADI88948.1"
FT                   KNQPLKLDQRWGVRKD"
FT   gene            complement(58315..59052)
FT                   /locus_tag="AOLE_00230"
FT   CDS_pept        complement(58315..59052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00230"
FT                   /product="Putative
FT                   carboxymethylenebutenolidase(Dienelactonehydrolase) (DLH)"
FT                   /note="COG0412 Dienelactone hydrolase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88949"
FT                   /db_xref="GOA:D8JKQ9"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKQ9"
FT                   /protein_id="ADI88949.1"
FT   gene            complement(59224..59382)
FT                   /locus_tag="AOLE_00235"
FT   CDS_pept        complement(59224..59382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88950"
FT                   /db_xref="GOA:D8JKR0"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKR0"
FT                   /protein_id="ADI88950.1"
FT                   FISRGRT"
FT   gene            59576..60034
FT                   /locus_tag="AOLE_00240"
FT   CDS_pept        59576..60034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00240"
FT                   /product="hypothetical protein"
FT                   /note="COG2983 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88951"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR008228"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKR1"
FT                   /protein_id="ADI88951.1"
FT   gene            60146..61315
FT                   /locus_tag="AOLE_00245"
FT   CDS_pept        60146..61315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00245"
FT                   /product="Glucose / Sorbosone dehydrogenase family protein"
FT                   /note="COG2133 Glucose/sorbosone dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88952"
FT                   /db_xref="GOA:D8JKR2"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKR2"
FT                   /protein_id="ADI88952.1"
FT   gene            61418..62683
FT                   /locus_tag="AOLE_00250"
FT   CDS_pept        61418..62683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00250"
FT                   /product="recombination factor protein RarA"
FT                   /note="COG2256 ATPase related to the helicase subunit of
FT                   the Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88953"
FT                   /db_xref="GOA:D8JKR3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKR3"
FT                   /protein_id="ADI88953.1"
FT   gene            complement(62685..63533)
FT                   /locus_tag="AOLE_00255"
FT   CDS_pept        complement(62685..63533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00255"
FT                   /product="formate/nitrate transporter"
FT                   /note="COG2116 Formate/nitrite family of transporters"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88954"
FT                   /db_xref="GOA:D8JKR4"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKR4"
FT                   /protein_id="ADI88954.1"
FT                   Q"
FT   gene            complement(63686..63889)
FT                   /locus_tag="AOLE_00260"
FT   CDS_pept        complement(63686..63889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88955"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKR5"
FT                   /protein_id="ADI88955.1"
FT   gene            complement(64080..64799)
FT                   /locus_tag="AOLE_00265"
FT   CDS_pept        complement(64080..64799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00265"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number=""
FT                   /note="COG0152
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88956"
FT                   /db_xref="GOA:D8JKR6"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKR6"
FT                   /protein_id="ADI88956.1"
FT                   EAYEEVAARLGVDLSAL"
FT   gene            complement(64835..65443)
FT                   /locus_tag="AOLE_00270"
FT   CDS_pept        complement(64835..65443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88957"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKR7"
FT                   /protein_id="ADI88957.1"
FT   gene            complement(65456..66349)
FT                   /locus_tag="AOLE_00275"
FT   CDS_pept        complement(65456..66349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00275"
FT                   /product="dihydrodipicolinate synthase"
FT                   /note="COG0329 Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88958"
FT                   /db_xref="GOA:D8JKR8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKR8"
FT                   /protein_id="ADI88958.1"
FT                   QYREPLRNALKDAGII"
FT   gene            66679..67323
FT                   /locus_tag="AOLE_00280"
FT   CDS_pept        66679..67323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00280"
FT                   /product="Pyrazinamidase/nicotinamidase"
FT                   /note="COG1335 Amidases related to nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88959"
FT                   /db_xref="GOA:D8JKR9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKR9"
FT                   /protein_id="ADI88959.1"
FT   gene            67364..68302
FT                   /locus_tag="AOLE_00285"
FT   CDS_pept        67364..68302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00285"
FT                   /product="Sodium Bile acid symporter family protein"
FT                   /note="COG0385 Predicted Na+-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88960"
FT                   /db_xref="GOA:D8JKS0"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKS0"
FT                   /protein_id="ADI88960.1"
FT   gene            68479..69822
FT                   /locus_tag="AOLE_00290"
FT   CDS_pept        68479..69822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00290"
FT                   /product="Multidrug resistance protein norM"
FT                   /note="COG0534 Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88961"
FT                   /db_xref="GOA:D8JKS1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKS1"
FT                   /protein_id="ADI88961.1"
FT   gene            complement(69838..70308)
FT                   /locus_tag="AOLE_00295"
FT   CDS_pept        complement(69838..70308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00295"
FT                   /product="hypothetical protein"
FT                   /note="COG1683 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88962"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKS2"
FT                   /protein_id="ADI88962.1"
FT   gene            70834..71889
FT                   /locus_tag="AOLE_00300"
FT   CDS_pept        70834..71889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00300"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /note="COG3185 4-hydroxyphenylpyruvate dioxygenase and
FT                   related hemolysins"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88963"
FT                   /db_xref="GOA:D8JKS3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKS3"
FT                   /protein_id="ADI88963.1"
FT                   DQIRRGVLEAK"
FT   gene            complement(71956..72735)
FT                   /locus_tag="AOLE_00305"
FT   CDS_pept        complement(71956..72735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00305"
FT                   /product="Acetate operon repressor"
FT                   /note="COG1414 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88964"
FT                   /db_xref="GOA:D8JKS4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKS4"
FT                   /protein_id="ADI88964.1"
FT   gene            complement(73031..73579)
FT                   /locus_tag="AOLE_00310"
FT   CDS_pept        complement(73031..73579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00310"
FT                   /product="putative homogentisate 1,2-dioxygenase"
FT                   /note="COG0346 Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88965"
FT                   /db_xref="GOA:D8JKS5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKS5"
FT                   /protein_id="ADI88965.1"
FT   gene            complement(73597..74229)
FT                   /locus_tag="AOLE_00315"
FT   CDS_pept        complement(73597..74229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00315"
FT                   /product="maleylacetoacetate isomerase"
FT                   /note="COG0625 Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88966"
FT                   /db_xref="GOA:D8JKS6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKS6"
FT                   /protein_id="ADI88966.1"
FT   gene            complement(74216..75523)
FT                   /locus_tag="AOLE_00320"
FT   CDS_pept        complement(74216..75523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00320"
FT                   /product="fumarylacetoacetase"
FT                   /note="COG0179 2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
FT                   (catechol pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88967"
FT                   /db_xref="GOA:D8JKS7"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKS7"
FT                   /protein_id="ADI88967.1"
FT   gene            75877..77265
FT                   /locus_tag="AOLE_00325"
FT   CDS_pept        75877..77265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00325"
FT                   /product="gamma-aminobutyrate permease"
FT                   /note="COG1113 Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88968"
FT                   /db_xref="GOA:D8JKS8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKS8"
FT                   /protein_id="ADI88968.1"
FT                   EADI"
FT   gene            77431..78108
FT                   /locus_tag="AOLE_00330"
FT   CDS_pept        77431..78108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00330"
FT                   /product="Peptidase M15 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88969"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR013230"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKS9"
FT                   /protein_id="ADI88969.1"
FT                   ICQ"
FT   gene            78293..79522
FT                   /locus_tag="AOLE_00335"
FT   CDS_pept        78293..79522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00335"
FT                   /product="CobW/HypB/UreG, nucleotide-binding domain
FT                   protein"
FT                   /note="COG0523 Putative GTPases (G3E family)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88970"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKT0"
FT                   /protein_id="ADI88970.1"
FT                   KQEDETMLIA"
FT   gene            complement(79555..80622)
FT                   /locus_tag="AOLE_00340"
FT   CDS_pept        complement(79555..80622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00340"
FT                   /product="putative acyltransferase"
FT                   /note="COG1835 Predicted acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88971"
FT                   /db_xref="GOA:D8JKT1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKT1"
FT                   /protein_id="ADI88971.1"
FT                   PLNSYIRKIFIKDKS"
FT   gene            81021..81773
FT                   /locus_tag="AOLE_00345"
FT   CDS_pept        81021..81773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00345"
FT                   /product="histidine utilization repressor"
FT                   /note="COG2188 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88972"
FT                   /db_xref="GOA:D8JKT2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKT2"
FT                   /protein_id="ADI88972.1"
FT   gene            81770..82345
FT                   /locus_tag="AOLE_00350"
FT   CDS_pept        81770..82345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00350"
FT                   /product="hypothetical protein"
FT                   /note="COG3758 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88973"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKT3"
FT                   /protein_id="ADI88973.1"
FT   gene            82597..84273
FT                   /locus_tag="AOLE_00355"
FT   CDS_pept        82597..84273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00355"
FT                   /product="urocanate hydratase"
FT                   /EC_number=""
FT                   /note="COG2987 Urocanate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88974"
FT                   /db_xref="GOA:D8JKT4"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKT4"
FT                   /protein_id="ADI88974.1"
FT   gene            84361..85899
FT                   /locus_tag="AOLE_00360"
FT   CDS_pept        84361..85899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00360"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number=""
FT                   /note="COG2986 Histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88975"
FT                   /db_xref="GOA:D8JKT5"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKT5"
FT                   /protein_id="ADI88975.1"
FT   gene            85964..87376
FT                   /locus_tag="AOLE_00365"
FT   CDS_pept        85964..87376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00365"
FT                   /product="Proline-specific permease proY"
FT                   /note="COG1113 Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88976"
FT                   /db_xref="GOA:D8JKT6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKT6"
FT                   /protein_id="ADI88976.1"
FT                   SNPIQQNVEIES"
FT   gene            87428..88633
FT                   /locus_tag="AOLE_00370"
FT   CDS_pept        87428..88633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00370"
FT                   /product="imidazolonepropionase"
FT                   /EC_number=""
FT                   /note="COG1228 Imidazolonepropionase and related
FT                   amidohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88977"
FT                   /db_xref="GOA:D8JKT7"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKT7"
FT                   /protein_id="ADI88977.1"
FT                   IF"
FT   gene            88644..89564
FT                   /locus_tag="AOLE_00375"
FT   CDS_pept        88644..89564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00375"
FT                   /product="formimidoylglutamase"
FT                   /note="COG0010 Arginase/agmatinase/formimionoglutamate
FT                   hydrolase, arginase family"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88978"
FT                   /db_xref="GOA:D8JKT8"
FT                   /db_xref="InterPro:IPR005923"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKT8"
FT                   /protein_id="ADI88978.1"
FT   gene            89818..91644
FT                   /locus_tag="AOLE_00380"
FT   CDS_pept        89818..91644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00380"
FT                   /product="hypothetical protein"
FT                   /note="COG4805 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88979"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKT9"
FT                   /protein_id="ADI88979.1"
FT   gene            91749..92387
FT                   /locus_tag="AOLE_00385"
FT   CDS_pept        91749..92387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00385"
FT                   /product="phosphatase"
FT                   /note="COG0546 Predicted phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88980"
FT                   /db_xref="GOA:D8JKU0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKU0"
FT                   /protein_id="ADI88980.1"
FT   gene            92411..93211
FT                   /locus_tag="AOLE_00390"
FT   CDS_pept        92411..93211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00390"
FT                   /product="glutamate racemase"
FT                   /note="COG0796 Glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88981"
FT                   /db_xref="GOA:D8JKU1"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKU1"
FT                   /protein_id="ADI88981.1"
FT   gene            complement(93267..94487)
FT                   /locus_tag="AOLE_00395"
FT   CDS_pept        complement(93267..94487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88982"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKU2"
FT                   /protein_id="ADI88982.1"
FT                   RWELKSA"
FT   gene            95672..95992
FT                   /locus_tag="AOLE_00400"
FT   CDS_pept        95672..95992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88983"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKU3"
FT                   /protein_id="ADI88983.1"
FT                   SQ"
FT   gene            96141..96278
FT                   /locus_tag="AOLE_00405"
FT   CDS_pept        96141..96278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88984"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKU4"
FT                   /protein_id="ADI88984.1"
FT                   "
FT   gene            complement(96206..98044)
FT                   /locus_tag="AOLE_00410"
FT   CDS_pept        complement(96206..98044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00410"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /EC_number=""
FT                   /note="COG0449 Glucosamine 6-phosphate synthetase, contains
FT                   amidotransferase and phosphosugar isomerase domains"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88985"
FT                   /db_xref="GOA:D8JKU5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKU5"
FT                   /protein_id="ADI88985.1"
FT   gene            complement(98057..99421)
FT                   /locus_tag="AOLE_00415"
FT   CDS_pept        complement(98057..99421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00415"
FT                   /product="N-acetylglucosamine-1-phosphate
FT                   uridyltransferase"
FT                   /note="COG1207 N-acetylglucosamine-1-phosphate
FT                   uridyltransferase (contains nucleotidyltransferase and
FT                   I-patch acetyltransferase domains)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88986"
FT                   /db_xref="GOA:D8JKU6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKU6"
FT                   /protein_id="ADI88986.1"
FT   gene            complement(99437..99952)
FT                   /locus_tag="AOLE_00420"
FT   CDS_pept        complement(99437..99952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00420"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /note="COG1267 Phosphatidylglycerophosphatase A and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88987"
FT                   /db_xref="GOA:D8JKU7"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKU7"
FT                   /protein_id="ADI88987.1"
FT                   TLIIIHLT"
FT   gene            complement(99930..100847)
FT                   /locus_tag="AOLE_00425"
FT   CDS_pept        complement(99930..100847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00425"
FT                   /product="thiamine-monophosphate kinase"
FT                   /note="COG0611 Thiamine monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88988"
FT                   /db_xref="GOA:D8JKU8"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKU8"
FT                   /protein_id="ADI88988.1"
FT   gene            complement(100864..101313)
FT                   /gene="nusB"
FT                   /locus_tag="AOLE_00430"
FT   CDS_pept        complement(100864..101313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="AOLE_00430"
FT                   /product="transcription antitermination protein NusB"
FT                   /note="COG0781 Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88989"
FT                   /db_xref="GOA:D8JKU9"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKU9"
FT                   /protein_id="ADI88989.1"
FT   gene            complement(101317..101787)
FT                   /gene="ribH"
FT                   /locus_tag="AOLE_00435"
FT   CDS_pept        complement(101317..101787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="AOLE_00435"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /note="COG0054 Riboflavin synthase beta-chain"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88990"
FT                   /db_xref="GOA:D8JKV0"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKV0"
FT                   /protein_id="ADI88990.1"
FT   gene            complement(101799..102920)
FT                   /locus_tag="AOLE_00440"
FT   CDS_pept        complement(101799..102920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00440"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="COG0108 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88991"
FT                   /db_xref="GOA:D8JKV1"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKV1"
FT                   /protein_id="ADI88991.1"
FT   gene            complement(103160..104449)
FT                   /locus_tag="AOLE_00445"
FT   CDS_pept        complement(103160..104449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88992"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKV2"
FT                   /protein_id="ADI88992.1"
FT   gene            104527..105750
FT                   /locus_tag="AOLE_00450"
FT   CDS_pept        104527..105750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00450"
FT                   /product="phosphoserine phosphatase SerB"
FT                   /note="COG3830 ACT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88993"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKV3"
FT                   /protein_id="ADI88993.1"
FT                   HDKDLNRA"
FT   gene            complement(105837..106046)
FT                   /locus_tag="AOLE_00455"
FT   CDS_pept        complement(105837..106046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88994"
FT                   /db_xref="GOA:D8JKV4"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKV4"
FT                   /protein_id="ADI88994.1"
FT   gene            106160..106495
FT                   /locus_tag="AOLE_00460"
FT   CDS_pept        106160..106495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88995"
FT                   /db_xref="GOA:D8JKV5"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKV5"
FT                   /protein_id="ADI88995.1"
FT                   QQQCSSR"
FT   gene            106747..107226
FT                   /locus_tag="AOLE_00465"
FT   CDS_pept        106747..107226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00465"
FT                   /product="hypothetical protein"
FT                   /note="COG1432 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88996"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKV6"
FT                   /protein_id="ADI88996.1"
FT   gene            complement(107270..107713)
FT                   /locus_tag="AOLE_00470"
FT   CDS_pept        complement(107270..107713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00470"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="COG1490 D-Tyr-tRNAtyr deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88997"
FT                   /db_xref="GOA:D8JKV7"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKV7"
FT                   /protein_id="ADI88997.1"
FT   gene            107882..109096
FT                   /locus_tag="AOLE_00475"
FT   CDS_pept        107882..109096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00475"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="COG1488 Nicotinic acid phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88998"
FT                   /db_xref="GOA:D8JKV8"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKV8"
FT                   /protein_id="ADI88998.1"
FT                   LEEVV"
FT   gene            109244..110092
FT                   /locus_tag="AOLE_00480"
FT   CDS_pept        109244..110092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00480"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /note="COG2897 Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ADI88999"
FT                   /db_xref="GOA:D8JKV9"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKV9"
FT                   /protein_id="ADI88999.1"
FT                   S"
FT   gene            110089..110940
FT                   /gene="psd"
FT                   /locus_tag="AOLE_00485"
FT   CDS_pept        110089..110940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="AOLE_00485"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number=""
FT                   /note="COG0688 Phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89000"
FT                   /db_xref="GOA:D8JKW0"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKW0"
FT                   /protein_id="ADI89000.1"
FT                   TV"
FT   gene            111366..112586
FT                   /locus_tag="AOLE_00490"
FT   CDS_pept        111366..112586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00490"
FT                   /product="acetamidase/formamidase"
FT                   /note="COG2421 Predicted acetamidase/formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89001"
FT                   /db_xref="GOA:D8JKW1"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKW1"
FT                   /protein_id="ADI89001.1"
FT                   FKEFESK"
FT   gene            complement(112616..113377)
FT                   /locus_tag="AOLE_00495"
FT   CDS_pept        complement(112616..113377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00495"
FT                   /product="accessory colonization factor AcfC"
FT                   /note="COG4588 Accessory colonization factor AcfC, contains
FT                   ABC-type periplasmic domain"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89002"
FT                   /db_xref="GOA:D8JKW2"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKW2"
FT                   /protein_id="ADI89002.1"
FT   gene            113619..114815
FT                   /locus_tag="AOLE_00500"
FT   CDS_pept        113619..114815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00500"
FT                   /product="Secretory lipase family protein"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89003"
FT                   /db_xref="GOA:D8JKW3"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKW3"
FT                   /protein_id="ADI89003.1"
FT   gene            complement(114930..115466)
FT                   /locus_tag="AOLE_00505"
FT   CDS_pept        complement(114930..115466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00505"
FT                   /product="hypothetical protein"
FT                   /note="COG0182 Predicted translation initiation factor 2B
FT                   subunit, eIF-2B alpha/beta/delta family"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89004"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKW4"
FT                   /protein_id="ADI89004.1"
FT                   GADGKWRKNGREYEG"
FT   gene            complement(115899..117257)
FT                   /locus_tag="AOLE_00510"
FT   CDS_pept        complement(115899..117257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00510"
FT                   /product="phosphate regulon sensor kinase PhoR"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89005"
FT                   /db_xref="GOA:D8JKW5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKW5"
FT                   /protein_id="ADI89005.1"
FT   gene            complement(117267..117977)
FT                   /locus_tag="AOLE_00515"
FT   CDS_pept        complement(117267..117977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00515"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89006"
FT                   /db_xref="GOA:D8JKW6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKW6"
FT                   /protein_id="ADI89006.1"
FT                   TGYRFSTRADLAAG"
FT   gene            complement(118232..118903)
FT                   /locus_tag="AOLE_00520"
FT   CDS_pept        complement(118232..118903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00520"
FT                   /product="TetR family regulatory protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89007"
FT                   /db_xref="GOA:D8JKW7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKW7"
FT                   /protein_id="ADI89007.1"
FT                   K"
FT   gene            119116..119949
FT                   /locus_tag="AOLE_00525"
FT   CDS_pept        119116..119949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00525"
FT                   /product="putative short-chain dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89008"
FT                   /db_xref="GOA:D8JKW8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKW8"
FT                   /protein_id="ADI89008.1"
FT   gene            complement(120006..121373)
FT                   /locus_tag="AOLE_00530"
FT   CDS_pept        complement(120006..121373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00530"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /note="COG0534 Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89009"
FT                   /db_xref="GOA:D8JKW9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKW9"
FT                   /protein_id="ADI89009.1"
FT   gene            complement(121479..122633)
FT                   /locus_tag="AOLE_00535"
FT   CDS_pept        complement(121479..122633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00535"
FT                   /product="putative aminotransferase"
FT                   /note="COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89010"
FT                   /db_xref="GOA:D8JKX0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKX0"
FT                   /protein_id="ADI89010.1"
FT   gene            complement(122662..123972)
FT                   /locus_tag="AOLE_00540"
FT   CDS_pept        complement(122662..123972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00540"
FT                   /product="hypothetical protein"
FT                   /note="COG2733 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89011"
FT                   /db_xref="GOA:D8JKX1"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKX1"
FT                   /protein_id="ADI89011.1"
FT   gene            complement(123986..124549)
FT                   /locus_tag="AOLE_00545"
FT   CDS_pept        complement(123986..124549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89012"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKX2"
FT                   /protein_id="ADI89012.1"
FT   gene            complement(124609..125148)
FT                   /locus_tag="AOLE_00550"
FT   CDS_pept        complement(124609..125148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00550"
FT                   /product="hypothetical protein"
FT                   /note="COG3803 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89013"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKX3"
FT                   /protein_id="ADI89013.1"
FT                   STPEETEFLLEPNSSF"
FT   gene            125317..126894
FT                   /locus_tag="AOLE_00555"
FT   CDS_pept        125317..126894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00555"
FT                   /product="glutamate--cysteine ligase"
FT                   /note="COG2918 Gamma-glutamylcysteine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89014"
FT                   /db_xref="GOA:D8JKX4"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKX4"
FT                   /protein_id="ADI89014.1"
FT                   DQYLEQYR"
FT   gene            126911..127426
FT                   /locus_tag="AOLE_00560"
FT   CDS_pept        126911..127426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00560"
FT                   /product="disulfide bond formation protein"
FT                   /note="COG1495 Disulfide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89015"
FT                   /db_xref="GOA:D8JKX5"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKX5"
FT                   /protein_id="ADI89015.1"
FT                   PVFKTAKK"
FT   gene            127592..130468
FT                   /locus_tag="AOLE_00565"
FT   CDS_pept        127592..130468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00565"
FT                   /product="hypothetical protein"
FT                   /note="COG3501 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89016"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKX6"
FT                   /protein_id="ADI89016.1"
FT   gene            130472..132067
FT                   /locus_tag="AOLE_00570"
FT   CDS_pept        130472..132067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89017"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031922"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKX7"
FT                   /protein_id="ADI89017.1"
FT                   ANIFEKGLKCACYE"
FT   gene            132060..132419
FT                   /locus_tag="AOLE_00575"
FT   CDS_pept        132060..132419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00575"
FT                   /product="hypothetical protein"
FT                   /note="COG3755 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89018"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKX8"
FT                   /protein_id="ADI89018.1"
FT                   QTEMTKERIYFLKKY"
FT   gene            132458..132997
FT                   /locus_tag="AOLE_00580"
FT   CDS_pept        132458..132997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89019"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKX9"
FT                   /protein_id="ADI89019.1"
FT                   KYKTISEIKKWLDKNY"
FT   gene            complement(133057..134400)
FT                   /locus_tag="AOLE_00585"
FT   CDS_pept        complement(133057..134400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00585"
FT                   /product="hypothetical protein"
FT                   /note="COG1075 Predicted acetyltransferases and hydrolases
FT                   with the alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89020"
FT                   /db_xref="GOA:D8JKY0"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKY0"
FT                   /protein_id="ADI89020.1"
FT   gene            134611..135192
FT                   /locus_tag="AOLE_00590"
FT   CDS_pept        134611..135192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00590"
FT                   /product="putative esterase"
FT                   /note="COG3150 Predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89021"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKY1"
FT                   /protein_id="ADI89021.1"
FT   gene            135207..137090
FT                   /locus_tag="AOLE_00595"
FT   CDS_pept        135207..137090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00595"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /note="COG0187 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89022"
FT                   /db_xref="GOA:D8JKY2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKY2"
FT                   /protein_id="ADI89022.1"
FT   gene            complement(137212..137715)
FT                   /locus_tag="AOLE_00600"
FT   CDS_pept        complement(137212..137715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00600"
FT                   /product="ureidoglycolate hydrolase"
FT                   /EC_number=""
FT                   /note="COG3194 Ureidoglycolate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89023"
FT                   /db_xref="GOA:D8JKY3"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKY3"
FT                   /protein_id="ADI89023.1"
FT                   KITT"
FT   gene            complement(137712..138722)
FT                   /locus_tag="AOLE_00605"
FT   CDS_pept        complement(137712..138722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00605"
FT                   /product="allantoicase"
FT                   /EC_number=""
FT                   /note="COG4266 Allantoicase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89024"
FT                   /db_xref="GOA:D8JKY4"
FT                   /db_xref="InterPro:IPR005164"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015908"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKY4"
FT                   /protein_id="ADI89024.1"
FT   gene            138922..140079
FT                   /locus_tag="AOLE_00610"
FT   CDS_pept        138922..140079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00610"
FT                   /product="FAD binding domain protein"
FT                   /note="COG0654 2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89025"
FT                   /db_xref="GOA:D8JKY5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKY5"
FT                   /protein_id="ADI89025.1"
FT   gene            complement(140132..140857)
FT                   /locus_tag="AOLE_00615"
FT   CDS_pept        complement(140132..140857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00615"
FT                   /product="nucleoside-binding outer membrane protein"
FT                   /note="COG3248 Nucleoside-binding outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89026"
FT                   /db_xref="GOA:D8JKY6"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKY6"
FT                   /protein_id="ADI89026.1"
FT   gene            complement(140979..142346)
FT                   /locus_tag="AOLE_00620"
FT   CDS_pept        complement(140979..142346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00620"
FT                   /product="xanthine/uracil permease"
FT                   /note="COG2233 Xanthine/uracil permeases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89027"
FT                   /db_xref="GOA:D8JKY7"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKY7"
FT                   /protein_id="ADI89027.1"
FT   gene            complement(142371..142694)
FT                   /locus_tag="AOLE_00625"
FT   CDS_pept        complement(142371..142694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00625"
FT                   /product="hydroxyisourate hydrolase"
FT                   /note="COG2351 Transthyretin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89028"
FT                   /db_xref="GOA:D8JKY8"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023418"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKY8"
FT                   /protein_id="ADI89028.1"
FT                   RGS"
FT   gene            complement(142691..143194)
FT                   /locus_tag="AOLE_00630"
FT   CDS_pept        complement(142691..143194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00630"
FT                   /product="putative OHCU decarboxylase"
FT                   /note="COG3195 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89029"
FT                   /db_xref="InterPro:IPR017595"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKY9"
FT                   /protein_id="ADI89029.1"
FT                   EIQA"
FT   gene            complement(143295..144260)
FT                   /locus_tag="AOLE_00635"
FT   CDS_pept        complement(143295..144260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00635"
FT                   /product="putative polysaccharide deacetylase"
FT                   /note="COG0726 Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89030"
FT                   /db_xref="GOA:D8JKZ0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR017625"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKZ0"
FT                   /protein_id="ADI89030.1"
FT   gene            144513..144863
FT                   /locus_tag="AOLE_00640"
FT   CDS_pept        144513..144863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89031"
FT                   /db_xref="GOA:D8JKZ1"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKZ1"
FT                   /protein_id="ADI89031.1"
FT                   RGGQPEFIDDEV"
FT   gene            145017..145562
FT                   /locus_tag="AOLE_00645"
FT   CDS_pept        145017..145562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00645"
FT                   /product="hypothetical protein"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89032"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKZ2"
FT                   /protein_id="ADI89032.1"
FT                   TLELLRRHGAKMTKELTT"
FT   gene            145563..146342
FT                   /locus_tag="AOLE_00650"
FT   CDS_pept        145563..146342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89033"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKZ3"
FT                   /protein_id="ADI89033.1"
FT   gene            146361..148187
FT                   /locus_tag="AOLE_00655"
FT   CDS_pept        146361..148187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00655"
FT                   /product="thiol:disulfide interchange protein DsbD"
FT                   /note="COG4232 Thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00655"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89034"
FT                   /db_xref="GOA:D8JKZ4"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:D8JKZ4"
FT                   /protein_id="ADI89034.1"
FT   gene            complement(148182..149264)
FT                   /locus_tag="AOLE_00660"
FT   CDS_pept        complement(148182..149264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00660"
FT                   /product="GGDEF domain-containing protein"
FT                   /note="COG2199 FOG: GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89035"
FT                   /db_xref="GOA:D8JLD1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLD1"
FT                   /protein_id="ADI89035.1"
FT   gene            complement(149550..150461)
FT                   /locus_tag="AOLE_00665"
FT   CDS_pept        complement(149550..150461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00665"
FT                   /product="esterase / lipase"
FT                   /note="COG0657 Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00665"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89036"
FT                   /db_xref="GOA:D8JLD2"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLD2"
FT                   /protein_id="ADI89036.1"
FT   gene            150614..151051
FT                   /locus_tag="AOLE_00670"
FT   CDS_pept        150614..151051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00670"
FT                   /product="hypothetical protein"
FT                   /note="COG4731 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89037"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLD3"
FT                   /protein_id="ADI89037.1"
FT   gene            complement(151091..151441)
FT                   /locus_tag="AOLE_00675"
FT   CDS_pept        complement(151091..151441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00675"
FT                   /product="hypothetical protein"
FT                   /note="COG1393 Arsenate reductase and related proteins,
FT                   glutaredoxin family"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00675"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89038"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLD4"
FT                   /protein_id="ADI89038.1"
FT                   GFDESTYQNIQA"
FT   gene            complement(151897..152721)
FT                   /locus_tag="AOLE_00680"
FT   CDS_pept        complement(151897..152721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00680"
FT                   /product="catabolite repression control protein"
FT                   /note="COG0708 Exonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89039"
FT                   /db_xref="GOA:D8JLD5"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLD5"
FT                   /protein_id="ADI89039.1"
FT   gene            152760..153410
FT                   /gene="pyrE"
FT                   /locus_tag="AOLE_00685"
FT   CDS_pept        152760..153410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="AOLE_00685"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="COG0461 Orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00685"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89040"
FT                   /db_xref="GOA:D8JLD6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLD6"
FT                   /protein_id="ADI89040.1"
FT   gene            complement(153461..155584)
FT                   /locus_tag="AOLE_00690"
FT   CDS_pept        complement(153461..155584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00690"
FT                   /product="putative ferric siderophore receptor protein"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89041"
FT                   /db_xref="GOA:D8JLD7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLD7"
FT                   /protein_id="ADI89041.1"
FT                   TPRNVLLRLNYQF"
FT   gene            complement(155880..156092)
FT                   /locus_tag="AOLE_00695"
FT   CDS_pept        complement(155880..156092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00695"
FT                   /product="hypothetical protein"
FT                   /note="COG5515 Uncharacterized conserved small protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00695"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89042"
FT                   /db_xref="InterPro:IPR013619"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLD8"
FT                   /protein_id="ADI89042.1"
FT   gene            156253..157197
FT                   /locus_tag="AOLE_00700"
FT   CDS_pept        156253..157197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00700"
FT                   /product="glutathione synthetase"
FT                   /EC_number=""
FT                   /note="COG0189 Glutathione synthase/Ribosomal protein S6
FT                   modification enzyme (glutaminyl transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89043"
FT                   /db_xref="GOA:D8JLD9"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLD9"
FT                   /protein_id="ADI89043.1"
FT   gene            157435..158532
FT                   /gene="murG"
FT                   /locus_tag="AOLE_00705"
FT   CDS_pept        157435..158532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="AOLE_00705"
FT                   /product="undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /EC_number=""
FT                   /note="COG0707 UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00705"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89044"
FT                   /db_xref="GOA:D8JLE0"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLE0"
FT                   /protein_id="ADI89044.1"
FT   gene            158544..159992
FT                   /gene="murC"
FT                   /locus_tag="AOLE_00710"
FT   CDS_pept        158544..159992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="AOLE_00710"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number=""
FT                   /note="COG0773 UDP-N-acetylmuramate-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89045"
FT                   /db_xref="GOA:D8JLE1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLE1"
FT                   /protein_id="ADI89045.1"
FT   gene            160029..160955
FT                   /gene="ddl"
FT                   /locus_tag="AOLE_00715"
FT   CDS_pept        160029..160955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="AOLE_00715"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number=""
FT                   /note="COG1181 D-alanine-D-alanine ligase and related
FT                   ATP-grasp enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00715"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89046"
FT                   /db_xref="GOA:D8JLE2"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLE2"
FT                   /protein_id="ADI89046.1"
FT   gene            160958..161812
FT                   /locus_tag="AOLE_00720"
FT   CDS_pept        160958..161812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00720"
FT                   /product="cell division protein"
FT                   /note="COG1589 Cell division septal protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89047"
FT                   /db_xref="GOA:D8JLE3"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/Swiss-Prot:D8JLE3"
FT                   /protein_id="ADI89047.1"
FT                   AKP"
FT   gene            161873..163135
FT                   /locus_tag="AOLE_00725"
FT   CDS_pept        161873..163135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00725"
FT                   /product="cell division protein FtsA"
FT                   /note="COG0849 Actin-like ATPase involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00725"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89048"
FT                   /db_xref="GOA:D8JLE4"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLE4"
FT                   /protein_id="ADI89048.1"
FT   gene            163300..164475
FT                   /locus_tag="AOLE_00730"
FT   CDS_pept        163300..164475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00730"
FT                   /product="cell division protein FtsZ"
FT                   /note="COG0206 Cell division GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89049"
FT                   /db_xref="GOA:D8JLE5"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLE5"
FT                   /protein_id="ADI89049.1"
FT   gene            164586..165488
FT                   /gene="lpxC"
FT                   /locus_tag="AOLE_00735"
FT   CDS_pept        164586..165488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="AOLE_00735"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="COG0774 UDP-3-O-acyl-N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00735"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89050"
FT                   /db_xref="GOA:D8JLE6"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLE6"
FT                   /protein_id="ADI89050.1"
FT   gene            complement(165586..166026)
FT                   /locus_tag="AOLE_00740"
FT   CDS_pept        complement(165586..166026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89051"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLE7"
FT                   /protein_id="ADI89051.1"
FT   gene            166134..166826
FT                   /locus_tag="AOLE_00745"
FT   CDS_pept        166134..166826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00745"
FT                   /product="Peptidase family M23 family protein"
FT                   /note="COG0739 Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00745"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89052"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLE8"
FT                   /protein_id="ADI89052.1"
FT                   TTYLAMLP"
FT   gene            167076..169793
FT                   /gene="aceE"
FT                   /locus_tag="AOLE_00750"
FT   CDS_pept        167076..169793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="AOLE_00750"
FT                   /product="pyruvate dehydrogenase subunit E1"
FT                   /note="COG2609 Pyruvate dehydrogenase complex,
FT                   dehydrogenase (E1) component"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89053"
FT                   /db_xref="GOA:D8JLE9"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLE9"
FT                   /protein_id="ADI89053.1"
FT   gene            169796..171763
FT                   /locus_tag="AOLE_00755"
FT   CDS_pept        169796..171763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00755"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dihydrolipoamide acyltransferase (E2) component"
FT                   /note="COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase (E2) component,
FT                   and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00755"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89054"
FT                   /db_xref="GOA:D8JLF0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLF0"
FT                   /protein_id="ADI89054.1"
FT   gene            171909..172187
FT                   /locus_tag="AOLE_00760"
FT   CDS_pept        171909..172187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89055"
FT                   /db_xref="GOA:D8JLF1"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLF1"
FT                   /protein_id="ADI89055.1"
FT   gene            172417..172992
FT                   /locus_tag="AOLE_00765"
FT   CDS_pept        172417..172992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00765"
FT                   /product="hypothetical protein"
FT                   /note="COG2119 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00765"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89056"
FT                   /db_xref="GOA:D8JLF2"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLF2"
FT                   /protein_id="ADI89056.1"
FT   gene            complement(173053..175191)
FT                   /locus_tag="AOLE_00770"
FT   CDS_pept        complement(173053..175191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00770"
FT                   /product="Ferrichrysobactin receptor precursor"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00770"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89057"
FT                   /db_xref="GOA:D8JLF3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLF3"
FT                   /protein_id="ADI89057.1"
FT                   LVTLGNPRQINFTVKFNY"
FT   gene            175419..176216
FT                   /locus_tag="AOLE_00775"
FT   CDS_pept        175419..176216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00775"
FT                   /product="Metallo-beta-lactamase superfamily protein"
FT                   /note="COG0426 Uncharacterized flavoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00775"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89058"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLF4"
FT                   /protein_id="ADI89058.1"
FT   gene            176411..177877
FT                   /locus_tag="AOLE_00780"
FT   CDS_pept        176411..177877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00780"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /note="COG0516 IMP dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00780"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89059"
FT                   /db_xref="GOA:D8JLF5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLF5"
FT                   /protein_id="ADI89059.1"
FT   gene            178026..179363
FT                   /gene="glmM"
FT                   /locus_tag="AOLE_00785"
FT   CDS_pept        178026..179363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="AOLE_00785"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number=""
FT                   /note="COG1109 Phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00785"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89060"
FT                   /db_xref="GOA:D8JLF6"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLF6"
FT                   /protein_id="ADI89060.1"
FT   gene            179374..180030
FT                   /locus_tag="AOLE_00790"
FT   CDS_pept        179374..180030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00790"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /note="COG0259 Pyridoxamine-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89061"
FT                   /db_xref="GOA:D8JLF7"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLF7"
FT                   /protein_id="ADI89061.1"
FT   gene            180031..181731
FT                   /locus_tag="AOLE_00795"
FT   CDS_pept        180031..181731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00795"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /note="COG0608 Single-stranded DNA-specific exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00795"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89062"
FT                   /db_xref="GOA:D8JLF8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLF8"
FT                   /protein_id="ADI89062.1"
FT   gene            complement(181780..182547)
FT                   /locus_tag="AOLE_00800"
FT   CDS_pept        complement(181780..182547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00800"
FT                   /product="putative porin"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89063"
FT                   /db_xref="InterPro:IPR031593"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLF9"
FT                   /protein_id="ADI89063.1"
FT   gene            183103..184035
FT                   /locus_tag="AOLE_00805"
FT   CDS_pept        183103..184035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00805"
FT                   /product="peptide chain release factor 2"
FT                   /note="COG1186 Protein chain release factor B"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00805"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89064"
FT                   /db_xref="GOA:D8JLG0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLG0"
FT                   /protein_id="ADI89064.1"
FT   gene            184257..184559
FT                   /locus_tag="AOLE_00810"
FT   CDS_pept        184257..184559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00810"
FT                   /product="hypothetical protein"
FT                   /note="COG0640 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00810"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89065"
FT                   /db_xref="GOA:D8JLG1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLG1"
FT                   /protein_id="ADI89065.1"
FT   gene            184587..185645
FT                   /locus_tag="AOLE_00815"
FT   CDS_pept        184587..185645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00815"
FT                   /product="xenobiotic reductase"
FT                   /note="COG1902 NADH:flavin oxidoreductases, Old Yellow
FT                   Enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00815"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89066"
FT                   /db_xref="GOA:D8JLG2"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLG2"
FT                   /protein_id="ADI89066.1"
FT                   EGYTDYPTLEAS"
FT   gene            185802..187094
FT                   /locus_tag="AOLE_00820"
FT   CDS_pept        185802..187094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00820"
FT                   /product="3-deoxy-D-manno-2-octulosonate transferase"
FT                   /note="COG1519 3-deoxy-D-manno-octulosonic-acid
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89067"
FT                   /db_xref="GOA:D8JLG3"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLG3"
FT                   /protein_id="ADI89067.1"
FT   gene            187091..187798
FT                   /locus_tag="AOLE_00825"
FT   CDS_pept        187091..187798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00825"
FT                   /product="16S ribosomal RNA methyltransferase RsmE"
FT                   /note="COG1385 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00825"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89068"
FT                   /db_xref="GOA:D8JLG4"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLG4"
FT                   /protein_id="ADI89068.1"
FT                   ETSISYILGRLFS"
FT   gene            complement(187787..188758)
FT                   /locus_tag="AOLE_00830"
FT   CDS_pept        complement(187787..188758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00830"
FT                   /product="small-conductance mechanosensitive channel"
FT                   /note="COG0668 Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89069"
FT                   /db_xref="GOA:D8JLG5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLG5"
FT                   /protein_id="ADI89069.1"
FT   gene            complement(188872..189447)
FT                   /locus_tag="AOLE_00835"
FT   CDS_pept        complement(188872..189447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00835"
FT                   /product="hypothetical protein"
FT                   /note="COG3152 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00835"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89070"
FT                   /db_xref="GOA:D8JLG6"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLG6"
FT                   /protein_id="ADI89070.1"
FT   gene            189742..191691
FT                   /locus_tag="AOLE_00840"
FT   CDS_pept        189742..191691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00840"
FT                   /product="acetate--CoA ligase"
FT                   /note="COG0365 Acyl-coenzyme A synthetases/AMP-(fatty) acid
FT                   ligases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00840"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89071"
FT                   /db_xref="GOA:D8JLG7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLG7"
FT                   /protein_id="ADI89071.1"
FT                   VDQLIATVYPDKQN"
FT   gene            complement(191739..192281)
FT                   /locus_tag="AOLE_00845"
FT   CDS_pept        complement(191739..192281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00845"
FT                   /product="putative isochorismatase"
FT                   /note="COG1335 Amidases related to nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00845"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89072"
FT                   /db_xref="GOA:D8JLG8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLG8"
FT                   /protein_id="ADI89072.1"
FT                   LSTFANVQNTADFLVNS"
FT   gene            192387..192800
FT                   /locus_tag="AOLE_00850"
FT   CDS_pept        192387..192800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00850"
FT                   /product="HTH-type transcriptional regulator lrpB"
FT                   /note="COG1522 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89073"
FT                   /db_xref="GOA:D8JLG9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLG9"
FT                   /protein_id="ADI89073.1"
FT   gene            complement(192894..194006)
FT                   /locus_tag="AOLE_00855"
FT   CDS_pept        complement(192894..194006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00855"
FT                   /product="putative sulfonate monooxygenase (MsuD)"
FT                   /note="COG2141 Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00855"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89074"
FT                   /db_xref="GOA:D8JLH0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR024014"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLH0"
FT                   /protein_id="ADI89074.1"
FT   gene            complement(194050..194790)
FT                   /locus_tag="AOLE_00860"
FT   CDS_pept        complement(194050..194790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00860"
FT                   /product="FMN reductase"
FT                   /note="COG0431 Predicted flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00860"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89075"
FT                   /db_xref="GOA:D8JLH1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR019912"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLH1"
FT                   /protein_id="ADI89075.1"
FT   gene            195167..195817
FT                   /locus_tag="AOLE_00865"
FT   CDS_pept        195167..195817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00865"
FT                   /product="Glycerol metabolism activator (Protein agmR)"
FT                   /note="COG2197 Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00865"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89076"
FT                   /db_xref="GOA:D8JLH2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLH2"
FT                   /protein_id="ADI89076.1"
FT   gene            complement(195861..196628)
FT                   /locus_tag="AOLE_00870"
FT   CDS_pept        complement(195861..196628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00870"
FT                   /product="hypothetical protein"
FT                   /note="COG2233 Xanthine/uracil permeases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00870"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89077"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLH3"
FT                   /protein_id="ADI89077.1"
FT   gene            complement(197019..200516)
FT                   /locus_tag="AOLE_00875"
FT   CDS_pept        complement(197019..200516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00875"
FT                   /product="Na+/proline symporter"
FT                   /note="COG0591 Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00875"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89078"
FT                   /db_xref="GOA:D8JLH4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLH4"
FT                   /protein_id="ADI89078.1"
FT   gene            200698..201030
FT                   /locus_tag="AOLE_00880"
FT   CDS_pept        200698..201030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00880"
FT                   /product="hypothetical protein"
FT                   /note="COG3162 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00880"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89079"
FT                   /db_xref="GOA:D8JLH5"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLH5"
FT                   /protein_id="ADI89079.1"
FT                   HEKGLH"
FT   gene            201032..202747
FT                   /gene="actP"
FT                   /locus_tag="AOLE_00885"
FT   CDS_pept        201032..202747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actP"
FT                   /locus_tag="AOLE_00885"
FT                   /product="acetate permease"
FT                   /note="COG4147 Predicted symporter"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00885"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89080"
FT                   /db_xref="GOA:D8JLH6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLH6"
FT                   /protein_id="ADI89080.1"
FT   gene            202919..203611
FT                   /locus_tag="AOLE_00890"
FT   CDS_pept        202919..203611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00890"
FT                   /product="hypothetical protein"
FT                   /note="COG1226 Kef-type K+ transport systems, predicted
FT                   NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00890"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89081"
FT                   /db_xref="GOA:D8JLH7"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLH7"
FT                   /protein_id="ADI89081.1"
FT                   LPKKNSDK"
FT   gene            203779..205746
FT                   /locus_tag="AOLE_00895"
FT   CDS_pept        203779..205746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00895"
FT                   /product="High-affinity choline transport protein"
FT                   /note="COG1292 Choline-glycine betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00895"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89082"
FT                   /db_xref="GOA:D8JLH8"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLH8"
FT                   /protein_id="ADI89082.1"
FT   gene            complement(205807..206712)
FT                   /locus_tag="AOLE_00900"
FT   CDS_pept        complement(205807..206712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00900"
FT                   /product="34 kDa outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89083"
FT                   /db_xref="InterPro:IPR031593"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLH9"
FT                   /protein_id="ADI89083.1"
FT   gene            207719..209428
FT                   /locus_tag="AOLE_00905"
FT   CDS_pept        207719..209428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00905"
FT                   /product="putative GGDEF family protein"
FT                   /note="COG2199 FOG: GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00905"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89084"
FT                   /db_xref="GOA:D8JLI0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLI0"
FT                   /protein_id="ADI89084.1"
FT   gene            complement(209466..212297)
FT                   /locus_tag="AOLE_00910"
FT   CDS_pept        complement(209466..212297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00910"
FT                   /product="excinuclease ABC subunit A"
FT                   /note="COG0178 Excinuclease ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89085"
FT                   /db_xref="GOA:D8JLI1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLI1"
FT                   /protein_id="ADI89085.1"
FT                   ISHTGRFLKPMLK"
FT   gene            212595..213197
FT                   /locus_tag="AOLE_00915"
FT   CDS_pept        212595..213197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00915"
FT                   /product="TetR family regulatory protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00915"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89086"
FT                   /db_xref="GOA:D8JLI2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLI2"
FT                   /protein_id="ADI89086.1"
FT   gene            213201..214178
FT                   /locus_tag="AOLE_00920"
FT   CDS_pept        213201..214178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00920"
FT                   /product="NADPH:quinone reductase"
FT                   /note="COG0604 NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00920"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89087"
FT                   /db_xref="GOA:D8JLI3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLI3"
FT                   /protein_id="ADI89087.1"
FT   gene            214244..214597
FT                   /locus_tag="AOLE_00925"
FT   CDS_pept        214244..214597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00925"
FT                   /product="hypothetical protein"
FT                   /note="COG3759 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00925"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89088"
FT                   /db_xref="GOA:D8JLI4"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLI4"
FT                   /protein_id="ADI89088.1"
FT                   VPAIIALVAVNFL"
FT   gene            214649..214990
FT                   /locus_tag="AOLE_00930"
FT   CDS_pept        214649..214990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00930"
FT                   /product="GlpM family protein"
FT                   /note="COG3136 Uncharacterized membrane protein required
FT                   for alginate biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00930"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89089"
FT                   /db_xref="GOA:D8JLI5"
FT                   /db_xref="InterPro:IPR009707"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLI5"
FT                   /protein_id="ADI89089.1"
FT                   IYGWQLFQH"
FT   gene            complement(215033..215839)
FT                   /locus_tag="AOLE_00935"
FT   CDS_pept        complement(215033..215839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00935"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COG0300 Short-chain dehydrogenases of various
FT                   substrate specificities"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00935"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89090"
FT                   /db_xref="GOA:D8JLI6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLI6"
FT                   /protein_id="ADI89090.1"
FT   gene            complement(215943..216314)
FT                   /locus_tag="AOLE_00940"
FT   CDS_pept        complement(215943..216314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00940"
FT                   /product="MerR family transcriptional regulator"
FT                   /note="COG0789 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89091"
FT                   /db_xref="GOA:D8JLI7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLI7"
FT                   /protein_id="ADI89091.1"
FT   gene            complement(216380..217054)
FT                   /locus_tag="AOLE_00945"
FT   CDS_pept        complement(216380..217054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00945"
FT                   /product="Thiaminase-2(Thiaminase II) (Transcriptional
FT                   activatortenA)"
FT                   /note="COG0819 Putative transcription activator"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00945"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89092"
FT                   /db_xref="GOA:D8JLI8"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLI8"
FT                   /protein_id="ADI89092.1"
FT                   HI"
FT   gene            217317..218399
FT                   /locus_tag="AOLE_00950"
FT   CDS_pept        217317..218399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00950"
FT                   /product="hypothetical protein"
FT                   /note="COG2899 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00950"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89093"
FT                   /db_xref="GOA:D8JLI9"
FT                   /db_xref="InterPro:IPR007427"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLI9"
FT                   /protein_id="ADI89093.1"
FT   gene            218550..219911
FT                   /locus_tag="AOLE_00955"
FT   CDS_pept        218550..219911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00955"
FT                   /product="MFS family transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00955"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89094"
FT                   /db_xref="GOA:D8JLJ0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLJ0"
FT                   /protein_id="ADI89094.1"
FT   gene            219963..220553
FT                   /locus_tag="AOLE_00960"
FT   CDS_pept        219963..220553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00960"
FT                   /product="ssDNA-binding protein controls activity of RecBCD
FT                   nuclease"
FT                   /note="COG0629 Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00960"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89095"
FT                   /db_xref="GOA:D8JLJ1"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLJ1"
FT                   /protein_id="ADI89095.1"
FT   gene            complement(220595..220918)
FT                   /locus_tag="AOLE_00965"
FT   CDS_pept        complement(220595..220918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00965"
FT                   /product="Branched-chain amino acid transport protein
FT                   (AzlD) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00965"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89096"
FT                   /db_xref="GOA:D8JLJ2"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLJ2"
FT                   /protein_id="ADI89096.1"
FT                   GIE"
FT   gene            complement(220915..221583)
FT                   /locus_tag="AOLE_00970"
FT   CDS_pept        complement(220915..221583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00970"
FT                   /product="hypothetical protein"
FT                   /note="COG1296 Predicted branched-chain amino acid permease
FT                   (azaleucine resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89097"
FT                   /db_xref="GOA:D8JLJ3"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLJ3"
FT                   /protein_id="ADI89097.1"
FT                   "
FT   gene            221679..222227
FT                   /locus_tag="AOLE_00975"
FT   CDS_pept        221679..222227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00975"
FT                   /product="Helix-turn-helix family protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00975"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89098"
FT                   /db_xref="GOA:D8JLJ4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLJ4"
FT                   /protein_id="ADI89098.1"
FT   gene            222554..223996
FT                   /locus_tag="AOLE_00980"
FT   CDS_pept        222554..223996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00980"
FT                   /product="gamma-aminobutyrate permease"
FT                   /note="COG1113 Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89099"
FT                   /db_xref="GOA:D8JLJ5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLJ5"
FT                   /protein_id="ADI89099.1"
FT   gene            complement(224062..225561)
FT                   /locus_tag="AOLE_00985"
FT   CDS_pept        complement(224062..225561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00985"
FT                   /product="transcriptional regulator"
FT                   /note="COG1167 Transcriptional regulators containing a
FT                   DNA-binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00985"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89100"
FT                   /db_xref="GOA:D8JLJ6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLJ6"
FT                   /protein_id="ADI89100.1"
FT   gene            225717..227009
FT                   /locus_tag="AOLE_00990"
FT   CDS_pept        225717..227009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00990"
FT                   /product="4-aminobutyrate transaminase"
FT                   /note="COG0160 4-aminobutyrate aminotransferase and related
FT                   aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89101"
FT                   /db_xref="GOA:D8JLJ7"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLJ7"
FT                   /protein_id="ADI89101.1"
FT   gene            227006..228454
FT                   /locus_tag="AOLE_00995"
FT   CDS_pept        227006..228454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_00995"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_00995"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89102"
FT                   /db_xref="GOA:D8JLJ8"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLJ8"
FT                   /protein_id="ADI89102.1"
FT   gene            complement(228558..229532)
FT                   /locus_tag="AOLE_01000"
FT   CDS_pept        complement(228558..229532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01000"
FT                   /product="LysR substrate binding domain protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01000"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89103"
FT                   /db_xref="GOA:D8JLJ9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLJ9"
FT                   /protein_id="ADI89103.1"
FT   gene            complement(229553..230179)
FT                   /locus_tag="AOLE_01005"
FT   CDS_pept        complement(229553..230179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01005"
FT                   /product="Isochorismatase family protein"
FT                   /note="COG1335 Amidases related to nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01005"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89104"
FT                   /db_xref="GOA:D8JLK0"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLK0"
FT                   /protein_id="ADI89104.1"
FT   gene            230457..231329
FT                   /locus_tag="AOLE_01010"
FT   CDS_pept        230457..231329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01010"
FT                   /product="hypothetical protein"
FT                   /note="COG1741 Pirin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89105"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLK1"
FT                   /protein_id="ADI89105.1"
FT                   KFGSIMQEG"
FT   gene            231729..233066
FT                   /locus_tag="AOLE_01015"
FT   CDS_pept        231729..233066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01015"
FT                   /product="hypothetical protein"
FT                   /note="COG2907 Predicted NAD/FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01015"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89106"
FT                   /db_xref="GOA:D8JLK2"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLK2"
FT                   /protein_id="ADI89106.1"
FT   gene            233071..233904
FT                   /locus_tag="AOLE_01020"
FT   CDS_pept        233071..233904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01020"
FT                   /product="putative methyltransferase"
FT                   /note="COG2230 Cyclopropane fatty acid synthase and related
FT                   methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89107"
FT                   /db_xref="GOA:D8JLK3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLK3"
FT                   /protein_id="ADI89107.1"
FT   gene            233908..234330
FT                   /locus_tag="AOLE_01025"
FT   CDS_pept        233908..234330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01025"
FT                   /product="Glutathione-dependent formaldehyde-activating
FT                   enzyme family protein"
FT                   /note="COG3791 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01025"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89108"
FT                   /db_xref="GOA:D8JLK4"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLK4"
FT                   /protein_id="ADI89108.1"
FT   gene            complement(234866..235249)
FT                   /locus_tag="AOLE_01030"
FT   CDS_pept        complement(234866..235249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01030"
FT                   /product="putative peptide signal"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01030"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89109"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLK5"
FT                   /protein_id="ADI89109.1"
FT   gene            complement(235729..235804)
FT                   /locus_tag="AOLE_t19486"
FT   tRNA            complement(235729..235804)
FT                   /locus_tag="AOLE_t19486"
FT                   /product="tRNA-Thr"
FT   gene            complement(235916..236242)
FT                   /locus_tag="AOLE_01035"
FT   CDS_pept        complement(235916..236242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01035"
FT                   /product="hypothetical protein"
FT                   /note="COG2105 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01035"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89110"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLK6"
FT                   /protein_id="ADI89110.1"
FT                   VLKS"
FT   gene            complement(236266..237510)
FT                   /locus_tag="AOLE_01040"
FT   CDS_pept        complement(236266..237510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01040"
FT                   /product="MFS family transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01040"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89111"
FT                   /db_xref="GOA:D8JLK7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLK7"
FT                   /protein_id="ADI89111.1"
FT                   LGIFLVVYTSHAKAH"
FT   gene            237651..238550
FT                   /locus_tag="AOLE_01045"
FT   CDS_pept        237651..238550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01045"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01045"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89112"
FT                   /db_xref="GOA:D8JLK8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037410"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLK8"
FT                   /protein_id="ADI89112.1"
FT                   SQMAINFASVVQDILHFN"
FT   gene            239383..240345
FT                   /locus_tag="AOLE_01050"
FT   CDS_pept        239383..240345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01050"
FT                   /product="Pyoverdine biosynthesis protein"
FT                   /note="COG3207 Pyoverdine/dityrosine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01050"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89113"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLK9"
FT                   /protein_id="ADI89113.1"
FT   gene            240379..241173
FT                   /locus_tag="AOLE_01055"
FT   CDS_pept        240379..241173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01055"
FT                   /product="pyoverdine biosynthesis protein"
FT                   /note="COG2175 Probable taurine catabolism dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01055"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89114"
FT                   /db_xref="GOA:D8JLL0"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLL0"
FT                   /protein_id="ADI89114.1"
FT   gene            complement(241689..244733)
FT                   /locus_tag="AOLE_01060"
FT   CDS_pept        complement(241689..244733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01060"
FT                   /product="acriflavin resistance protein"
FT                   /note="COG0841 Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89115"
FT                   /db_xref="GOA:D8JLL1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLL1"
FT                   /protein_id="ADI89115.1"
FT   gene            complement(244730..245857)
FT                   /locus_tag="AOLE_01065"
FT   CDS_pept        complement(244730..245857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01065"
FT                   /product="cation/multidrug efflux system, mebrane-fusion
FT                   component"
FT                   /note="COG0845 Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01065"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89116"
FT                   /db_xref="GOA:D8JLL2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLL2"
FT                   /protein_id="ADI89116.1"
FT   gene            245990..246607
FT                   /locus_tag="AOLE_01070"
FT   CDS_pept        245990..246607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01070"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89117"
FT                   /db_xref="GOA:D8JLL3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLL3"
FT                   /protein_id="ADI89117.1"
FT   gene            complement(246730..247614)
FT                   /locus_tag="AOLE_01075"
FT   CDS_pept        complement(246730..247614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01075"
FT                   /product="DMT family permease"
FT                   /note="COG0697 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01075"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89118"
FT                   /db_xref="GOA:D8JLL4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLL4"
FT                   /protein_id="ADI89118.1"
FT                   ISGIVLINKAPKA"
FT   gene            247966..248646
FT                   /locus_tag="AOLE_01080"
FT   CDS_pept        247966..248646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89119"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLL5"
FT                   /protein_id="ADI89119.1"
FT                   ETLS"
FT   gene            248662..249552
FT                   /locus_tag="AOLE_01085"
FT   CDS_pept        248662..249552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01085"
FT                   /product="oxidoreductase FAD/NAD(P)-binding subunit"
FT                   /note="COG0543 2-polyprenylphenol hydroxylase and related
FT                   flavodoxin oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01085"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89120"
FT                   /db_xref="GOA:D8JLL6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLL6"
FT                   /protein_id="ADI89120.1"
FT                   KILNQPLCELESFGP"
FT   gene            249567..250778
FT                   /locus_tag="AOLE_01090"
FT   CDS_pept        249567..250778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01090"
FT                   /product="phosphoribosylglycinamide synthetase ATP-grasp
FT                   domain-containing protein"
FT                   /note="COG0439 Biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01090"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89121"
FT                   /db_xref="GOA:D8JLL7"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLL7"
FT                   /protein_id="ADI89121.1"
FT                   VKVI"
FT   gene            250775..251971
FT                   /locus_tag="AOLE_01095"
FT   CDS_pept        250775..251971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01095"
FT                   /product="putative biotin carboxylase"
FT                   /note="COG0439 Biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01095"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89122"
FT                   /db_xref="GOA:D8JLL8"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLL8"
FT                   /protein_id="ADI89122.1"
FT   gene            252154..252897
FT                   /locus_tag="AOLE_01100"
FT   CDS_pept        252154..252897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01100"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01100"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89123"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLL9"
FT                   /protein_id="ADI89123.1"
FT   gene            252921..253310
FT                   /locus_tag="AOLE_01105"
FT   CDS_pept        252921..253310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01105"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89124"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLM0"
FT                   /protein_id="ADI89124.1"
FT   gene            complement(253356..254357)
FT                   /locus_tag="AOLE_01110"
FT   CDS_pept        complement(253356..254357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01110"
FT                   /product="oxidoreductase"
FT                   /note="COG0667 Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01110"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89125"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLM1"
FT                   /protein_id="ADI89125.1"
FT   gene            complement(254469..255371)
FT                   /locus_tag="AOLE_01115"
FT   CDS_pept        complement(254469..255371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01115"
FT                   /product="putative transcriptional regulator (AraC-like)
FT                   protein"
FT                   /note="COG2207 AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01115"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89126"
FT                   /db_xref="GOA:D8JLM2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLM2"
FT                   /protein_id="ADI89126.1"
FT   gene            complement(255603..255770)
FT                   /locus_tag="AOLE_01120"
FT   CDS_pept        complement(255603..255770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01120"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89127"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLM3"
FT                   /protein_id="ADI89127.1"
FT                   TRKCPLIALP"
FT   gene            256500..257048
FT                   /locus_tag="AOLE_01125"
FT   CDS_pept        256500..257048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01125"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01125"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89128"
FT                   /db_xref="GOA:D8JLM4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLM4"
FT                   /protein_id="ADI89128.1"
FT   gene            complement(257133..257504)
FT                   /locus_tag="AOLE_01130"
FT   CDS_pept        complement(257133..257504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01130"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89129"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLM5"
FT                   /protein_id="ADI89129.1"
FT   gene            257625..257981
FT                   /locus_tag="AOLE_01135"
FT   CDS_pept        257625..257981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01135"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89130"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLM6"
FT                   /protein_id="ADI89130.1"
FT                   DAEIDKIYSFIVQD"
FT   gene            258026..258907
FT                   /locus_tag="AOLE_01140"
FT   CDS_pept        258026..258907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89131"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLM7"
FT                   /protein_id="ADI89131.1"
FT                   EYIDPDVWPYVK"
FT   gene            complement(258969..259187)
FT                   /locus_tag="AOLE_01145"
FT   CDS_pept        complement(258969..259187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01145"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89132"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLM8"
FT                   /protein_id="ADI89132.1"
FT   gene            complement(259215..259550)
FT                   /locus_tag="AOLE_01150"
FT   CDS_pept        complement(259215..259550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01150"
FT                   /product="HxlR-like helix-turn-helix family protein"
FT                   /note="COG1733 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89133"
FT                   /db_xref="GOA:D8JLM9"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLM9"
FT                   /protein_id="ADI89133.1"
FT                   GERNKSS"
FT   gene            259667..260224
FT                   /locus_tag="AOLE_01155"
FT   CDS_pept        259667..260224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01155"
FT                   /product="General stress protein 14 (GSP14)"
FT                   /note="COG2249 Putative NADPH-quinone reductase (modulator
FT                   of drug activity B)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01155"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89134"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLN0"
FT                   /protein_id="ADI89134.1"
FT   gene            260375..260716
FT                   /locus_tag="AOLE_01160"
FT   CDS_pept        260375..260716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01160"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89135"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLN1"
FT                   /protein_id="ADI89135.1"
FT                   NGAKLLIVD"
FT   gene            complement(260764..261426)
FT                   /locus_tag="AOLE_01165"
FT   CDS_pept        complement(260764..261426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01165"
FT                   /product="isoprenoid biosynthesis protein with
FT                   amidotransferase-like domain"
FT                   /note="COG3155 Uncharacterized protein involved in an early
FT                   stage of isoprenoid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01165"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89136"
FT                   /db_xref="GOA:D8JLN2"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLN2"
FT                   /protein_id="ADI89136.1"
FT   gene            complement(261516..262328)
FT                   /locus_tag="AOLE_01170"
FT   CDS_pept        complement(261516..262328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01170"
FT                   /product="AraC-type DNA-binding domain-containing protein"
FT                   /note="COG2207 AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89137"
FT                   /db_xref="GOA:D8JLN3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLN3"
FT                   /protein_id="ADI89137.1"
FT   gene            complement(262465..262554)
FT                   /locus_tag="AOLE_t19488"
FT   tRNA            complement(262465..262554)
FT                   /locus_tag="AOLE_t19488"
FT                   /product="tRNA-Ser"
FT   gene            262673..264550
FT                   /locus_tag="AOLE_01175"
FT   CDS_pept        262673..264550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01175"
FT                   /product="K+ transporter"
FT                   /note="COG3158 K+ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01175"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89138"
FT                   /db_xref="GOA:D8JLN4"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLN4"
FT                   /protein_id="ADI89138.1"
FT   gene            complement(264607..265047)
FT                   /locus_tag="AOLE_01180"
FT   CDS_pept        complement(264607..265047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01180"
FT                   /product="putative signal peptide-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01180"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89139"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLN5"
FT                   /protein_id="ADI89139.1"
FT   gene            265303..266382
FT                   /locus_tag="AOLE_01185"
FT   CDS_pept        265303..266382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01185"
FT                   /product="Nuclease precursor(Endonuclease)"
FT                   /note="COG1864 DNA/RNA endonuclease G, NUC1"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01185"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89140"
FT                   /db_xref="GOA:D8JLN6"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLN6"
FT                   /protein_id="ADI89140.1"
FT   gene            266480..267079
FT                   /locus_tag="AOLE_01190"
FT   CDS_pept        266480..267079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01190"
FT                   /product="LysE type translocator family protein"
FT                   /note="COG1280 Putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89141"
FT                   /db_xref="GOA:D8JLN7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLN7"
FT                   /protein_id="ADI89141.1"
FT   gene            267125..267367
FT                   /locus_tag="AOLE_01195"
FT   CDS_pept        267125..267367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01195"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89142"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLN8"
FT                   /protein_id="ADI89142.1"
FT   gene            complement(267589..268278)
FT                   /locus_tag="AOLE_01200"
FT   CDS_pept        complement(267589..268278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01200"
FT                   /product="glycerol uptake facilitator"
FT                   /note="COG0580 Glycerol uptake facilitator and related
FT                   permeases (Major Intrinsic Protein Family)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01200"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89143"
FT                   /db_xref="GOA:D8JLN9"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023743"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLN9"
FT                   /protein_id="ADI89143.1"
FT                   VVAGEKD"
FT   gene            complement(268411..269415)
FT                   /locus_tag="AOLE_01205"
FT   CDS_pept        complement(268411..269415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01205"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207 AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01205"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89144"
FT                   /db_xref="GOA:D8JLP0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLP0"
FT                   /protein_id="ADI89144.1"
FT   gene            269525..270163
FT                   /locus_tag="AOLE_01210"
FT   CDS_pept        269525..270163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01210"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89145"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLP1"
FT                   /protein_id="ADI89145.1"
FT   gene            complement(270201..270959)
FT                   /locus_tag="AOLE_01215"
FT   CDS_pept        complement(270201..270959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01215"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="COG0107 Imidazoleglycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01215"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89146"
FT                   /db_xref="GOA:D8JLP2"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLP2"
FT                   /protein_id="ADI89146.1"
FT   gene            271072..272022
FT                   /locus_tag="AOLE_01220"
FT   CDS_pept        271072..272022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01220"
FT                   /product="homoserine kinase"
FT                   /EC_number=""
FT                   /note="COG2334 Putative homoserine kinase type II (protein
FT                   kinase fold)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01220"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89147"
FT                   /db_xref="GOA:D8JLP3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLP3"
FT                   /protein_id="ADI89147.1"
FT   gene            272035..272664
FT                   /locus_tag="AOLE_01225"
FT   CDS_pept        272035..272664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01225"
FT                   /product="hypothetical protein"
FT                   /note="COG1278 Cold shock proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01225"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89148"
FT                   /db_xref="GOA:D8JLP4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLP4"
FT                   /protein_id="ADI89148.1"
FT   gene            272701..273093
FT                   /locus_tag="AOLE_01230"
FT   CDS_pept        272701..273093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01230"
FT                   /product="putative transmembrane protein"
FT                   /note="COG3671 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89149"
FT                   /db_xref="GOA:D8JLP5"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLP5"
FT                   /protein_id="ADI89149.1"
FT   gene            273097..273402
FT                   /locus_tag="AOLE_01235"
FT   CDS_pept        273097..273402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01235"
FT                   /product="putative polyketide synthesis monooxygenase"
FT                   /note="COG2329 Uncharacterized enzyme involved in
FT                   biosynthesis of extracellular polysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01235"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89150"
FT                   /db_xref="GOA:D8JLP6"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLP6"
FT                   /protein_id="ADI89150.1"
FT   gene            complement(273437..274339)
FT                   /locus_tag="AOLE_01240"
FT   CDS_pept        complement(273437..274339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01240"
FT                   /product="DMT family permease"
FT                   /note="COG0697 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01240"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89151"
FT                   /db_xref="GOA:D8JLP7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLP7"
FT                   /protein_id="ADI89151.1"
FT   gene            274359..274499
FT                   /locus_tag="AOLE_01245"
FT   CDS_pept        274359..274499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01245"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89152"
FT                   /db_xref="GOA:D8JLP8"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLP8"
FT                   /protein_id="ADI89152.1"
FT                   R"
FT   gene            274438..274989
FT                   /locus_tag="AOLE_01250"
FT   CDS_pept        274438..274989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01250"
FT                   /product="hypothetical protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01250"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89153"
FT                   /db_xref="GOA:D8JLP9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLP9"
FT                   /protein_id="ADI89153.1"
FT   gene            275129..276865
FT                   /locus_tag="AOLE_01255"
FT   CDS_pept        275129..276865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01255"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG5265 ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease and ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01255"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89154"
FT                   /db_xref="GOA:D8JLQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLQ0"
FT                   /protein_id="ADI89154.1"
FT                   LN"
FT   gene            complement(276922..277653)
FT                   /locus_tag="AOLE_01260"
FT   CDS_pept        complement(276922..277653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01260"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /EC_number=""
FT                   /note="COG0106 Phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribonucleotide (ProFAR) isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01260"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89155"
FT                   /db_xref="GOA:D8JLQ1"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLQ1"
FT                   /protein_id="ADI89155.1"
FT   gene            complement(277748..278389)
FT                   /locus_tag="AOLE_01265"
FT   CDS_pept        complement(277748..278389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01265"
FT                   /product="3'-5' exonuclease"
FT                   /note="COG0749 DNA polymerase I - 3'-5' exonuclease and
FT                   polymerase domains"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01265"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89156"
FT                   /db_xref="GOA:D8JLQ2"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLQ2"
FT                   /protein_id="ADI89156.1"
FT   gene            complement(278476..279024)
FT                   /locus_tag="AOLE_01270"
FT   CDS_pept        complement(278476..279024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01270"
FT                   /product="hypothetical protein"
FT                   /note="COG3152 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89157"
FT                   /db_xref="GOA:D8JLQ3"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLQ3"
FT                   /protein_id="ADI89157.1"
FT   gene            complement(279174..279791)
FT                   /gene="hisH"
FT                   /locus_tag="AOLE_01275"
FT   CDS_pept        complement(279174..279791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="AOLE_01275"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisH"
FT                   /EC_number="2.4.2.-"
FT                   /note="COG0118 Glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01275"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89158"
FT                   /db_xref="GOA:D8JLQ4"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLQ4"
FT                   /protein_id="ADI89158.1"
FT   gene            complement(279791..280384)
FT                   /gene="hisB"
FT                   /locus_tag="AOLE_01280"
FT   CDS_pept        complement(279791..280384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="AOLE_01280"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number=""
FT                   /note="COG0131 Imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01280"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89159"
FT                   /db_xref="GOA:D8JLQ5"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLQ5"
FT                   /protein_id="ADI89159.1"
FT   gene            280487..280870
FT                   /locus_tag="AOLE_01285"
FT   CDS_pept        280487..280870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01285"
FT                   /product="Acetyltransferase (GNAT) family protein"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01285"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89160"
FT                   /db_xref="GOA:D8JLQ6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR040448"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLQ6"
FT                   /protein_id="ADI89160.1"
FT   gene            280976..281051
FT                   /locus_tag="AOLE_t19490"
FT   tRNA            280976..281051
FT                   /locus_tag="AOLE_t19490"
FT                   /product="tRNA-Phe"
FT   gene            281178..281253
FT                   /locus_tag="AOLE_t19492"
FT   tRNA            281178..281253
FT                   /locus_tag="AOLE_t19492"
FT                   /product="tRNA-Phe"
FT   gene            complement(281426..281857)
FT                   /locus_tag="AOLE_01290"
FT   CDS_pept        complement(281426..281857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01290"
FT                   /product="putative acetyltransferase"
FT                   /note="COG0456 Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89161"
FT                   /db_xref="GOA:D8JLQ7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLQ7"
FT                   /protein_id="ADI89161.1"
FT   gene            complement(281987..283501)
FT                   /locus_tag="AOLE_01295"
FT   CDS_pept        complement(281987..283501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01295"
FT                   /product="Succinyl-CoA:coenzyme A transferase"
FT                   /note="COG0427 Acetyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01295"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89162"
FT                   /db_xref="GOA:D8JLQ8"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLQ8"
FT                   /protein_id="ADI89162.1"
FT   gene            complement(283693..285150)
FT                   /locus_tag="AOLE_01300"
FT   CDS_pept        complement(283693..285150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01300"
FT                   /product="two-component system sensory histidine kinase"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89163"
FT                   /db_xref="GOA:D8JLQ9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLQ9"
FT                   /protein_id="ADI89163.1"
FT   gene            complement(285168..285932)
FT                   /gene="ompR"
FT                   /locus_tag="AOLE_01305"
FT   CDS_pept        complement(285168..285932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="AOLE_01305"
FT                   /product="osmolarity response regulator"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01305"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89164"
FT                   /db_xref="GOA:D8JLR0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLR0"
FT                   /protein_id="ADI89164.1"
FT   gene            286599..288947
FT                   /locus_tag="AOLE_01310"
FT   CDS_pept        286599..288947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01310"
FT                   /product="transcriptional accessory protein"
FT                   /note="COG2183 Transcriptional accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01310"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89165"
FT                   /db_xref="GOA:D8JLR1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLR1"
FT                   /protein_id="ADI89165.1"
FT   gene            289245..291431
FT                   /locus_tag="AOLE_01315"
FT   CDS_pept        289245..291431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01315"
FT                   /product="Sulfate transporter family protein"
FT                   /note="COG0659 Sulfate permease and related transporters
FT                   (MFS superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01315"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89166"
FT                   /db_xref="GOA:D8JLR2"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D8JLR2"
FT                   /protein_id="ADI89166.1"
FT   gene            complement(291499..292389)
FT                   /locus_tag="AOLE_01320"
FT   CDS_pept        complement(291499..292389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01320"
FT                   /product="short chain dehydrogenase family protein"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89167"
FT                   /db_xref="GOA:D8JM49"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM49"
FT                   /protein_id="ADI89167.1"
FT                   WAQKAYARIFPGEHW"
FT   gene            complement(292665..293090)
FT                   /locus_tag="AOLE_01325"
FT   CDS_pept        complement(292665..293090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01325"
FT                   /product="hypothetical protein"
FT                   /note="COG1981 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01325"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89168"
FT                   /db_xref="GOA:D8JM50"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM50"
FT                   /protein_id="ADI89168.1"
FT   gene            complement(293087..293422)
FT                   /locus_tag="AOLE_01330"
FT   CDS_pept        complement(293087..293422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89169"
FT                   /db_xref="GOA:D8JM51"
FT                   /db_xref="InterPro:IPR023845"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM51"
FT                   /protein_id="ADI89169.1"
FT                   LDETQSS"
FT   gene            293693..294640
FT                   /locus_tag="AOLE_01335"
FT   CDS_pept        293693..294640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01335"
FT                   /product="EsvA"
FT                   /note="COG4977 Transcriptional regulator containing an
FT                   amidase domain and an AraC-type DNA-binding HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01335"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89170"
FT                   /db_xref="GOA:D8JM52"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM52"
FT                   /protein_id="ADI89170.1"
FT   gene            complement(294763..296040)
FT                   /locus_tag="AOLE_01340"
FT   CDS_pept        complement(294763..296040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01340"
FT                   /product="O-acetylhomoserine sulfhydrylase"
FT                   /note="COG2873 O-acetylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89171"
FT                   /db_xref="GOA:D8JM53"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM53"
FT                   /protein_id="ADI89171.1"
FT   gene            296336..297997
FT                   /locus_tag="AOLE_01345"
FT   CDS_pept        296336..297997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01345"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01345"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89172"
FT                   /db_xref="GOA:D8JM54"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM54"
FT                   /protein_id="ADI89172.1"
FT   gene            complement(298042..298425)
FT                   /locus_tag="AOLE_01350"
FT   CDS_pept        complement(298042..298425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01350"
FT                   /product="hypothetical protein"
FT                   /note="COG0790 FOG: TPR repeat, SEL1 subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89173"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM55"
FT                   /protein_id="ADI89173.1"
FT   gene            complement(298786..299412)
FT                   /locus_tag="AOLE_01355"
FT   CDS_pept        complement(298786..299412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01355"
FT                   /product="putative signal peptide-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01355"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89174"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM56"
FT                   /protein_id="ADI89174.1"
FT   gene            299702..300034
FT                   /locus_tag="AOLE_01360"
FT   CDS_pept        299702..300034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01360"
FT                   /product="putative component of the czc cation-efflux
FT                   system (CzcI)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89175"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM57"
FT                   /protein_id="ADI89175.1"
FT                   PVLTPL"
FT   gene            300089..301504
FT                   /locus_tag="AOLE_01365"
FT   CDS_pept        300089..301504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01365"
FT                   /product="Outer membrane protein"
FT                   /note="COG1538 Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01365"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89176"
FT                   /db_xref="GOA:D8JM58"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM58"
FT                   /protein_id="ADI89176.1"
FT                   WQQSQTFPTQAGE"
FT   gene            301507..302727
FT                   /locus_tag="AOLE_01370"
FT   CDS_pept        301507..302727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01370"
FT                   /product="membrane-fusion protein"
FT                   /note="COG0845 Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01370"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89177"
FT                   /db_xref="GOA:D8JM59"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM59"
FT                   /protein_id="ADI89177.1"
FT                   GEAEHGH"
FT   gene            302717..305875
FT                   /locus_tag="AOLE_01375"
FT   CDS_pept        302717..305875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01375"
FT                   /product="putative silver efflux pump"
FT                   /note="COG3696 Putative silver efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01375"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89178"
FT                   /db_xref="GOA:D8JM60"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM60"
FT                   /protein_id="ADI89178.1"
FT                   VEHS"
FT   gene            306007..306957
FT                   /locus_tag="AOLE_01380"
FT   CDS_pept        306007..306957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01380"
FT                   /product="Cobalt-zinc-cadmium resistance protein czcD
FT                   (Cation efflux systemprotein czcD)"
FT                   /note="COG1230 Co/Zn/Cd efflux system component"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01380"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89179"
FT                   /db_xref="GOA:D8JM61"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM61"
FT                   /protein_id="ADI89179.1"
FT   gene            complement(306976..307314)
FT                   /locus_tag="AOLE_01385"
FT   CDS_pept        complement(306976..307314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01385"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89180"
FT                   /db_xref="GOA:D8JM62"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM62"
FT                   /protein_id="ADI89180.1"
FT                   DCNHEWEI"
FT   gene            307590..308540
FT                   /locus_tag="AOLE_01390"
FT   CDS_pept        307590..308540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01390"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89181"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM63"
FT                   /protein_id="ADI89181.1"
FT   gene            complement(308622..308697)
FT                   /locus_tag="AOLE_t19494"
FT   tRNA            complement(308622..308697)
FT                   /locus_tag="AOLE_t19494"
FT                   /product="tRNA-Glu"
FT   gene            complement(308728..308803)
FT                   /locus_tag="AOLE_t19496"
FT   tRNA            complement(308728..308803)
FT                   /locus_tag="AOLE_t19496"
FT                   /product="tRNA-Glu"
FT   gene            complement(308925..309800)
FT                   /locus_tag="AOLE_01395"
FT   CDS_pept        complement(308925..309800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01395"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89182"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM64"
FT                   /protein_id="ADI89182.1"
FT                   IIEPFQKNEG"
FT   gene            complement(309944..311365)
FT                   /locus_tag="AOLE_01400"
FT   CDS_pept        complement(309944..311365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01400"
FT                   /product="Probable S-methylmethionine permease"
FT                   /note="COG0833 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01400"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89183"
FT                   /db_xref="GOA:D8JM65"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM65"
FT                   /protein_id="ADI89183.1"
FT                   ALCYVSYFIFYRNKT"
FT   gene            complement(311494..311569)
FT                   /locus_tag="AOLE_t19498"
FT   tRNA            complement(311494..311569)
FT                   /locus_tag="AOLE_t19498"
FT                   /product="tRNA-Glu"
FT   gene            complement(311595..311670)
FT                   /locus_tag="AOLE_t19500"
FT   tRNA            complement(311595..311670)
FT                   /locus_tag="AOLE_t19500"
FT                   /product="tRNA-Ala"
FT   gene            complement(311728..313236)
FT                   /gene="gltX"
FT                   /locus_tag="AOLE_01405"
FT   CDS_pept        complement(311728..313236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="AOLE_01405"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG0008 Glutamyl- and glutaminyl-tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01405"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89184"
FT                   /db_xref="GOA:D8JM66"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM66"
FT                   /protein_id="ADI89184.1"
FT   gene            complement(313353..313652)
FT                   /locus_tag="AOLE_01410"
FT   CDS_pept        complement(313353..313652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01410"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89185"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM67"
FT                   /protein_id="ADI89185.1"
FT   gene            314052..315050
FT                   /locus_tag="AOLE_01415"
FT   CDS_pept        314052..315050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01415"
FT                   /product="sulfate ABC transporter periplasmic
FT                   substrate-binding protein"
FT                   /note="COG1613 ABC-type sulfate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01415"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89186"
FT                   /db_xref="GOA:D8JM68"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM68"
FT                   /protein_id="ADI89186.1"
FT   gene            complement(315119..315718)
FT                   /locus_tag="AOLE_01420"
FT   CDS_pept        complement(315119..315718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01420"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01420"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89187"
FT                   /db_xref="GOA:D8JM69"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM69"
FT                   /protein_id="ADI89187.1"
FT   gene            315840..316445
FT                   /locus_tag="AOLE_01425"
FT   CDS_pept        315840..316445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01425"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="COG2249 Putative NADPH-quinone reductase (modulator
FT                   of drug activity B)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01425"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89188"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM70"
FT                   /protein_id="ADI89188.1"
FT   gene            316703..317626
FT                   /gene="mraW"
FT                   /locus_tag="AOLE_01430"
FT   CDS_pept        316703..317626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="AOLE_01430"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG0275 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in cell envelope biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01430"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89189"
FT                   /db_xref="GOA:D8JM71"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM71"
FT                   /protein_id="ADI89189.1"
FT   gene            317626..317958
FT                   /locus_tag="AOLE_01435"
FT   CDS_pept        317626..317958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01435"
FT                   /product="cell division protein"
FT                   /note="COG3116 Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01435"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89190"
FT                   /db_xref="GOA:D8JM72"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM72"
FT                   /protein_id="ADI89190.1"
FT                   TSEQNK"
FT   gene            317970..319802
FT                   /locus_tag="AOLE_01440"
FT   CDS_pept        317970..319802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01440"
FT                   /product="Penicillin binding protein transpeptidase domain
FT                   protein"
FT                   /note="COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01440"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89191"
FT                   /db_xref="GOA:D8JM73"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM73"
FT                   /protein_id="ADI89191.1"
FT   gene            319806..321305
FT                   /locus_tag="AOLE_01445"
FT   CDS_pept        319806..321305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01445"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate-2,
FT                   6-diaminopimelate ligase"
FT                   /note="COG0769 UDP-N-acetylmuramyl tripeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01445"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89192"
FT                   /db_xref="GOA:D8JM74"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM74"
FT                   /protein_id="ADI89192.1"
FT   gene            321314..322714
FT                   /locus_tag="AOLE_01450"
FT   CDS_pept        321314..322714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01450"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase (UDP-MurNAc-pentapeptide synthetase)"
FT                   /note="COG0770 UDP-N-acetylmuramyl pentapeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01450"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89193"
FT                   /db_xref="GOA:D8JM75"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM75"
FT                   /protein_id="ADI89193.1"
FT                   MADLMEKL"
FT   gene            322715..323833
FT                   /gene="mraY"
FT                   /locus_tag="AOLE_01455"
FT   CDS_pept        322715..323833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="AOLE_01455"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number=""
FT                   /note="COG0472 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01455"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89194"
FT                   /db_xref="GOA:D8JM76"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM76"
FT                   /protein_id="ADI89194.1"
FT   gene            323893..324225
FT                   /locus_tag="AOLE_01460"
FT   CDS_pept        323893..324225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01460"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89195"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM77"
FT                   /protein_id="ADI89195.1"
FT                   KEQENN"
FT   gene            324246..325049
FT                   /locus_tag="AOLE_01465"
FT   CDS_pept        324246..325049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01465"
FT                   /product="23S ribosomal RNA G745 methyltransferase"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01465"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89196"
FT                   /db_xref="GOA:D8JM78"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM78"
FT                   /protein_id="ADI89196.1"
FT   gene            complement(325145..327706)
FT                   /locus_tag="AOLE_01470"
FT   CDS_pept        complement(325145..327706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01470"
FT                   /product="putative penicillin binding protein (PonA)"
FT                   /note="COG5009 Membrane carboxypeptidase/penicillin-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01470"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89197"
FT                   /db_xref="GOA:D8JM79"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM79"
FT                   /protein_id="ADI89197.1"
FT   gene            327904..328926
FT                   /locus_tag="AOLE_01475"
FT   CDS_pept        327904..328926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01475"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="COG4972 Tfp pilus assembly protein, ATPase PilM"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01475"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89198"
FT                   /db_xref="GOA:D8JM80"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM80"
FT                   /protein_id="ADI89198.1"
FT                   "
FT   gene            328926..329567
FT                   /locus_tag="AOLE_01480"
FT   CDS_pept        328926..329567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01480"
FT                   /product="putative membrane protein"
FT                   /note="COG3166 Tfp pilus assembly protein PilN"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01480"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89199"
FT                   /db_xref="GOA:D8JM81"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM81"
FT                   /protein_id="ADI89199.1"
FT   gene            329564..330313
FT                   /locus_tag="AOLE_01485"
FT   CDS_pept        329564..330313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01485"
FT                   /product="putative membrane protein"
FT                   /note="COG3167 Tfp pilus assembly protein PilO"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01485"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89200"
FT                   /db_xref="GOA:D8JM82"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM82"
FT                   /protein_id="ADI89200.1"
FT   gene            330324..330851
FT                   /locus_tag="AOLE_01490"
FT   CDS_pept        330324..330851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01490"
FT                   /product="putative lipoprotein (ComL)"
FT                   /note="COG3168 Tfp pilus assembly protein PilP"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01490"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89201"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM83"
FT                   /protein_id="ADI89201.1"
FT                   RPRTLVLIGPAP"
FT   gene            330914..333079
FT                   /locus_tag="AOLE_01495"
FT   CDS_pept        330914..333079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01495"
FT                   /product="Type II secretory pathway, component HofQ"
FT                   /note="COG4796 Type II secretory pathway, component HofQ"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01495"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89202"
FT                   /db_xref="GOA:D8JM84"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM84"
FT                   /protein_id="ADI89202.1"
FT   gene            333091..333660
FT                   /gene="aroK"
FT                   /locus_tag="AOLE_01500"
FT   CDS_pept        333091..333660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="AOLE_01500"
FT                   /product="shikimate kinase"
FT                   /EC_number=""
FT                   /note="COG0703 Shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01500"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89203"
FT                   /db_xref="GOA:D8JM85"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM85"
FT                   /protein_id="ADI89203.1"
FT   gene            333689..334771
FT                   /gene="aroB"
FT                   /locus_tag="AOLE_01505"
FT   CDS_pept        333689..334771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="AOLE_01505"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number=""
FT                   /note="COG0337 3-dehydroquinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01505"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89204"
FT                   /db_xref="GOA:D8JM86"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM86"
FT                   /protein_id="ADI89204.1"
FT   gene            334788..335666
FT                   /locus_tag="AOLE_01510"
FT   CDS_pept        334788..335666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01510"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89205"
FT                   /db_xref="GOA:D8JM87"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM87"
FT                   /protein_id="ADI89205.1"
FT                   KNATNEGTRGN"
FT   gene            336122..340603
FT                   /gene="gltB"
FT                   /locus_tag="AOLE_01515"
FT   CDS_pept        336122..340603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="AOLE_01515"
FT                   /product="glutamate synthase subunit alpha"
FT                   /EC_number=""
FT                   /note="COG0067 Glutamate synthase domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01515"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89206"
FT                   /db_xref="GOA:D8JM88"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM88"
FT                   /protein_id="ADI89206.1"
FT   gene            340673..342094
FT                   /gene="gltD"
FT                   /locus_tag="AOLE_01520"
FT   CDS_pept        340673..342094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="AOLE_01520"
FT                   /product="glutamate synthase subunit beta"
FT                   /EC_number=""
FT                   /note="COG0493 NADPH-dependent glutamate synthase beta
FT                   chain and related oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01520"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89207"
FT                   /db_xref="GOA:D8JM89"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM89"
FT                   /protein_id="ADI89207.1"
FT                   EGRQAAEGILDYLGV"
FT   gene            342271..343158
FT                   /locus_tag="AOLE_01525"
FT   CDS_pept        342271..343158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01525"
FT                   /product="hypothetical protein"
FT                   /note="COG3687 Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01525"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89208"
FT                   /db_xref="GOA:D8JM90"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM90"
FT                   /protein_id="ADI89208.1"
FT                   QMASFQQEKHQRLS"
FT   gene            343289..343879
FT                   /locus_tag="AOLE_01530"
FT   CDS_pept        343289..343879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01530"
FT                   /product="putative signal peptide-containing protein"
FT                   /note="COG1704 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01530"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89209"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM91"
FT                   /protein_id="ADI89209.1"
FT   gene            343904..344980
FT                   /locus_tag="AOLE_01535"
FT   CDS_pept        343904..344980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01535"
FT                   /product="hypothetical protein"
FT                   /note="COG1512 Beta-propeller domains of methanol
FT                   dehydrogenase type"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01535"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89210"
FT                   /db_xref="GOA:D8JM92"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM92"
FT                   /protein_id="ADI89210.1"
FT                   GYGGGGGRFGGGGASGSW"
FT   gene            344974..345534
FT                   /locus_tag="AOLE_01540"
FT   CDS_pept        344974..345534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01540"
FT                   /product="hypothetical protein"
FT                   /note="COG3762 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01540"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89211"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM93"
FT                   /protein_id="ADI89211.1"
FT   gene            345881..346363
FT                   /locus_tag="AOLE_01545"
FT   CDS_pept        345881..346363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01545"
FT                   /product="fimbrial protein pilin"
FT                   /note="COG4969 Tfp pilus assembly protein, major pilin
FT                   PilA"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01545"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89212"
FT                   /db_xref="GOA:D8JM94"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM94"
FT                   /protein_id="ADI89212.1"
FT   gene            346441..347175
FT                   /locus_tag="AOLE_01550"
FT   CDS_pept        346441..347175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01550"
FT                   /product="type IV pilin accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01550"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89213"
FT                   /db_xref="GOA:D8JM95"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM95"
FT                   /protein_id="ADI89213.1"
FT   gene            347267..348895
FT                   /locus_tag="AOLE_01555"
FT   CDS_pept        347267..348895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01555"
FT                   /product="Lipid A core-O-antigen ligase"
FT                   /note="COG3307 Lipid A core - O-antigen ligase and related
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01555"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89214"
FT                   /db_xref="GOA:D8JM96"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR021797"
FT                   /db_xref="InterPro:IPR031726"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM96"
FT                   /protein_id="ADI89214.1"
FT   gene            complement(348940..349404)
FT                   /locus_tag="AOLE_01560"
FT   CDS_pept        complement(348940..349404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01560"
FT                   /product="bacterioferritin"
FT                   /note="COG2193 Bacterioferritin (cytochrome b1)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01560"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89215"
FT                   /db_xref="GOA:D8JM97"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM97"
FT                   /protein_id="ADI89215.1"
FT   gene            complement(349650..349844)
FT                   /locus_tag="AOLE_01565"
FT   CDS_pept        complement(349650..349844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01565"
FT                   /product="putative regulatory or redox component complexing
FT                   with Bfr, in iron storage and mobility (BFD)"
FT                   /note="COG2906 Bacterioferritin-associated ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01565"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89216"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM98"
FT                   /protein_id="ADI89216.1"
FT   gene            complement(350064..350447)
FT                   /locus_tag="AOLE_01570"
FT   CDS_pept        complement(350064..350447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01570"
FT                   /product="UPF0076 protein in vnfA 5'region"
FT                   /note="COG0251 Putative translation initiation inhibitor,
FT                   yjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01570"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89217"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D8JM99"
FT                   /protein_id="ADI89217.1"
FT   gene            complement(350592..352697)
FT                   /locus_tag="AOLE_01575"
FT   CDS_pept        complement(350592..352697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01575"
FT                   /product="GTP pyrophosphokinase(ATP:GTP
FT                   3'-pyrophosphotransferase)(ppGpp synthetase I)"
FT                   /note="COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01575"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89218"
FT                   /db_xref="GOA:D8JMA0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMA0"
FT                   /protein_id="ADI89218.1"
FT                   MEISKVS"
FT   gene            352808..352906
FT                   /locus_tag="AOLE_01580"
FT   CDS_pept        352808..352906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01580"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89219"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMA1"
FT                   /protein_id="ADI89219.1"
FT                   /translation="MKIIAFFNIFKFKTKPNKKPPQKNDGFFMKQN"
FT   gene            complement(352907..353185)
FT                   /gene="rpoZ"
FT                   /locus_tag="AOLE_01585"
FT   CDS_pept        complement(352907..353185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="AOLE_01585"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number=""
FT                   /note="COG1758 DNA-directed RNA polymerase, subunit
FT                   K/omega"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01585"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89220"
FT                   /db_xref="GOA:D8JMA2"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMA2"
FT                   /protein_id="ADI89220.1"
FT   gene            complement(353258..353887)
FT                   /gene="gmk"
FT                   /locus_tag="AOLE_01590"
FT   CDS_pept        complement(353258..353887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="AOLE_01590"
FT                   /product="guanylate kinase"
FT                   /EC_number=""
FT                   /note="COG0194 Guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01590"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89221"
FT                   /db_xref="GOA:D8JMA3"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMA3"
FT                   /protein_id="ADI89221.1"
FT   gene            354010..354960
FT                   /gene="ispH"
FT                   /locus_tag="AOLE_01595"
FT   CDS_pept        354010..354960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="AOLE_01595"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number=""
FT                   /note="COG0761 Penicillin tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01595"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89222"
FT                   /db_xref="GOA:D8JMA4"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMA4"
FT                   /protein_id="ADI89222.1"
FT   gene            355132..355578
FT                   /locus_tag="AOLE_01600"
FT   CDS_pept        355132..355578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01600"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain protein"
FT                   /note="COG4970 Tfp pilus assembly protein FimT"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01600"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89223"
FT                   /db_xref="GOA:D8JMA5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMA5"
FT                   /protein_id="ADI89223.1"
FT   gene            355575..356096
FT                   /locus_tag="AOLE_01605"
FT   CDS_pept        355575..356096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01605"
FT                   /product="putative type IV fimbrial biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01605"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89224"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMA6"
FT                   /protein_id="ADI89224.1"
FT                   QAKCVIMELY"
FT   gene            356098..357126
FT                   /locus_tag="AOLE_01610"
FT   CDS_pept        356098..357126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01610"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain protein"
FT                   /note="COG4966 Tfp pilus assembly protein PilW"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89225"
FT                   /db_xref="GOA:D8JMA7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMA7"
FT                   /protein_id="ADI89225.1"
FT                   VM"
FT   gene            357126..357872
FT                   /locus_tag="AOLE_01615"
FT   CDS_pept        357126..357872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01615"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89226"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMA8"
FT                   /protein_id="ADI89226.1"
FT   gene            357897..361583
FT                   /locus_tag="AOLE_01620"
FT   CDS_pept        357897..361583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01620"
FT                   /product="putative pilus assembly protein tip-associated
FT                   adhesin PilY1"
FT                   /note="COG3419 Tfp pilus assembly protein, tip-associated
FT                   adhesin PilY1"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01620"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89227"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMA9"
FT                   /protein_id="ADI89227.1"
FT                   ERQ"
FT   gene            361593..362093
FT                   /locus_tag="AOLE_01625"
FT   CDS_pept        361593..362093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01625"
FT                   /product="pilin like competence factor"
FT                   /note="COG4968 Tfp pilus assembly protein PilE"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01625"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89228"
FT                   /db_xref="GOA:D8JMB0"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMB0"
FT                   /protein_id="ADI89228.1"
FT                   EKW"
FT   gene            362077..362526
FT                   /locus_tag="AOLE_01630"
FT   CDS_pept        362077..362526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01630"
FT                   /product="pilin like competence factor"
FT                   /note="COG4968 Tfp pilus assembly protein PilE"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01630"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89229"
FT                   /db_xref="GOA:D8JMB1"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMB1"
FT                   /protein_id="ADI89229.1"
FT   gene            362673..362924
FT                   /gene="rpsP"
FT                   /locus_tag="AOLE_01635"
FT   CDS_pept        362673..362924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="AOLE_01635"
FT                   /product="30S ribosomal protein S16"
FT                   /note="COG0228 Ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01635"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89230"
FT                   /db_xref="GOA:D8JMB2"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMB2"
FT                   /protein_id="ADI89230.1"
FT   gene            362945..363493
FT                   /gene="rimM"
FT                   /locus_tag="AOLE_01640"
FT   CDS_pept        362945..363493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="AOLE_01640"
FT                   /product="16S rRNA-processing protein RimM"
FT                   /note="COG0806 RimM protein, required for 16S rRNA
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01640"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89231"
FT                   /db_xref="GOA:D8JMB3"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMB3"
FT                   /protein_id="ADI89231.1"
FT   gene            363536..364291
FT                   /gene="trmD"
FT                   /locus_tag="AOLE_01645"
FT   CDS_pept        363536..364291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="AOLE_01645"
FT                   /product="tRNA (guanine-N(1)-)-methyltransferase"
FT                   /note="COG0336 tRNA-(guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01645"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89232"
FT                   /db_xref="GOA:D8JMB4"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMB4"
FT                   /protein_id="ADI89232.1"
FT   gene            364511..364879
FT                   /gene="rplS"
FT                   /locus_tag="AOLE_01650"
FT   CDS_pept        364511..364879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="AOLE_01650"
FT                   /product="50S ribosomal protein L19"
FT                   /note="COG0335 Ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01650"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89233"
FT                   /db_xref="GOA:D8JMB5"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMB5"
FT                   /protein_id="ADI89233.1"
FT                   DLSGKAARIREKLPARKA"
FT   gene            complement(364933..365892)
FT                   /locus_tag="AOLE_01655"
FT   CDS_pept        complement(364933..365892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01655"
FT                   /product="Lactonizing lipase precursor(Triacylglycerol
FT                   lipase)"
FT                   /note="COG1075 Predicted acetyltransferases and hydrolases
FT                   with the alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01655"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89234"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMB6"
FT                   /protein_id="ADI89234.1"
FT   gene            complement(365991..367022)
FT                   /locus_tag="AOLE_01660"
FT   CDS_pept        complement(365991..367022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01660"
FT                   /product="lipase chaperone"
FT                   /note="COG5380 Lipase chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01660"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89235"
FT                   /db_xref="GOA:D8JMB7"
FT                   /db_xref="InterPro:IPR004961"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMB7"
FT                   /protein_id="ADI89235.1"
FT                   FNY"
FT   gene            367176..368081
FT                   /gene="truB"
FT                   /locus_tag="AOLE_01665"
FT   CDS_pept        367176..368081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="AOLE_01665"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="COG0130 Pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01665"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89236"
FT                   /db_xref="GOA:D8JMB8"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMB8"
FT                   /protein_id="ADI89236.1"
FT   gene            368101..368877
FT                   /locus_tag="AOLE_01670"
FT   CDS_pept        368101..368877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01670"
FT                   /product="permease"
FT                   /note="COG0730 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01670"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89237"
FT                   /db_xref="GOA:D8JMB9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMB9"
FT                   /protein_id="ADI89237.1"
FT   gene            369089..369532
FT                   /locus_tag="AOLE_01675"
FT   CDS_pept        369089..369532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01675"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01675"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89238"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMC0"
FT                   /protein_id="ADI89238.1"
FT   gene            complement(369540..370403)
FT                   /locus_tag="AOLE_01680"
FT   CDS_pept        complement(369540..370403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01680"
FT                   /product="hypothetical protein"
FT                   /note="COG5006 Predicted permease, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01680"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89239"
FT                   /db_xref="GOA:D8JMC1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMC1"
FT                   /protein_id="ADI89239.1"
FT                   STKKVA"
FT   gene            complement(370496..371380)
FT                   /locus_tag="AOLE_01685"
FT   CDS_pept        complement(370496..371380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01685"
FT                   /product="DMT superfamily permease"
FT                   /note="COG5006 Predicted permease, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01685"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89240"
FT                   /db_xref="GOA:D8JMC2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMC2"
FT                   /protein_id="ADI89240.1"
FT                   TQKARQEREKTVS"
FT   gene            371454..371591
FT                   /locus_tag="AOLE_01690"
FT   CDS_pept        371454..371591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01690"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89241"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMC3"
FT                   /protein_id="ADI89241.1"
FT                   "
FT   gene            complement(371479..372711)
FT                   /locus_tag="AOLE_01695"
FT   CDS_pept        complement(371479..372711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01695"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="COG0111 Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01695"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89242"
FT                   /db_xref="GOA:D8JMC4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMC4"
FT                   /protein_id="ADI89242.1"
FT                   VEGTIRVRVLF"
FT   gene            373090..374499
FT                   /locus_tag="AOLE_01700"
FT   CDS_pept        373090..374499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01700"
FT                   /product="FAD linked oxidase, C-terminal domain protein"
FT                   /note="COG0277 FAD/FMN-containing dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01700"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89243"
FT                   /db_xref="GOA:D8JMC5"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMC5"
FT                   /protein_id="ADI89243.1"
FT                   GIMNPGKLFDL"
FT   gene            374575..374892
FT                   /locus_tag="AOLE_01705"
FT   CDS_pept        374575..374892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01705"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89244"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMC6"
FT                   /protein_id="ADI89244.1"
FT                   V"
FT   gene            complement(374906..375694)
FT                   /locus_tag="AOLE_01710"
FT   CDS_pept        complement(374906..375694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89245"
FT                   /db_xref="GOA:D8JMC7"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMC7"
FT                   /protein_id="ADI89245.1"
FT   gene            375881..376249
FT                   /locus_tag="AOLE_01715"
FT   CDS_pept        375881..376249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01715"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89246"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMC8"
FT                   /protein_id="ADI89246.1"
FT                   YQCARGKGSRGFQTQLCS"
FT   gene            complement(376297..376611)
FT                   /locus_tag="AOLE_01720"
FT   CDS_pept        complement(376297..376611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01720"
FT                   /product="Antibiotic biosynthesis monooxygenase family
FT                   protein"
FT                   /note="COG1359 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01720"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89247"
FT                   /db_xref="GOA:D8JMC9"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMC9"
FT                   /protein_id="ADI89247.1"
FT                   "
FT   gene            complement(376625..377212)
FT                   /locus_tag="AOLE_01725"
FT   CDS_pept        complement(376625..377212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01725"
FT                   /product="Flavodoxin-like fold family protein"
FT                   /note="COG2249 Putative NADPH-quinone reductase (modulator
FT                   of drug activity B)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01725"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89248"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMD0"
FT                   /protein_id="ADI89248.1"
FT   gene            377437..377802
FT                   /locus_tag="AOLE_01730"
FT   CDS_pept        377437..377802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01730"
FT                   /product="putative signal peptide-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01730"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89249"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMD1"
FT                   /protein_id="ADI89249.1"
FT                   QCTQGQDAPDFQVNPCP"
FT   gene            378171..379400
FT                   /locus_tag="AOLE_01735"
FT   CDS_pept        378171..379400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01735"
FT                   /product="Multidrug translocase mdfA (Chloramphenicol
FT                   resistance pump cmr)"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01735"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89250"
FT                   /db_xref="GOA:D8JMD2"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMD2"
FT                   /protein_id="ADI89250.1"
FT                   MQERKLEGND"
FT   gene            complement(379438..379974)
FT                   /locus_tag="AOLE_01740"
FT   CDS_pept        complement(379438..379974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01740"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89251"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMD3"
FT                   /protein_id="ADI89251.1"
FT                   TYETDREEMEKMLKE"
FT   gene            complement(380000..382150)
FT                   /locus_tag="AOLE_01745"
FT   CDS_pept        complement(380000..382150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01745"
FT                   /product="Inner membrane protein yccS"
FT                   /note="COG1289 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01745"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89252"
FT                   /db_xref="GOA:D8JMD4"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMD4"
FT                   /protein_id="ADI89252.1"
FT   gene            complement(382354..382929)
FT                   /locus_tag="AOLE_01750"
FT   CDS_pept        complement(382354..382929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01750"
FT                   /product="Cu/Zn superoxide dismutase"
FT                   /note="COG2032 Cu/Zn superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01750"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89253"
FT                   /db_xref="GOA:D8JMD5"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMD5"
FT                   /protein_id="ADI89253.1"
FT   gene            complement(383050..384168)
FT                   /locus_tag="AOLE_01755"
FT   CDS_pept        complement(383050..384168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01755"
FT                   /product="hypothetical protein"
FT                   /note="COG0628 Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01755"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89254"
FT                   /db_xref="GOA:D8JMD6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMD6"
FT                   /protein_id="ADI89254.1"
FT   gene            complement(384293..384937)
FT                   /locus_tag="AOLE_01760"
FT   CDS_pept        complement(384293..384937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01760"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   protein"
FT                   /note="COG1192 ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01760"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89255"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMD7"
FT                   /protein_id="ADI89255.1"
FT   gene            385096..385563
FT                   /locus_tag="AOLE_01765"
FT   CDS_pept        385096..385563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01765"
FT                   /product="hypothetical protein"
FT                   /note="COG4741 Predicted secreted endonuclease distantly
FT                   related to archaeal Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01765"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89256"
FT                   /db_xref="GOA:D8JMD8"
FT                   /db_xref="InterPro:IPR019287"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMD8"
FT                   /protein_id="ADI89256.1"
FT   gene            385703..386266
FT                   /locus_tag="AOLE_01770"
FT   CDS_pept        385703..386266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01770"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89257"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMD9"
FT                   /protein_id="ADI89257.1"
FT   gene            complement(386319..386822)
FT                   /locus_tag="AOLE_01775"
FT   CDS_pept        complement(386319..386822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01775"
FT                   /product="putative signal peptide-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01775"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89258"
FT                   /db_xref="UniProtKB/TrEMBL:D8JME0"
FT                   /protein_id="ADI89258.1"
FT                   SQQK"
FT   gene            complement(386879..387667)
FT                   /locus_tag="AOLE_01780"
FT   CDS_pept        complement(386879..387667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01780"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01780"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89259"
FT                   /db_xref="GOA:D8JME1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8JME1"
FT                   /protein_id="ADI89259.1"
FT   gene            387795..389072
FT                   /locus_tag="AOLE_01785"
FT   CDS_pept        387795..389072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01785"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01785"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89260"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D8JME2"
FT                   /protein_id="ADI89260.1"
FT   gene            389486..390913
FT                   /locus_tag="AOLE_01790"
FT   CDS_pept        389486..390913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01790"
FT                   /product="S-methylmethionine APC transporter"
FT                   /note="COG0833 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01790"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89261"
FT                   /db_xref="GOA:D8JME3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D8JME3"
FT                   /protein_id="ADI89261.1"
FT                   LVCYASYFIFYHKKDVM"
FT   gene            391952..393226
FT                   /locus_tag="AOLE_01795"
FT   CDS_pept        391952..393226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01795"
FT                   /product="glutamate dehydrogenase (NAD(P)+) oxidoreductase
FT                   protein"
FT                   /note="COG0334 Glutamate dehydrogenase/leucine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01795"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89262"
FT                   /db_xref="GOA:D8JME4"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8JME4"
FT                   /protein_id="ADI89262.1"
FT   gene            393362..394576
FT                   /locus_tag="AOLE_01800"
FT   CDS_pept        393362..394576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01800"
FT                   /product="bifunctional succinylornithine
FT                   transaminase/acetylornithine transaminase"
FT                   /note="COG4992 Ornithine/acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89263"
FT                   /db_xref="GOA:D8JME5"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/TrEMBL:D8JME5"
FT                   /protein_id="ADI89263.1"
FT                   AKLAK"
FT   gene            394595..395626
FT                   /locus_tag="AOLE_01805"
FT   CDS_pept        394595..395626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01805"
FT                   /product="arginine succinyltransferase"
FT                   /note="COG3138 Arginine/ornithine N-succinyltransferase
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01805"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89264"
FT                   /db_xref="GOA:D8JME6"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017650"
FT                   /db_xref="UniProtKB/TrEMBL:D8JME6"
FT                   /protein_id="ADI89264.1"
FT                   EVS"
FT   gene            395626..397095
FT                   /locus_tag="AOLE_01810"
FT   CDS_pept        395626..397095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01810"
FT                   /product="succinylglutamic semialdehyde dehydrogenase"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01810"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89265"
FT                   /db_xref="GOA:D8JME7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017649"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D8JME7"
FT                   /protein_id="ADI89265.1"
FT   gene            397113..398456
FT                   /locus_tag="AOLE_01815"
FT   CDS_pept        397113..398456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01815"
FT                   /product="succinylarginine dihydrolase"
FT                   /EC_number=""
FT                   /note="COG3724 Succinylarginine dihydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01815"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89266"
FT                   /db_xref="GOA:D8JME8"
FT                   /db_xref="InterPro:IPR007079"
FT                   /db_xref="InterPro:IPR037031"
FT                   /db_xref="UniProtKB/TrEMBL:D8JME8"
FT                   /protein_id="ADI89266.1"
FT   gene            398469..399443
FT                   /locus_tag="AOLE_01820"
FT   CDS_pept        398469..399443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01820"
FT                   /product="succinylglutamate desuccinylase"
FT                   /note="COG2988 Succinylglutamate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01820"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89267"
FT                   /db_xref="GOA:D8JME9"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR016681"
FT                   /db_xref="UniProtKB/TrEMBL:D8JME9"
FT                   /protein_id="ADI89267.1"
FT   gene            complement(399507..400340)
FT                   /locus_tag="AOLE_01825"
FT   CDS_pept        complement(399507..400340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01825"
FT                   /product="putative signal peptide-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01825"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89268"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMF0"
FT                   /protein_id="ADI89268.1"
FT   gene            400932..401240
FT                   /locus_tag="AOLE_01830"
FT   CDS_pept        400932..401240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01830"
FT                   /product="putative signal peptide-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01830"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89269"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMF1"
FT                   /protein_id="ADI89269.1"
FT   gene            401276..402631
FT                   /locus_tag="AOLE_01835"
FT   CDS_pept        401276..402631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01835"
FT                   /product="subtilisin-like serine protease"
FT                   /note="COG1404 Subtilisin-like serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01835"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89270"
FT                   /db_xref="GOA:D8JMF2"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMF2"
FT                   /protein_id="ADI89270.1"
FT   gene            complement(402734..403168)
FT                   /locus_tag="AOLE_01840"
FT   CDS_pept        complement(402734..403168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01840"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89271"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMF3"
FT                   /protein_id="ADI89271.1"
FT   gene            complement(403265..403684)
FT                   /locus_tag="AOLE_01845"
FT   CDS_pept        complement(403265..403684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01845"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01845"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89272"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMF4"
FT                   /protein_id="ADI89272.1"
FT   gene            complement(403833..404699)
FT                   /locus_tag="AOLE_01850"
FT   CDS_pept        complement(403833..404699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01850"
FT                   /product="transcriptional regulator"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01850"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89273"
FT                   /db_xref="GOA:D8JMF5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMF5"
FT                   /protein_id="ADI89273.1"
FT                   IKSEFCL"
FT   gene            404808..405719
FT                   /locus_tag="AOLE_01855"
FT   CDS_pept        404808..405719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01855"
FT                   /product="hypothetical protein"
FT                   /note="COG0697 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01855"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89274"
FT                   /db_xref="GOA:D8JMF6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMF6"
FT                   /protein_id="ADI89274.1"
FT   gene            complement(405879..406328)
FT                   /locus_tag="AOLE_01860"
FT   CDS_pept        complement(405879..406328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01860"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89275"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMF7"
FT                   /protein_id="ADI89275.1"
FT   gene            406611..406895
FT                   /locus_tag="AOLE_01865"
FT   CDS_pept        406611..406895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01865"
FT                   /product="hypothetical protein"
FT                   /note="COG2350 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01865"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89276"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMF8"
FT                   /protein_id="ADI89276.1"
FT   gene            complement(406953..407783)
FT                   /locus_tag="AOLE_01870"
FT   CDS_pept        complement(406953..407783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01870"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89277"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMF9"
FT                   /protein_id="ADI89277.1"
FT   gene            complement(408013..410082)
FT                   /gene="glyS"
FT                   /locus_tag="AOLE_01875"
FT   CDS_pept        complement(408013..410082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="AOLE_01875"
FT                   /product="glycyl-tRNA synthetase subunit beta"
FT                   /EC_number=""
FT                   /note="COG0751 Glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01875"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89278"
FT                   /db_xref="GOA:D8JMG0"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMG0"
FT                   /protein_id="ADI89278.1"
FT   gene            complement(410082..411059)
FT                   /gene="glyQ"
FT                   /locus_tag="AOLE_01880"
FT   CDS_pept        complement(410082..411059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="AOLE_01880"
FT                   /product="glycyl-tRNA synthetase subunit alpha"
FT                   /EC_number=""
FT                   /note="COG0752 Glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01880"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89279"
FT                   /db_xref="GOA:D8JMG1"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMG1"
FT                   /protein_id="ADI89279.1"
FT   gene            complement(411151..411633)
FT                   /locus_tag="AOLE_01885"
FT   CDS_pept        complement(411151..411633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01885"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01885"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89280"
FT                   /db_xref="GOA:D8JMG2"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMG2"
FT                   /protein_id="ADI89280.1"
FT   gene            411771..412556
FT                   /locus_tag="AOLE_01890"
FT   CDS_pept        411771..412556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01890"
FT                   /product="Sel1 domain-containing protein"
FT                   /note="COG0790 FOG: TPR repeat, SEL1 subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01890"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89281"
FT                   /db_xref="GOA:D8JMG3"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMG3"
FT                   /protein_id="ADI89281.1"
FT   gene            complement(412678..413088)
FT                   /locus_tag="AOLE_01895"
FT   CDS_pept        complement(412678..413088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01895"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01895"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89282"
FT                   /db_xref="GOA:D8JMG4"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMG4"
FT                   /protein_id="ADI89282.1"
FT   gene            413118..413534
FT                   /locus_tag="AOLE_01900"
FT   CDS_pept        413118..413534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01900"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89283"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMG5"
FT                   /protein_id="ADI89283.1"
FT   gene            413644..414906
FT                   /locus_tag="AOLE_01905"
FT   CDS_pept        413644..414906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01905"
FT                   /product="DNA-binding protein"
FT                   /note="COG4277 Predicted DNA-binding protein with the
FT                   Helix-hairpin-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01905"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89284"
FT                   /db_xref="GOA:D8JMG6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMG6"
FT                   /protein_id="ADI89284.1"
FT   gene            414909..415706
FT                   /locus_tag="AOLE_01910"
FT   CDS_pept        414909..415706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01910"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89285"
FT                   /db_xref="InterPro:IPR023875"
FT                   /db_xref="InterPro:IPR025404"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMG7"
FT                   /protein_id="ADI89285.1"
FT   gene            415840..416940
FT                   /locus_tag="AOLE_01915"
FT   CDS_pept        415840..416940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01915"
FT                   /product="CBS domain-containing membrane protein"
FT                   /note="COG3448 CBS-domain-containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01915"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89286"
FT                   /db_xref="GOA:D8JMG8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMG8"
FT                   /protein_id="ADI89286.1"
FT   gene            complement(417004..417258)
FT                   /locus_tag="AOLE_01920"
FT   CDS_pept        complement(417004..417258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01920"
FT                   /product="PspC domain protein"
FT                   /note="COG1983 Putative stress-responsive transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01920"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89287"
FT                   /db_xref="GOA:D8JMG9"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMG9"
FT                   /protein_id="ADI89287.1"
FT   gene            417563..418156
FT                   /locus_tag="AOLE_01925"
FT   CDS_pept        417563..418156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01925"
FT                   /product="putative signal peptide-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01925"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89288"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMH0"
FT                   /protein_id="ADI89288.1"
FT   gene            complement(418223..420046)
FT                   /locus_tag="AOLE_01930"
FT   CDS_pept        complement(418223..420046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01930"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal domain
FT                   protein"
FT                   /note="COG1960 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01930"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89289"
FT                   /db_xref="GOA:D8JMH1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMH1"
FT                   /protein_id="ADI89289.1"
FT   gene            420302..422644
FT                   /locus_tag="AOLE_01935"
FT   CDS_pept        420302..422644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01935"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01935"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89290"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMH2"
FT                   /protein_id="ADI89290.1"
FT   gene            complement(422691..423479)
FT                   /gene="aroE"
FT                   /locus_tag="AOLE_01940"
FT   CDS_pept        complement(422691..423479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="AOLE_01940"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number=""
FT                   /note="COG0169 Shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01940"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89291"
FT                   /db_xref="GOA:D8JMH3"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMH3"
FT                   /protein_id="ADI89291.1"
FT   gene            complement(423660..424610)
FT                   /locus_tag="AOLE_01945"
FT   CDS_pept        complement(423660..424610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01945"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /EC_number=""
FT                   /note="COG0408 Coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01945"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89292"
FT                   /db_xref="GOA:D8JMH4"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMH4"
FT                   /protein_id="ADI89292.1"
FT   gene            complement(424729..425340)
FT                   /gene="ribA"
FT                   /locus_tag="AOLE_01950"
FT   CDS_pept        complement(424729..425340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="AOLE_01950"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number=""
FT                   /note="COG0807 GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01950"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89293"
FT                   /db_xref="GOA:D8JMH5"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMH5"
FT                   /protein_id="ADI89293.1"
FT   gene            425644..427548
FT                   /locus_tag="AOLE_01955"
FT   CDS_pept        425644..427548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01955"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number=""
FT                   /note="COG1154 Deoxyxylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01955"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89294"
FT                   /db_xref="GOA:D8JMH6"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMH6"
FT                   /protein_id="ADI89294.1"
FT   gene            427666..428496
FT                   /locus_tag="AOLE_01960"
FT   CDS_pept        427666..428496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01960"
FT                   /product="inositol-1-monophosphatase"
FT                   /note="COG0483 Archaeal fructose-1,6-bisphosphatase and
FT                   related enzymes of inositol monophosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01960"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89295"
FT                   /db_xref="GOA:D8JMH7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMH7"
FT                   /protein_id="ADI89295.1"
FT   gene            428905..430839
FT                   /locus_tag="AOLE_01965"
FT   CDS_pept        428905..430839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01965"
FT                   /product="putative ATP-dependent RNA helicase"
FT                   /note="COG0513 Superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01965"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89296"
FT                   /db_xref="GOA:D8JMH8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMH8"
FT                   /protein_id="ADI89296.1"
FT                   KPPRRKFDR"
FT   gene            431245..432063
FT                   /locus_tag="AOLE_01970"
FT   CDS_pept        431245..432063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01970"
FT                   /product="ABC-type transport system"
FT                   /note="COG1127 ABC-type transport system involved in
FT                   resistance to organic solvents, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01970"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89297"
FT                   /db_xref="GOA:D8JMH9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMH9"
FT                   /protein_id="ADI89297.1"
FT   gene            432060..432839
FT                   /locus_tag="AOLE_01975"
FT   CDS_pept        432060..432839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01975"
FT                   /product="toluene tolerance protein Ttg2B"
FT                   /note="COG0767 ABC-type transport system involved in
FT                   resistance to organic solvents, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01975"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89298"
FT                   /db_xref="GOA:D8JMI0"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMI0"
FT                   /protein_id="ADI89298.1"
FT   gene            432839..433522
FT                   /locus_tag="AOLE_01980"
FT   CDS_pept        432839..433522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01980"
FT                   /product="mce related family protein"
FT                   /note="COG1463 ABC-type transport system involved in
FT                   resistance to organic solvents, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01980"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89299"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMI1"
FT                   /protein_id="ADI89299.1"
FT                   ASFVE"
FT   gene            433549..434190
FT                   /locus_tag="AOLE_01985"
FT   CDS_pept        433549..434190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01985"
FT                   /product="putative toluene tolerance protein (Ttg2D)"
FT                   /note="COG2854 ABC-type transport system involved in
FT                   resistance to organic solvents, auxiliary component"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01985"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89300"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMW8"
FT                   /protein_id="ADI89300.1"
FT   gene            434201..434488
FT                   /locus_tag="AOLE_01990"
FT   CDS_pept        434201..434488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01990"
FT                   /product="hypothetical protein"
FT                   /note="COG3845 ABC-type uncharacterized transport systems,
FT                   ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01990"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89301"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMW9"
FT                   /protein_id="ADI89301.1"
FT   gene            complement(434561..435574)
FT                   /locus_tag="AOLE_01995"
FT   CDS_pept        complement(434561..435574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_01995"
FT                   /product="magnesium and cobalt transport protein"
FT                   /note="COG0598 Mg2+ and Co2+ transporters"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_01995"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89302"
FT                   /db_xref="GOA:D8JMX0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMX0"
FT                   /protein_id="ADI89302.1"
FT   gene            435733..436314
FT                   /locus_tag="AOLE_02000"
FT   CDS_pept        435733..436314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02000"
FT                   /product="Rossmann fold nucleotide-binding protein"
FT                   /note="COG1611 Predicted Rossmann fold nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02000"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89303"
FT                   /db_xref="GOA:D8JMX1"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMX1"
FT                   /protein_id="ADI89303.1"
FT   gene            436329..436727
FT                   /locus_tag="AOLE_02005"
FT   CDS_pept        436329..436727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02005"
FT                   /product="Mutator mutT protein"
FT                   /note="COG0494 NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02005"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89304"
FT                   /db_xref="GOA:D8JMX2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMX2"
FT                   /protein_id="ADI89304.1"
FT   gene            complement(436733..437362)
FT                   /locus_tag="AOLE_02010"
FT   CDS_pept        complement(436733..437362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02010"
FT                   /product="putative DNA transformation protein (ComF)"
FT                   /note="COG1040 Predicted amidophosphoribosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02010"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89305"
FT                   /db_xref="GOA:D8JMX3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMX3"
FT                   /protein_id="ADI89305.1"
FT   gene            complement(437355..439400)
FT                   /locus_tag="AOLE_02015"
FT   CDS_pept        complement(437355..439400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02015"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="COG1200 RecG-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02015"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89306"
FT                   /db_xref="GOA:D8JMX4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMX4"
FT                   /protein_id="ADI89306.1"
FT   gene            439421..440236
FT                   /locus_tag="AOLE_02020"
FT   CDS_pept        439421..440236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02020"
FT                   /product="nucleoside-diphosphate-sugar epimerase"
FT                   /note="COG0451 Nucleoside-diphosphate-sugar epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02020"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89307"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMX5"
FT                   /protein_id="ADI89307.1"
FT   gene            440310..441299
FT                   /locus_tag="AOLE_02025"
FT   CDS_pept        440310..441299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02025"
FT                   /product="putative RND type efflux pump involved in
FT                   aminoglycoside resistance (adeT)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02025"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89308"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMX6"
FT                   /protein_id="ADI89308.1"
FT   misc_feature    complement(441346..443918)
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|169632340|ref|YP_001706076.1| glycerol-3-phosphate
FT                   acyltransferase"
FT   gene            444195..445067
FT                   /locus_tag="AOLE_02040"
FT   CDS_pept        444195..445067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02040"
FT                   /product="acyl-CoA thioesterase II"
FT                   /note="COG1946 Acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02040"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89309"
FT                   /db_xref="GOA:D8JMX7"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMX7"
FT                   /protein_id="ADI89309.1"
FT                   IRLREIETQ"
FT   gene            445176..446441
FT                   /locus_tag="AOLE_02045"
FT   CDS_pept        445176..446441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02045"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="COG1301 Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02045"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89310"
FT                   /db_xref="GOA:D8JMX8"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMX8"
FT                   /protein_id="ADI89310.1"
FT   gene            complement(446488..447435)
FT                   /locus_tag="AOLE_02050"
FT   CDS_pept        complement(446488..447435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02050"
FT                   /product="metal-dependent hydrolase"
FT                   /note="COG3687 Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02050"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89311"
FT                   /db_xref="GOA:D8JMX9"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMX9"
FT                   /protein_id="ADI89311.1"
FT   gene            complement(447562..448338)
FT                   /gene="engB"
FT                   /locus_tag="AOLE_02055"
FT   CDS_pept        complement(447562..448338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="AOLE_02055"
FT                   /product="ribosome biogenesis GTP-binding protein YsxC"
FT                   /note="COG0218 Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02055"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89312"
FT                   /db_xref="GOA:D8JMY0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMY0"
FT                   /protein_id="ADI89312.1"
FT   gene            complement(448439..448876)
FT                   /locus_tag="AOLE_02060"
FT   CDS_pept        complement(448439..448876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02060"
FT                   /product="hypothetical protein"
FT                   /note="COG1959 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02060"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89313"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMY1"
FT                   /protein_id="ADI89313.1"
FT   gene            complement(448962..449726)
FT                   /locus_tag="AOLE_02065"
FT   CDS_pept        complement(448962..449726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02065"
FT                   /product="flavohemoprotein"
FT                   /note="COG1017 Hemoglobin-like flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02065"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89314"
FT                   /db_xref="GOA:D8JMY2"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMY2"
FT                   /protein_id="ADI89314.1"
FT   gene            complement(449872..451419)
FT                   /locus_tag="AOLE_02070"
FT   CDS_pept        complement(449872..451419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02070"
FT                   /product="hypothetical protein"
FT                   /note="COG0433 Predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02070"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89315"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMY3"
FT                   /protein_id="ADI89315.1"
FT   gene            complement(451463..452653)
FT                   /locus_tag="AOLE_02075"
FT   CDS_pept        complement(451463..452653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02075"
FT                   /product="cystathionine beta-lyases/cystathionine
FT                   gamma-synthase"
FT                   /note="COG0626 Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02075"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89316"
FT                   /db_xref="GOA:D8JMY4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMY4"
FT                   /protein_id="ADI89316.1"
FT   gene            452822..453550
FT                   /locus_tag="AOLE_02080"
FT   CDS_pept        452822..453550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02080"
FT                   /product="hypothetical protein"
FT                   /note="COG0518 GMP synthase - Glutamine amidotransferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02080"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89317"
FT                   /db_xref="GOA:D8JMY5"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMY5"
FT                   /protein_id="ADI89317.1"
FT   gene            453803..454114
FT                   /gene="rpsJ"
FT                   /locus_tag="AOLE_02085"
FT   CDS_pept        453803..454114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="AOLE_02085"
FT                   /product="30S ribosomal protein S10"
FT                   /note="COG0051 Ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02085"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89318"
FT                   /db_xref="GOA:D8JMY6"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMY6"
FT                   /protein_id="ADI89318.1"
FT   gene            454173..454811
FT                   /gene="rplC"
FT                   /locus_tag="AOLE_02090"
FT   CDS_pept        454173..454811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="AOLE_02090"
FT                   /product="50S ribosomal protein L3"
FT                   /note="COG0087 Ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02090"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89319"
FT                   /db_xref="GOA:D8JMY7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMY7"
FT                   /protein_id="ADI89319.1"
FT   gene            454823..455425
FT                   /gene="rplD"
FT                   /locus_tag="AOLE_02095"
FT   CDS_pept        454823..455425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="AOLE_02095"
FT                   /product="50S ribosomal protein L4"
FT                   /note="COG0088 Ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02095"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89320"
FT                   /db_xref="GOA:D8JMY8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMY8"
FT                   /protein_id="ADI89320.1"
FT   gene            455422..455742
FT                   /gene="rplW"
FT                   /locus_tag="AOLE_02100"
FT   CDS_pept        455422..455742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="AOLE_02100"
FT                   /product="50S ribosomal protein L23"
FT                   /note="COG0089 Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02100"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89321"
FT                   /db_xref="GOA:D8JMY9"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMY9"
FT                   /protein_id="ADI89321.1"
FT                   AE"
FT   gene            455754..456578
FT                   /gene="rplB"
FT                   /locus_tag="AOLE_02105"
FT   CDS_pept        455754..456578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="AOLE_02105"
FT                   /product="50S ribosomal protein L2"
FT                   /note="COG0090 Ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02105"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89322"
FT                   /db_xref="GOA:D8JMZ0"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMZ0"
FT                   /protein_id="ADI89322.1"
FT   gene            456592..456867
FT                   /gene="rpsS"
FT                   /locus_tag="AOLE_02110"
FT   CDS_pept        456592..456867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="AOLE_02110"
FT                   /product="30S ribosomal protein S19"
FT                   /note="COG0185 Ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02110"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89323"
FT                   /db_xref="GOA:D8JMZ1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMZ1"
FT                   /protein_id="ADI89323.1"
FT   gene            456879..457208
FT                   /gene="rplV"
FT                   /locus_tag="AOLE_02115"
FT   CDS_pept        456879..457208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="AOLE_02115"
FT                   /product="50S ribosomal protein L22"
FT                   /note="COG0091 Ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02115"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89324"
FT                   /db_xref="GOA:D8JMZ2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMZ2"
FT                   /protein_id="ADI89324.1"
FT                   VKVGV"
FT   gene            457210..457962
FT                   /gene="rpsC"
FT                   /locus_tag="AOLE_02120"
FT   CDS_pept        457210..457962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="AOLE_02120"
FT                   /product="30S ribosomal protein S3"
FT                   /note="COG0092 Ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02120"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89325"
FT                   /db_xref="GOA:D8JMZ3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMZ3"
FT                   /protein_id="ADI89325.1"
FT   gene            457966..458379
FT                   /gene="rplP"
FT                   /locus_tag="AOLE_02125"
FT   CDS_pept        457966..458379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="AOLE_02125"
FT                   /product="50S ribosomal protein L16"
FT                   /note="COG0197 Ribosomal protein L16/L10E"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02125"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89326"
FT                   /db_xref="GOA:D8JMZ4"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMZ4"
FT                   /protein_id="ADI89326.1"
FT   gene            458379..458576
FT                   /locus_tag="AOLE_02130"
FT   CDS_pept        458379..458576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02130"
FT                   /product="50S ribosomal protein L29"
FT                   /note="COG0255 Ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02130"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89327"
FT                   /db_xref="GOA:D8JMZ5"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMZ5"
FT                   /protein_id="ADI89327.1"
FT   gene            458573..458830
FT                   /gene="rpsQ"
FT                   /locus_tag="AOLE_02135"
FT   CDS_pept        458573..458830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="AOLE_02135"
FT                   /product="30S ribosomal protein S17"
FT                   /note="COG0186 Ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02135"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89328"
FT                   /db_xref="GOA:D8JMZ6"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMZ6"
FT                   /protein_id="ADI89328.1"
FT   gene            458923..459291
FT                   /gene="rplN"
FT                   /locus_tag="AOLE_02140"
FT   CDS_pept        458923..459291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="AOLE_02140"
FT                   /product="50S ribosomal protein L14"
FT                   /note="COG0093 Ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89329"
FT                   /db_xref="GOA:D8JMZ7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMZ7"
FT                   /protein_id="ADI89329.1"
FT                   ELRTEQFMKIISLAPEVL"
FT   gene            459301..459618
FT                   /gene="rplX"
FT                   /locus_tag="AOLE_02145"
FT   CDS_pept        459301..459618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="AOLE_02145"
FT                   /product="50S ribosomal protein L24"
FT                   /note="COG0198 Ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02145"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89330"
FT                   /db_xref="GOA:D8JMZ8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMZ8"
FT                   /protein_id="ADI89330.1"
FT                   K"
FT   gene            459634..460170
FT                   /gene="rplE"
FT                   /locus_tag="AOLE_02150"
FT   CDS_pept        459634..460170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="AOLE_02150"
FT                   /product="50S ribosomal protein L5"
FT                   /note="COG0094 Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02150"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89331"
FT                   /db_xref="GOA:D8JMZ9"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D8JMZ9"
FT                   /protein_id="ADI89331.1"
FT                   DEGRALMRAFGFPFK"
FT   gene            460180..460485
FT                   /gene="rpsN"
FT                   /locus_tag="AOLE_02155"
FT   CDS_pept        460180..460485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="AOLE_02155"
FT                   /product="30S ribosomal protein S14"
FT                   /note="COG0199 Ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02155"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89332"
FT                   /db_xref="GOA:D8JN00"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN00"
FT                   /protein_id="ADI89332.1"
FT   gene            460497..460892
FT                   /gene="rpsH"
FT                   /locus_tag="AOLE_02160"
FT   CDS_pept        460497..460892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="AOLE_02160"
FT                   /product="30S ribosomal protein S8"
FT                   /note="COG0096 Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02160"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89333"
FT                   /db_xref="GOA:D8JN01"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN01"
FT                   /protein_id="ADI89333.1"
FT   gene            460906..461439
FT                   /gene="rplF"
FT                   /locus_tag="AOLE_02165"
FT   CDS_pept        460906..461439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="AOLE_02165"
FT                   /product="50S ribosomal protein L6"
FT                   /note="COG0097 Ribosomal protein L6P/L9E"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02165"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89334"
FT                   /db_xref="GOA:D8JN02"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN02"
FT                   /protein_id="ADI89334.1"
FT                   YSDEVILRKEAKKK"
FT   gene            461454..461804
FT                   /gene="rplR"
FT                   /locus_tag="AOLE_02170"
FT   CDS_pept        461454..461804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="AOLE_02170"
FT                   /product="50S ribosomal protein L18"
FT                   /note="COG0256 Ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02170"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89335"
FT                   /db_xref="GOA:D8JN03"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN03"
FT                   /protein_id="ADI89335.1"
FT                   LADAARENGLEF"
FT   gene            461807..462304
FT                   /gene="rpsE"
FT                   /locus_tag="AOLE_02175"
FT   CDS_pept        461807..462304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="AOLE_02175"
FT                   /product="30S ribosomal protein S5"
FT                   /note="COG0098 Ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02175"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89336"
FT                   /db_xref="GOA:D8JN04"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN04"
FT                   /protein_id="ADI89336.1"
FT                   QG"
FT   gene            462311..462487
FT                   /gene="rpmD"
FT                   /locus_tag="AOLE_02180"
FT   CDS_pept        462311..462487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="AOLE_02180"
FT                   /product="50S ribosomal protein L30"
FT                   /note="COG1841 Ribosomal protein L30/L7E"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02180"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89337"
FT                   /db_xref="GOA:D8JN05"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN05"
FT                   /protein_id="ADI89337.1"
FT                   MINKVYYMVSVEE"
FT   gene            462491..462931
FT                   /gene="rplO"
FT                   /locus_tag="AOLE_02185"
FT   CDS_pept        462491..462931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="AOLE_02185"
FT                   /product="50S ribosomal protein L15"
FT                   /note="COG0200 Ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02185"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89338"
FT                   /db_xref="GOA:D8JN06"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN06"
FT                   /protein_id="ADI89338.1"
FT   gene            462938..464296
FT                   /gene="secY"
FT                   /locus_tag="AOLE_02190"
FT   CDS_pept        462938..464296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="AOLE_02190"
FT                   /product="preprotein translocase subunit SecY"
FT                   /note="COG0201 Preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89339"
FT                   /db_xref="GOA:D8JN07"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN07"
FT                   /protein_id="ADI89339.1"
FT   gene            464317..464433
FT                   /gene="rpmJ"
FT                   /locus_tag="AOLE_02195"
FT   CDS_pept        464317..464433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="AOLE_02195"
FT                   /product="50S ribosomal protein L36"
FT                   /note="COG0257 Ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02195"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89340"
FT                   /db_xref="GOA:D8JN08"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN08"
FT                   /protein_id="ADI89340.1"
FT   gene            464539..464895
FT                   /gene="rpsM"
FT                   /locus_tag="AOLE_02200"
FT   CDS_pept        464539..464895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="AOLE_02200"
FT                   /product="30S ribosomal protein S13"
FT                   /note="COG0099 Ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89341"
FT                   /db_xref="GOA:D8JN09"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN09"
FT                   /protein_id="ADI89341.1"
FT                   NARTRKGPRKPIKK"
FT   gene            464915..465301
FT                   /locus_tag="AOLE_02205"
FT   CDS_pept        464915..465301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02205"
FT                   /product="30S ribosomal protein S11"
FT                   /note="COG0100 Ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02205"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89342"
FT                   /db_xref="GOA:D8JN10"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN10"
FT                   /protein_id="ADI89342.1"
FT   gene            465314..465940
FT                   /gene="rpsD"
FT                   /locus_tag="AOLE_02210"
FT   CDS_pept        465314..465940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="AOLE_02210"
FT                   /product="30S ribosomal protein S4"
FT                   /note="COG0522 Ribosomal protein S4 and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02210"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89343"
FT                   /db_xref="GOA:D8JN11"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN11"
FT                   /protein_id="ADI89343.1"
FT   gene            465958..466965
FT                   /locus_tag="AOLE_02215"
FT   CDS_pept        465958..466965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02215"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number=""
FT                   /note="COG0202 DNA-directed RNA polymerase, alpha
FT                   subunit/40 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02215"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89344"
FT                   /db_xref="GOA:D8JN12"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN12"
FT                   /protein_id="ADI89344.1"
FT   gene            466984..467361
FT                   /gene="rplQ"
FT                   /locus_tag="AOLE_02220"
FT   CDS_pept        466984..467361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="AOLE_02220"
FT                   /product="50S ribosomal protein L17"
FT                   /note="COG0203 Ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02220"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89345"
FT                   /db_xref="GOA:D8JN13"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN13"
FT                   /protein_id="ADI89345.1"
FT   gene            467543..469033
FT                   /locus_tag="AOLE_02225"
FT   CDS_pept        467543..469033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02225"
FT                   /product="hypothetical protein"
FT                   /note="COG2072 Predicted flavoprotein involved in K+
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02225"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89346"
FT                   /db_xref="GOA:D8JN14"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN14"
FT                   /protein_id="ADI89346.1"
FT   gene            complement(469085..470257)
FT                   /locus_tag="AOLE_02230"
FT   CDS_pept        complement(469085..470257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02230"
FT                   /product="acyl coenzyme A dehydrogenase"
FT                   /note="COG1960 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02230"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89347"
FT                   /db_xref="GOA:D8JN15"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN15"
FT                   /protein_id="ADI89347.1"
FT   gene            470447..470704
FT                   /locus_tag="AOLE_02235"
FT   CDS_pept        470447..470704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02235"
FT                   /product="hypothetical protein"
FT                   /note="COG2938 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02235"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89348"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN16"
FT                   /protein_id="ADI89348.1"
FT   gene            470819..471100
FT                   /locus_tag="AOLE_02240"
FT   CDS_pept        470819..471100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02240"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89349"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN17"
FT                   /protein_id="ADI89349.1"
FT   gene            471536..471637
FT                   /locus_tag="AOLE_02245"
FT   CDS_pept        471536..471637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02245"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89350"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN18"
FT                   /protein_id="ADI89350.1"
FT   gene            471870..472958
FT                   /locus_tag="AOLE_02250"
FT   CDS_pept        471870..472958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02250"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89351"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN19"
FT                   /protein_id="ADI89351.1"
FT   gene            473042..473617
FT                   /locus_tag="AOLE_02255"
FT   CDS_pept        473042..473617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02255"
FT                   /product="uncharacterized membrane protein"
FT                   /note="COG0705 Uncharacterized membrane protein (homolog of
FT                   Drosophila rhomboid)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02255"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89352"
FT                   /db_xref="GOA:D8JN20"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023826"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN20"
FT                   /protein_id="ADI89352.1"
FT   gene            473795..475990
FT                   /locus_tag="AOLE_02260"
FT   CDS_pept        473795..475990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02260"
FT                   /product="DctM-like transporters family protein"
FT                   /note="COG1593 TRAP-type C4-dicarboxylate transport system,
FT                   large permease component"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02260"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89353"
FT                   /db_xref="GOA:D8JN21"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN21"
FT                   /protein_id="ADI89353.1"
FT   gene            complement(476152..476577)
FT                   /locus_tag="AOLE_02265"
FT   CDS_pept        complement(476152..476577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02265"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89354"
FT                   /db_xref="GOA:D8JN22"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN22"
FT                   /protein_id="ADI89354.1"
FT   gene            complement(476589..476798)
FT                   /locus_tag="AOLE_02270"
FT   CDS_pept        complement(476589..476798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02270"
FT                   /product="hypothetical protein"
FT                   /note="COG3529 Predicted nucleic-acid-binding protein
FT                   containing a Zn-ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02270"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89355"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN23"
FT                   /protein_id="ADI89355.1"
FT   gene            complement(476839..478893)
FT                   /locus_tag="AOLE_02275"
FT   CDS_pept        complement(476839..478893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02275"
FT                   /product="oligopeptidase A"
FT                   /note="COG0339 Zn-dependent oligopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02275"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89356"
FT                   /db_xref="GOA:D8JN24"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN24"
FT                   /protein_id="ADI89356.1"
FT   gene            complement(479028..481442)
FT                   /locus_tag="AOLE_02280"
FT   CDS_pept        complement(479028..481442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02280"
FT                   /product="exoribonuclease R"
FT                   /note="COG0557 Exoribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02280"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89357"
FT                   /db_xref="GOA:D8JN25"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN25"
FT                   /protein_id="ADI89357.1"
FT   gene            481704..481794
FT                   /locus_tag="AOLE_t19502"
FT   tRNA            481704..481794
FT                   /locus_tag="AOLE_t19502"
FT                   /product="tRNA-Ser"
FT   gene            481805..481881
FT                   /locus_tag="AOLE_t19504"
FT   tRNA            481805..481881
FT                   /locus_tag="AOLE_t19504"
FT                   /product="tRNA-Arg"
FT   gene            481921..481997
FT                   /locus_tag="AOLE_t19506"
FT   tRNA            481921..481997
FT                   /locus_tag="AOLE_t19506"
FT                   /product="tRNA-Arg"
FT   gene            482104..482697
FT                   /locus_tag="AOLE_02285"
FT   CDS_pept        482104..482697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02285"
FT                   /product="HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like) family protein"
FT                   /note="COG0560 Phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02285"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89358"
FT                   /db_xref="GOA:D8JN26"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN26"
FT                   /protein_id="ADI89358.1"
FT   gene            complement(482768..484954)
FT                   /locus_tag="AOLE_02290"
FT   CDS_pept        complement(482768..484954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02290"
FT                   /product="Outer membrane protein A precursor (190 kDa
FT                   antigen)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02290"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89359"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN27"
FT                   /protein_id="ADI89359.1"
FT   gene            485535..485611
FT                   /locus_tag="AOLE_t19508"
FT   tRNA            485535..485611
FT                   /locus_tag="AOLE_t19508"
FT                   /product="tRNA-Arg"
FT   gene            complement(485725..486417)
FT                   /locus_tag="AOLE_02295"
FT   CDS_pept        complement(485725..486417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02295"
FT                   /product="nitroreductase-like oxidoreductase"
FT                   /note="COG3560 Predicted oxidoreductase related to
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02295"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89360"
FT                   /db_xref="GOA:D8JN28"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033877"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN28"
FT                   /protein_id="ADI89360.1"
FT                   ENRFKTFG"
FT   gene            486641..487138
FT                   /locus_tag="AOLE_02300"
FT   CDS_pept        486641..487138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02300"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89361"
FT                   /db_xref="GOA:D8JN29"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN29"
FT                   /protein_id="ADI89361.1"
FT                   KK"
FT   gene            487178..487819
FT                   /locus_tag="AOLE_02305"
FT   CDS_pept        487178..487819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02305"
FT                   /product="2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
FT                   (catechol pathway)"
FT                   /note="COG0179 2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
FT                   (catechol pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02305"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89362"
FT                   /db_xref="GOA:D8JN30"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN30"
FT                   /protein_id="ADI89362.1"
FT   gene            complement(487925..489172)
FT                   /locus_tag="AOLE_02310"
FT   CDS_pept        complement(487925..489172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02310"
FT                   /product="tRNA-processing ribonuclease BN(RNase BN)"
FT                   /note="COG1295 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02310"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89363"
FT                   /db_xref="GOA:D8JN31"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN31"
FT                   /protein_id="ADI89363.1"
FT                   LAAKLSIPLSTIFEEK"
FT   gene            489542..490141
FT                   /locus_tag="AOLE_02315"
FT   CDS_pept        489542..490141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02315"
FT                   /product="NAD(P)H:quinone oxidoreductase, type IV"
FT                   /note="COG0655 Multimeric flavodoxin WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02315"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89364"
FT                   /db_xref="GOA:D8JN32"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN32"
FT                   /protein_id="ADI89364.1"
FT   gene            complement(490190..490765)
FT                   /locus_tag="AOLE_02320"
FT   CDS_pept        complement(490190..490765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02320"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="COG0503 Adenine/guanine phosphoribosyltransferases
FT                   and related PRPP-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02320"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89365"
FT                   /db_xref="GOA:D8JN33"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN33"
FT                   /protein_id="ADI89365.1"
FT   gene            complement(490837..491550)
FT                   /locus_tag="AOLE_02325"
FT   CDS_pept        complement(490837..491550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02325"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89366"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN34"
FT                   /protein_id="ADI89366.1"
FT                   TSYGLLLTSYTGKTN"
FT   gene            complement(491709..492380)
FT                   /locus_tag="AOLE_02330"
FT   CDS_pept        complement(491709..492380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02330"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89367"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN35"
FT                   /protein_id="ADI89367.1"
FT                   A"
FT   gene            492613..493497
FT                   /locus_tag="AOLE_02335"
FT   CDS_pept        492613..493497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02335"
FT                   /product="hypothetical protein"
FT                   /note="COG0810 Periplasmic protein TonB, links inner and
FT                   outer membranes"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02335"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89368"
FT                   /db_xref="GOA:D8JN36"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN36"
FT                   /protein_id="ADI89368.1"
FT                   WRFDPAQAEFEVH"
FT   gene            complement(493598..494080)
FT                   /locus_tag="AOLE_02340"
FT   CDS_pept        complement(493598..494080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02340"
FT                   /product="metal-dependent hydrolase"
FT                   /note="COG0319 Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02340"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89369"
FT                   /db_xref="GOA:D8JN37"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN37"
FT                   /protein_id="ADI89369.1"
FT   gene            complement(494090..495178)
FT                   /locus_tag="AOLE_02345"
FT   CDS_pept        complement(494090..495178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02345"
FT                   /product="phosphate starvation-inducible protein"
FT                   /note="COG1702 Phosphate starvation-inducible protein PhoH,
FT                   predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02345"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89370"
FT                   /db_xref="GOA:D8JN38"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN38"
FT                   /protein_id="ADI89370.1"
FT   gene            complement(495216..496667)
FT                   /locus_tag="AOLE_02350"
FT   CDS_pept        complement(495216..496667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02350"
FT                   /product="(dimethylallyl)adenosine tRNA
FT                   methylthiotransferase"
FT                   /note="COG0621 2-methylthioadenine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02350"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89371"
FT                   /db_xref="GOA:D8JN39"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN39"
FT                   /protein_id="ADI89371.1"
FT   gene            496970..498898
FT                   /locus_tag="AOLE_02355"
FT   CDS_pept        496970..498898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02355"
FT                   /product="soluble lytic murein transglycosylase, related
FT                   regulatory protein"
FT                   /note="COG0741 Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02355"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89372"
FT                   /db_xref="GOA:D8JN40"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN40"
FT                   /protein_id="ADI89372.1"
FT                   IPMRTSP"
FT   gene            498970..499617
FT                   /locus_tag="AOLE_02360"
FT   CDS_pept        498970..499617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02360"
FT                   /product="ribonuclease I"
FT                   /note="COG3719 Ribonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02360"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89373"
FT                   /db_xref="GOA:D8JN41"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN41"
FT                   /protein_id="ADI89373.1"
FT   gene            499829..500815
FT                   /locus_tag="AOLE_02365"
FT   CDS_pept        499829..500815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02365"
FT                   /product="malate dehydrogenase"
FT                   /EC_number=""
FT                   /note="COG0039 Malate/lactate dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02365"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89374"
FT                   /db_xref="GOA:D8JN42"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN42"
FT                   /protein_id="ADI89374.1"
FT   gene            500992..501237
FT                   /locus_tag="AOLE_02370"
FT   CDS_pept        500992..501237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02370"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89375"
FT                   /db_xref="InterPro:IPR021250"
FT                   /db_xref="InterPro:IPR038086"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN43"
FT                   /protein_id="ADI89375.1"
FT   gene            complement(501301..501828)
FT                   /locus_tag="AOLE_02375"
FT   CDS_pept        complement(501301..501828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02375"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89376"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN44"
FT                   /protein_id="ADI89376.1"
FT                   PWYKDQLKIKTH"
FT   gene            complement(501896..502501)
FT                   /locus_tag="AOLE_02380"
FT   CDS_pept        complement(501896..502501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02380"
FT                   /product="proline hydroxylase"
FT                   /note="COG3751 Predicted proline hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02380"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89377"
FT                   /db_xref="GOA:D8JN45"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN45"
FT                   /protein_id="ADI89377.1"
FT   gene            502619..503476
FT                   /locus_tag="AOLE_02385"
FT   CDS_pept        502619..503476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02385"
FT                   /product="hypothetical protein"
FT                   /note="COG2961 Protein involved in catabolism of external
FT                   DNA"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02385"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89378"
FT                   /db_xref="GOA:D8JN46"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN46"
FT                   /protein_id="ADI89378.1"
FT                   LVGE"
FT   gene            503518..504351
FT                   /locus_tag="AOLE_02390"
FT   CDS_pept        503518..504351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02390"
FT                   /product="phosphatidylserine synthase"
FT                   /note="COG1183 Phosphatidylserine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02390"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89379"
FT                   /db_xref="GOA:D8JN47"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN47"
FT                   /protein_id="ADI89379.1"
FT   gene            504369..505436
FT                   /locus_tag="AOLE_02395"
FT   CDS_pept        504369..505436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02395"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89380"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN48"
FT                   /protein_id="ADI89380.1"
FT                   ILDKLMLLQPCLYKK"
FT   gene            505901..507437
FT                   /locus_tag="AOLE_r19638"
FT   rRNA            505901..507437
FT                   /locus_tag="AOLE_r19638"
FT                   /product="16S ribosomal RNA"
FT   gene            507497..507573
FT                   /locus_tag="AOLE_t19510"
FT   tRNA            507497..507573
FT                   /locus_tag="AOLE_t19510"
FT                   /product="tRNA-Ile"
FT   gene            507629..507704
FT                   /locus_tag="AOLE_t19512"
FT   tRNA            507629..507704
FT                   /locus_tag="AOLE_t19512"
FT                   /product="tRNA-Ala"
FT   gene            508057..510959
FT                   /locus_tag="AOLE_r19650"
FT   rRNA            508057..510959
FT                   /locus_tag="AOLE_r19650"
FT                   /product="23S ribosomal RNA"
FT   gene            511129..511243
FT                   /locus_tag="AOLE_r19626"
FT   rRNA            511129..511243
FT                   /locus_tag="AOLE_r19626"
FT                   /product="5S ribosomal RNA"
FT   gene            511521..511871
FT                   /locus_tag="AOLE_02400"
FT   CDS_pept        511521..511871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02400"
FT                   /product="Glutathione-dependent formaldehyde-activating
FT                   enzyme family protein"
FT                   /note="COG3791 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02400"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89381"
FT                   /db_xref="GOA:D8JN49"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN49"
FT                   /protein_id="ADI89381.1"
FT                   KIKINYFDGRSV"
FT   gene            511892..512455
FT                   /locus_tag="AOLE_02405"
FT   CDS_pept        511892..512455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02405"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89382"
FT                   /db_xref="InterPro:IPR025352"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN50"
FT                   /protein_id="ADI89382.1"
FT   gene            512592..513755
FT                   /locus_tag="AOLE_02410"
FT   CDS_pept        512592..513755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02410"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /note="COG1960 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89383"
FT                   /db_xref="GOA:D8JN51"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN51"
FT                   /protein_id="ADI89383.1"
FT   gene            complement(513799..514299)
FT                   /locus_tag="AOLE_02415"
FT   CDS_pept        complement(513799..514299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02415"
FT                   /product="acetyltransferase, GNAT family protein"
FT                   /note="COG1670 Acetyltransferases, including N-acetylases
FT                   of ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02415"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89384"
FT                   /db_xref="GOA:D8JN52"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN52"
FT                   /protein_id="ADI89384.1"
FT                   PSQ"
FT   gene            complement(514296..514895)
FT                   /locus_tag="AOLE_02420"
FT   CDS_pept        complement(514296..514895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02420"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02420"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89385"
FT                   /db_xref="GOA:D8JN53"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN53"
FT                   /protein_id="ADI89385.1"
FT   gene            515081..516886
FT                   /locus_tag="AOLE_02425"
FT   CDS_pept        515081..516886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02425"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89386"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN54"
FT                   /protein_id="ADI89386.1"
FT   gene            516892..517794
FT                   /locus_tag="AOLE_02430"
FT   CDS_pept        516892..517794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02430"
FT                   /product="dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02430"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89387"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN55"
FT                   /protein_id="ADI89387.1"
FT   gene            517797..519410
FT                   /locus_tag="AOLE_02435"
FT   CDS_pept        517797..519410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02435"
FT                   /product="Carboxyl transferase domain protein"
FT                   /note="COG4799 Acetyl-CoA carboxylase, carboxyltransferase
FT                   component (subunits alpha and beta)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02435"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89388"
FT                   /db_xref="GOA:D8JN56"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN56"
FT                   /protein_id="ADI89388.1"
FT   gene            519453..520610
FT                   /locus_tag="AOLE_02440"
FT   CDS_pept        519453..520610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02440"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /note="COG1960 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02440"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89389"
FT                   /db_xref="GOA:D8JN57"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN57"
FT                   /protein_id="ADI89389.1"
FT   gene            520627..521463
FT                   /locus_tag="AOLE_02445"
FT   CDS_pept        520627..521463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02445"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="COG1024 Enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02445"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89390"
FT                   /db_xref="GOA:D8JN58"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN58"
FT                   /protein_id="ADI89390.1"
FT   gene            521482..523422
FT                   /locus_tag="AOLE_02450"
FT   CDS_pept        521482..523422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02450"
FT                   /product="3-methylcrotonyl-CoA carboxylase alpha subunit"
FT                   /note="COG4770 Acetyl/propionyl-CoA carboxylase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89391"
FT                   /db_xref="GOA:D8JN59"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN59"
FT                   /protein_id="ADI89391.1"
FT                   KKRQMLFSIQI"
FT   gene            complement(523475..523894)
FT                   /locus_tag="AOLE_02455"
FT   CDS_pept        complement(523475..523894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02455"
FT                   /product="hypothetical protein"
FT                   /note="COG2018 Uncharacterized distant relative of homeotic
FT                   protein bithoraxoid"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02455"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89392"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN60"
FT                   /protein_id="ADI89392.1"
FT   gene            complement(523887..524447)
FT                   /locus_tag="AOLE_02460"
FT   CDS_pept        complement(523887..524447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02460"
FT                   /product="hypothetical protein"
FT                   /note="COG2229 Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02460"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89393"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN61"
FT                   /protein_id="ADI89393.1"
FT   gene            complement(524456..525421)
FT                   /locus_tag="AOLE_02465"
FT   CDS_pept        complement(524456..525421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02465"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89394"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN62"
FT                   /protein_id="ADI89394.1"
FT   gene            complement(525505..525864)
FT                   /locus_tag="AOLE_02470"
FT   CDS_pept        complement(525505..525864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02470"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89395"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN63"
FT                   /protein_id="ADI89395.1"
FT                   ARHELKSFEKELDFS"
FT   gene            complement(526203..526859)
FT                   /locus_tag="AOLE_02475"
FT   CDS_pept        complement(526203..526859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02475"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89396"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN64"
FT                   /protein_id="ADI89396.1"
FT   gene            complement(526877..527311)
FT                   /locus_tag="AOLE_02480"
FT   CDS_pept        complement(526877..527311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02480"
FT                   /product="ClpXP protease specificity-enhancing factor"
FT                   /note="COG2969 Stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02480"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89397"
FT                   /db_xref="GOA:D8JN65"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN65"
FT                   /protein_id="ADI89397.1"
FT   gene            complement(527318..527971)
FT                   /locus_tag="AOLE_02485"
FT   CDS_pept        complement(527318..527971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02485"
FT                   /product="stringent starvation protein A"
FT                   /note="COG0625 Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02485"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89398"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN66"
FT                   /protein_id="ADI89398.1"
FT   gene            complement(528146..528532)
FT                   /locus_tag="AOLE_02490"
FT   CDS_pept        complement(528146..528532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02490"
FT                   /product="30S ribosomal protein S9"
FT                   /note="COG0103 Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89399"
FT                   /db_xref="GOA:D8JN67"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN67"
FT                   /protein_id="ADI89399.1"
FT   gene            complement(528545..528973)
FT                   /gene="rplM"
FT                   /locus_tag="AOLE_02495"
FT   CDS_pept        complement(528545..528973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="AOLE_02495"
FT                   /product="50S ribosomal protein L13"
FT                   /note="COG0102 Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02495"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89400"
FT                   /db_xref="GOA:D8JN68"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN68"
FT                   /protein_id="ADI89400.1"
FT   gene            529156..530130
FT                   /locus_tag="AOLE_02500"
FT   CDS_pept        529156..530130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02500"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /note="COG1995 Pyridoxal phosphate biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02500"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89401"
FT                   /db_xref="GOA:D8JN69"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN69"
FT                   /protein_id="ADI89401.1"
FT   gene            530154..530966
FT                   /gene="ksgA"
FT                   /locus_tag="AOLE_02505"
FT   CDS_pept        530154..530966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="AOLE_02505"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG0030 Dimethyladenosine transferase (rRNA
FT                   methylation)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02505"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89402"
FT                   /db_xref="GOA:D8JN70"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN70"
FT                   /protein_id="ADI89402.1"
FT   gene            530967..531806
FT                   /gene="apaH"
FT                   /locus_tag="AOLE_02510"
FT   CDS_pept        530967..531806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="AOLE_02510"
FT                   /product="diadenosine tetraphosphatase"
FT                   /EC_number=""
FT                   /note="COG0639 Diadenosine tetraphosphatase and related
FT                   serine/threonine protein phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02510"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89403"
FT                   /db_xref="GOA:D8JN71"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN71"
FT                   /protein_id="ADI89403.1"
FT   gene            complement(531845..532288)
FT                   /locus_tag="AOLE_02515"
FT   CDS_pept        complement(531845..532288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02515"
FT                   /product="putative signal peptide-containing protein"
FT                   /note="COG4731 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02515"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89404"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN72"
FT                   /protein_id="ADI89404.1"
FT   gene            complement(532371..533045)
FT                   /locus_tag="AOLE_02520"
FT   CDS_pept        complement(532371..533045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02520"
FT                   /product="LrgB-like family protein"
FT                   /note="COG1346 Putative effector of murein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02520"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89405"
FT                   /db_xref="GOA:D8JN73"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN73"
FT                   /protein_id="ADI89405.1"
FT                   TP"
FT   gene            complement(533056..533427)
FT                   /locus_tag="AOLE_02525"
FT   CDS_pept        complement(533056..533427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02525"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89406"
FT                   /db_xref="GOA:D8JN74"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN74"
FT                   /protein_id="ADI89406.1"
FT   gene            complement(533461..534804)
FT                   /locus_tag="AOLE_02530"
FT   CDS_pept        complement(533461..534804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02530"
FT                   /product="GTP-binding proten HflX"
FT                   /note="COG2262 GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02530"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89407"
FT                   /db_xref="GOA:D8JN75"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN75"
FT                   /protein_id="ADI89407.1"
FT   gene            535020..535829
FT                   /locus_tag="AOLE_02535"
FT   CDS_pept        535020..535829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02535"
FT                   /product="putative acyltransferase"
FT                   /note="COG0204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02535"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89408"
FT                   /db_xref="GOA:D8JN76"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN76"
FT                   /protein_id="ADI89408.1"
FT   gene            complement(535830..537455)
FT                   /locus_tag="AOLE_02540"
FT   CDS_pept        complement(535830..537455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02540"
FT                   /product="putative phospholipase D protein"
FT                   /note="COG1502
FT                   Phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthases and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02540"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89409"
FT                   /db_xref="GOA:D8JN77"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN77"
FT                   /protein_id="ADI89409.1"
FT   gene            537562..538572
FT                   /locus_tag="AOLE_02545"
FT   CDS_pept        537562..538572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02545"
FT                   /product="phosphohydrolase"
FT                   /note="COG1408 Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02545"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89410"
FT                   /db_xref="GOA:D8JN78"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN78"
FT                   /protein_id="ADI89410.1"
FT   gene            complement(538623..539102)
FT                   /locus_tag="AOLE_02550"
FT   CDS_pept        complement(538623..539102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02550"
FT                   /product="Outer membrane protein A precursor"
FT                   /note="COG2885 Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02550"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89411"
FT                   /db_xref="GOA:D8JN79"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN79"
FT                   /protein_id="ADI89411.1"
FT   gene            complement(539117..540340)
FT                   /locus_tag="AOLE_02555"
FT   CDS_pept        complement(539117..540340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02555"
FT                   /product="hypothetical protein"
FT                   /note="COG2199 FOG: GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02555"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89412"
FT                   /db_xref="GOA:D8JN80"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033417"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN80"
FT                   /protein_id="ADI89412.1"
FT                   WFIYKPEN"
FT   gene            complement(540346..540807)
FT                   /locus_tag="AOLE_02560"
FT   CDS_pept        complement(540346..540807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02560"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89413"
FT                   /db_xref="InterPro:IPR025293"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN81"
FT                   /protein_id="ADI89413.1"
FT   gene            541433..542969
FT                   /locus_tag="AOLE_r19640"
FT   rRNA            541433..542969
FT                   /locus_tag="AOLE_r19640"
FT                   /product="16S ribosomal RNA"
FT   gene            543029..543105
FT                   /locus_tag="AOLE_t19514"
FT   tRNA            543029..543105
FT                   /locus_tag="AOLE_t19514"
FT                   /product="tRNA-Ile"
FT   gene            543161..543236
FT                   /locus_tag="AOLE_t19516"
FT   tRNA            543161..543236
FT                   /locus_tag="AOLE_t19516"
FT                   /product="tRNA-Ala"
FT   gene            543589..546491
FT                   /locus_tag="AOLE_r19652"
FT   rRNA            543589..546491
FT                   /locus_tag="AOLE_r19652"
FT                   /product="23S ribosomal RNA"
FT   gene            546661..546775
FT                   /locus_tag="AOLE_r19628"
FT   rRNA            546661..546775
FT                   /locus_tag="AOLE_r19628"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(546900..548273)
FT                   /locus_tag="AOLE_02565"
FT   CDS_pept        complement(546900..548273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02565"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number=""
FT                   /note="COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02565"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89414"
FT                   /db_xref="GOA:D8JN82"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN82"
FT                   /protein_id="ADI89414.1"
FT   gene            complement(548356..549552)
FT                   /locus_tag="AOLE_02570"
FT   CDS_pept        complement(548356..549552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02570"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89415"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN83"
FT                   /protein_id="ADI89415.1"
FT   gene            complement(549918..550253)
FT                   /locus_tag="AOLE_02575"
FT   CDS_pept        complement(549918..550253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02575"
FT                   /product="hypothetical protein"
FT                   /note="COG3453 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02575"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89416"
FT                   /db_xref="GOA:D8JN84"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN84"
FT                   /protein_id="ADI89416.1"
FT                   QMDLLDD"
FT   gene            550443..551339
FT                   /locus_tag="AOLE_02580"
FT   CDS_pept        550443..551339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02580"
FT                   /product="hypothetical protein"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02580"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89417"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN85"
FT                   /protein_id="ADI89417.1"
FT                   KAVITQLEFLHQHIGVM"
FT   gene            551340..551777
FT                   /locus_tag="AOLE_02585"
FT   CDS_pept        551340..551777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02585"
FT                   /product="thioredoxin 2"
FT                   /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02585"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89418"
FT                   /db_xref="GOA:D8JN86"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN86"
FT                   /protein_id="ADI89418.1"
FT   gene            551779..552195
FT                   /locus_tag="AOLE_02590"
FT   CDS_pept        551779..552195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02590"
FT                   /product="Thioesterase superfamily protein"
FT                   /note="COG1607 Acyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02590"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89419"
FT                   /db_xref="GOA:D8JN87"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN87"
FT                   /protein_id="ADI89419.1"
FT   gene            complement(552266..552772)
FT                   /locus_tag="AOLE_02595"
FT   CDS_pept        complement(552266..552772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02595"
FT                   /product="hypothetical protein"
FT                   /note="COG4922 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02595"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89420"
FT                   /db_xref="GOA:D8JN88"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN88"
FT                   /protein_id="ADI89420.1"
FT                   TNTMF"
FT   gene            complement(552848..553342)
FT                   /locus_tag="AOLE_02600"
FT   CDS_pept        complement(552848..553342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02600"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89421"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D8JN89"
FT                   /protein_id="ADI89421.1"
FT                   K"
FT   gene            complement(553378..553866)
FT                   /locus_tag="AOLE_02605"
FT   CDS_pept        complement(553378..553866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02605"
FT                   /product="putative nucleotide-binding protein"
FT                   /note="COG1666 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02605"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89422"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNM5"
FT                   /protein_id="ADI89422.1"
FT   gene            553958..554272
FT                   /locus_tag="AOLE_02610"
FT   CDS_pept        553958..554272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02610"
FT                   /product="rhodanese domain protein"
FT                   /note="COG0607 Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02610"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89423"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNM6"
FT                   /protein_id="ADI89423.1"
FT                   "
FT   gene            complement(554310..556184)
FT                   /locus_tag="AOLE_02615"
FT   CDS_pept        complement(554310..556184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02615"
FT                   /product="tRNA 5-methylaminomethyl-2-thiouridine
FT                   biosynthesis bifunctional protein mnmC"
FT                   /note="COG4121 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02615"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89424"
FT                   /db_xref="GOA:D8JNM7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNM7"
FT                   /protein_id="ADI89424.1"
FT   gene            complement(556208..556675)
FT                   /locus_tag="AOLE_02620"
FT   CDS_pept        complement(556208..556675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02620"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89425"
FT                   /db_xref="GOA:D8JNM8"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNM8"
FT                   /protein_id="ADI89425.1"
FT   gene            complement(556680..556982)
FT                   /locus_tag="AOLE_02625"
FT   CDS_pept        complement(556680..556982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02625"
FT                   /product="YciI-like protein"
FT                   /note="COG2350 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02625"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89426"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNM9"
FT                   /protein_id="ADI89426.1"
FT   gene            complement(557017..557631)
FT                   /locus_tag="AOLE_02630"
FT   CDS_pept        complement(557017..557631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02630"
FT                   /product="intracellular septation protein A"
FT                   /note="COG2917 Intracellular septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89427"
FT                   /db_xref="GOA:D8JNN0"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNN0"
FT                   /protein_id="ADI89427.1"
FT   gene            557676..558527
FT                   /locus_tag="AOLE_02635"
FT   CDS_pept        557676..558527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02635"
FT                   /product="PHP domain protein"
FT                   /note="COG0613 Predicted metal-dependent phosphoesterases
FT                   (PHP family)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02635"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89428"
FT                   /db_xref="GOA:D8JNN1"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNN1"
FT                   /protein_id="ADI89428.1"
FT                   FL"
FT   gene            complement(558534..559352)
FT                   /locus_tag="AOLE_02640"
FT   CDS_pept        complement(558534..559352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02640"
FT                   /product="hypothetical protein"
FT                   /note="COG3781 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02640"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89429"
FT                   /db_xref="GOA:D8JNN2"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNN2"
FT                   /protein_id="ADI89429.1"
FT   gene            complement(559507..560214)
FT                   /locus_tag="AOLE_02645"
FT   CDS_pept        complement(559507..560214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02645"
FT                   /product="DNA repair protein RadC"
FT                   /note="COG2003 DNA repair proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02645"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89430"
FT                   /db_xref="GOA:D8JNN3"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNN3"
FT                   /protein_id="ADI89430.1"
FT                   EQQLLNPAAISVQ"
FT   gene            560326..561579
FT                   /locus_tag="AOLE_02650"
FT   CDS_pept        560326..561579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02650"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /note="COG0452 Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02650"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89431"
FT                   /db_xref="GOA:D8JNN4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNN4"
FT                   /protein_id="ADI89431.1"
FT                   QEISQQLVEAISDALRRK"
FT   gene            complement(561647..562612)
FT                   /gene="secF"
FT                   /locus_tag="AOLE_02655"
FT   CDS_pept        complement(561647..562612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="AOLE_02655"
FT                   /product="preprotein translocase subunit SecF"
FT                   /note="COG0341 Preprotein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02655"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89432"
FT                   /db_xref="GOA:D8JNN5"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNN5"
FT                   /protein_id="ADI89432.1"
FT   gene            complement(562621..564522)
FT                   /gene="secD"
FT                   /locus_tag="AOLE_02660"
FT   CDS_pept        complement(562621..564522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="AOLE_02660"
FT                   /product="preprotein translocase subunit SecD"
FT                   /note="COG0342 Preprotein translocase subunit SecD"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02660"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89433"
FT                   /db_xref="GOA:D8JNN6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNN6"
FT                   /protein_id="ADI89433.1"
FT   gene            complement(564574..564903)
FT                   /locus_tag="AOLE_02665"
FT   CDS_pept        complement(564574..564903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02665"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="COG1862 Preprotein translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02665"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89434"
FT                   /db_xref="GOA:D8JNN7"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNN7"
FT                   /protein_id="ADI89434.1"
FT                   TLNNL"
FT   gene            complement(565001..566134)
FT                   /gene="tgt"
FT                   /locus_tag="AOLE_02670"
FT   CDS_pept        complement(565001..566134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="AOLE_02670"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number=""
FT                   /note="COG0343 Queuine/archaeosine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02670"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89435"
FT                   /db_xref="GOA:D8JNN8"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNN8"
FT                   /protein_id="ADI89435.1"
FT   gene            complement(566288..566857)
FT                   /locus_tag="AOLE_02675"
FT   CDS_pept        complement(566288..566857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02675"
FT                   /product="hypothetical protein"
FT                   /note="COG1704 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02675"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89436"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNN9"
FT                   /protein_id="ADI89436.1"
FT   gene            complement(566940..567968)
FT                   /locus_tag="AOLE_02680"
FT   CDS_pept        complement(566940..567968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02680"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89437"
FT                   /db_xref="GOA:D8JNP0"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNP0"
FT                   /protein_id="ADI89437.1"
FT                   IK"
FT   gene            complement(568199..569236)
FT                   /gene="queA"
FT                   /locus_tag="AOLE_02685"
FT   CDS_pept        complement(568199..569236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="AOLE_02685"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /note="COG0809
FT                   S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
FT                   (queuine synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02685"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89438"
FT                   /db_xref="GOA:D8JNP1"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNP1"
FT                   /protein_id="ADI89438.1"
FT                   DKLDV"
FT   gene            569419..569505
FT                   /locus_tag="AOLE_t19518"
FT   tRNA            569419..569505
FT                   /locus_tag="AOLE_t19518"
FT                   /product="tRNA-Leu"
FT   gene            569834..570850
FT                   /locus_tag="AOLE_02690"
FT   CDS_pept        569834..570850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89439"
FT                   /db_xref="InterPro:IPR021330"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNP2"
FT                   /protein_id="ADI89439.1"
FT   gene            571172..572443
FT                   /locus_tag="AOLE_02695"
FT   CDS_pept        571172..572443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02695"
FT                   /product="Signal transduction histidine kinase"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02695"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89440"
FT                   /db_xref="GOA:D8JNP3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNP3"
FT                   /protein_id="ADI89440.1"
FT   gene            572511..575261
FT                   /locus_tag="AOLE_02700"
FT   CDS_pept        572511..575261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02700"
FT                   /product="bifunctional glutamine-synthetase
FT                   adenylyltransferase/deadenyltransferase"
FT                   /EC_number=""
FT                   /note="COG1391 Glutamine synthetase adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02700"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89441"
FT                   /db_xref="GOA:D8JNP4"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNP4"
FT                   /protein_id="ADI89441.1"
FT   gene            575286..576212
FT                   /locus_tag="AOLE_02705"
FT   CDS_pept        575286..576212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02705"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number=""
FT                   /note="COG0115 Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02705"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89442"
FT                   /db_xref="GOA:D8JNP5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNP5"
FT                   /protein_id="ADI89442.1"
FT   gene            576280..577170
FT                   /locus_tag="AOLE_02710"
FT   CDS_pept        576280..577170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02710"
FT                   /product="predicted nucleoside-diphosphate-sugar epimerase"
FT                   /note="COG3660 Predicted nucleoside-diphosphate-sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02710"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89443"
FT                   /db_xref="InterPro:IPR009367"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNP6"
FT                   /protein_id="ADI89443.1"
FT                   FKEADRVATYLLAKN"
FT   gene            577193..578221
FT                   /locus_tag="AOLE_02715"
FT   CDS_pept        577193..578221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02715"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89444"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNP7"
FT                   /protein_id="ADI89444.1"
FT                   YA"
FT   gene            578221..578973
FT                   /locus_tag="AOLE_02720"
FT   CDS_pept        578221..578973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02720"
FT                   /product="xylanase/chitin deacetylase"
FT                   /note="COG0726 Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89445"
FT                   /db_xref="GOA:D8JNP8"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNP8"
FT                   /protein_id="ADI89445.1"
FT   gene            578970..579737
FT                   /locus_tag="AOLE_02725"
FT   CDS_pept        578970..579737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02725"
FT                   /product="putative lipopolysaccharide core biosynthesis
FT                   glycosyl transferase LpsC"
FT                   /note="COG0463 Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02725"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89446"
FT                   /db_xref="GOA:D8JNP9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNP9"
FT                   /protein_id="ADI89446.1"
FT   gene            579745..580779
FT                   /locus_tag="AOLE_02730"
FT   CDS_pept        579745..580779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02730"
FT                   /product="glycosyltransferase"
FT                   /note="COG0438 Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02730"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89447"
FT                   /db_xref="GOA:D8JNQ0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNQ0"
FT                   /protein_id="ADI89447.1"
FT                   LLKT"
FT   gene            complement(580776..581666)
FT                   /locus_tag="AOLE_02735"
FT   CDS_pept        complement(580776..581666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02735"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89448"
FT                   /db_xref="GOA:D8JNQ1"
FT                   /db_xref="InterPro:IPR004263"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNQ1"
FT                   /protein_id="ADI89448.1"
FT                   NFVVLDAIRLTPKNN"
FT   gene            581735..582490
FT                   /locus_tag="AOLE_02740"
FT   CDS_pept        581735..582490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02740"
FT                   /product="putative glycosyltransferase involved in LPS
FT                   biosynthesis"
FT                   /note="COG3306 Glycosyltransferase involved in LPS
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02740"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89449"
FT                   /db_xref="GOA:D8JNQ2"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNQ2"
FT                   /protein_id="ADI89449.1"
FT   gene            582520..583449
FT                   /locus_tag="AOLE_02745"
FT   CDS_pept        582520..583449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02745"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89450"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNQ3"
FT                   /protein_id="ADI89450.1"
FT   gene            complement(583488..583706)
FT                   /locus_tag="AOLE_02750"
FT   CDS_pept        complement(583488..583706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02750"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89451"
FT                   /db_xref="GOA:D8JNQ4"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNQ4"
FT                   /protein_id="ADI89451.1"
FT   gene            583910..584938
FT                   /locus_tag="AOLE_02755"
FT   CDS_pept        583910..584938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02755"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02755"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89452"
FT                   /db_xref="GOA:D8JNQ5"
FT                   /db_xref="InterPro:IPR021520"
FT                   /db_xref="InterPro:IPR031357"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNQ5"
FT                   /protein_id="ADI89452.1"
FT                   SH"
FT   gene            complement(585004..586788)
FT                   /gene="aspS"
FT                   /locus_tag="AOLE_02760"
FT   CDS_pept        complement(585004..586788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="AOLE_02760"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG0173 Aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89453"
FT                   /db_xref="GOA:D8JNQ6"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNQ6"
FT                   /protein_id="ADI89453.1"
FT                   LRDLGIRLREKPKAEESK"
FT   gene            complement(586959..587723)
FT                   /locus_tag="AOLE_02765"
FT   CDS_pept        complement(586959..587723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02765"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02765"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89454"
FT                   /db_xref="GOA:D8JNQ7"
FT                   /db_xref="InterPro:IPR025238"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNQ7"
FT                   /protein_id="ADI89454.1"
FT   gene            587861..589936
FT                   /locus_tag="AOLE_02770"
FT   CDS_pept        587861..589936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02770"
FT                   /product="TonB dependent receptor family protein"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02770"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89455"
FT                   /db_xref="GOA:D8JNQ8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNQ8"
FT                   /protein_id="ADI89455.1"
FT   gene            590012..591475
FT                   /locus_tag="AOLE_02775"
FT   CDS_pept        590012..591475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02775"
FT                   /product="phospholipase D endonuclease domain-containing
FT                   protein"
FT                   /note="COG1502
FT                   Phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthases and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02775"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89456"
FT                   /db_xref="GOA:D8JNQ9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNQ9"
FT                   /protein_id="ADI89456.1"
FT   gene            complement(591742..592188)
FT                   /locus_tag="AOLE_02780"
FT   CDS_pept        complement(591742..592188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02780"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89457"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNR0"
FT                   /protein_id="ADI89457.1"
FT   gene            592353..592736
FT                   /locus_tag="AOLE_02785"
FT   CDS_pept        592353..592736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02785"
FT                   /product="hypothetical protein"
FT                   /note="COG5455 Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02785"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89458"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNR1"
FT                   /protein_id="ADI89458.1"
FT   gene            complement(592785..593267)
FT                   /locus_tag="AOLE_02790"
FT   CDS_pept        complement(592785..593267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02790"
FT                   /product="Protein psiE"
FT                   /note="COG3223 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02790"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89459"
FT                   /db_xref="GOA:D8JNR2"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNR2"
FT                   /protein_id="ADI89459.1"
FT   gene            complement(593390..595171)
FT                   /locus_tag="AOLE_02795"
FT   CDS_pept        complement(593390..595171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02795"
FT                   /product="Acyl-CoA dehydrogenase, C-terminal domain
FT                   protein"
FT                   /note="COG1960 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02795"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89460"
FT                   /db_xref="GOA:D8JNR3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNR3"
FT                   /protein_id="ADI89460.1"
FT                   GSDLIMGFSEDYFTNQA"
FT   gene            complement(595339..597141)
FT                   /locus_tag="AOLE_02800"
FT   CDS_pept        complement(595339..597141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02800"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /note="COG1960 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02800"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89461"
FT                   /db_xref="GOA:D8JNR4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNR4"
FT                   /protein_id="ADI89461.1"
FT   gene            complement(597431..597808)
FT                   /locus_tag="AOLE_02805"
FT   CDS_pept        complement(597431..597808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02805"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89462"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNR5"
FT                   /protein_id="ADI89462.1"
FT   gene            597935..599599
FT                   /locus_tag="AOLE_02810"
FT   CDS_pept        597935..599599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02810"
FT                   /product="kinase sensor component of a two component signal
FT                   transduction system"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02810"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89463"
FT                   /db_xref="GOA:D8JNR6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNR6"
FT                   /protein_id="ADI89463.1"
FT   gene            599621..600307
FT                   /locus_tag="AOLE_02815"
FT   CDS_pept        599621..600307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02815"
FT                   /product="response regulator"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02815"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89464"
FT                   /db_xref="GOA:D8JNR7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNR7"
FT                   /protein_id="ADI89464.1"
FT                   FEYPEE"
FT   gene            complement(600379..600960)
FT                   /locus_tag="AOLE_02820"
FT   CDS_pept        complement(600379..600960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02820"
FT                   /product="hypothetical protein"
FT                   /note="COG3034 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02820"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89465"
FT                   /db_xref="GOA:D8JNR8"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNR8"
FT                   /protein_id="ADI89465.1"
FT   gene            complement(601027..602469)
FT                   /locus_tag="AOLE_02825"
FT   CDS_pept        complement(601027..602469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02825"
FT                   /product="hypothetical protein"
FT                   /note="COG0397 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02825"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89466"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNR9"
FT                   /protein_id="ADI89466.1"
FT   gene            complement(602569..603741)
FT                   /locus_tag="AOLE_02830"
FT   CDS_pept        complement(602569..603741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02830"
FT                   /product="stearoyl-CoA desaturase"
FT                   /note="COG1398 Fatty-acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02830"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89467"
FT                   /db_xref="GOA:D8JNS0"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR009160"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNS0"
FT                   /protein_id="ADI89467.1"
FT   gene            603950..604483
FT                   /locus_tag="AOLE_02835"
FT   CDS_pept        603950..604483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02835"
FT                   /product="hypothetical protein"
FT                   /note="COG3187 Heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02835"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89468"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNS1"
FT                   /protein_id="ADI89468.1"
FT                   LDQSGQRLIQAQKK"
FT   gene            complement(604511..605224)
FT                   /locus_tag="AOLE_02840"
FT   CDS_pept        complement(604511..605224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02840"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="COG0584 Glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02840"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89469"
FT                   /db_xref="GOA:D8JNS2"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNS2"
FT                   /protein_id="ADI89469.1"
FT                   QGLITDIPTTMLQAL"
FT   gene            complement(605299..605877)
FT                   /locus_tag="AOLE_02845"
FT   CDS_pept        complement(605299..605877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02845"
FT                   /product="ATP:cob(I)alamin adenosyltransferase"
FT                   /note="COG2096 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02845"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89470"
FT                   /db_xref="GOA:D8JNS3"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNS3"
FT                   /protein_id="ADI89470.1"
FT   gene            complement(605973..607817)
FT                   /locus_tag="AOLE_02850"
FT   CDS_pept        complement(605973..607817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02850"
FT                   /product="Vitamin B12 transporter btuB precursor"
FT                   /note="COG4206 Outer membrane cobalamin receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02850"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89471"
FT                   /db_xref="GOA:D8JNS4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNS4"
FT                   /protein_id="ADI89471.1"
FT   gene            608175..608843
FT                   /locus_tag="AOLE_02855"
FT   CDS_pept        608175..608843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02855"
FT                   /product="N-(5'-phosphoribosyl)anthranilate
FT                   isomerase(PRAI)"
FT                   /note="COG0135 Phosphoribosylanthranilate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02855"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89472"
FT                   /db_xref="GOA:D8JNS5"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNS5"
FT                   /protein_id="ADI89472.1"
FT                   "
FT   gene            608818..610047
FT                   /locus_tag="AOLE_02860"
FT   CDS_pept        608818..610047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02860"
FT                   /product="tryptophan synthase subunit beta"
FT                   /EC_number=""
FT                   /note="COG0133 Tryptophan synthase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02860"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89473"
FT                   /db_xref="GOA:D8JNS6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNS6"
FT                   /protein_id="ADI89473.1"
FT                   RIDGVEMVEM"
FT   gene            610060..610572
FT                   /locus_tag="AOLE_02865"
FT   CDS_pept        610060..610572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02865"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02865"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89474"
FT                   /db_xref="InterPro:IPR011440"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNS7"
FT                   /protein_id="ADI89474.1"
FT                   NTYLTVV"
FT   gene            610610..611605
FT                   /locus_tag="AOLE_02870"
FT   CDS_pept        610610..611605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02870"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89475"
FT                   /db_xref="InterPro:IPR021243"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNS8"
FT                   /protein_id="ADI89475.1"
FT   gene            complement(611614..612489)
FT                   /locus_tag="AOLE_02875"
FT   CDS_pept        complement(611614..612489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02875"
FT                   /product="metal-dependent hydrolase"
FT                   /note="COG3687 Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02875"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89476"
FT                   /db_xref="GOA:D8JNS9"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNS9"
FT                   /protein_id="ADI89476.1"
FT                   AGEAFWQAGL"
FT   gene            612610..613659
FT                   /locus_tag="AOLE_02880"
FT   CDS_pept        612610..613659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02880"
FT                   /product="AraC-type DNA-binding domain-containing protein"
FT                   /note="COG2207 AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02880"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89477"
FT                   /db_xref="GOA:D8JNT0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNT0"
FT                   /protein_id="ADI89477.1"
FT                   QLTNKNAIK"
FT   gene            613906..614709
FT                   /gene="trpA"
FT                   /locus_tag="AOLE_02885"
FT   CDS_pept        613906..614709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="AOLE_02885"
FT                   /product="tryptophan synthase subunit alpha"
FT                   /EC_number=""
FT                   /note="COG0159 Tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02885"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89478"
FT                   /db_xref="GOA:D8JNT1"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNT1"
FT                   /protein_id="ADI89478.1"
FT   gene            614706..615602
FT                   /locus_tag="AOLE_02890"
FT   CDS_pept        614706..615602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02890"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /note="COG0777 Acetyl-CoA carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89479"
FT                   /db_xref="GOA:D8JNT2"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNT2"
FT                   /protein_id="ADI89479.1"
FT                   ALRDTVSRLVSKLMNLP"
FT   gene            615599..616885
FT                   /locus_tag="AOLE_02895"
FT   CDS_pept        615599..616885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02895"
FT                   /product="FolC bifunctional protein"
FT                   /note="COG0285 Folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02895"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89480"
FT                   /db_xref="GOA:D8JNT3"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNT3"
FT                   /protein_id="ADI89480.1"
FT   gene            616882..617934
FT                   /locus_tag="AOLE_02900"
FT   CDS_pept        616882..617934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02900"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89481"
FT                   /db_xref="GOA:D8JNT4"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNT4"
FT                   /protein_id="ADI89481.1"
FT                   VIDWVPLDQR"
FT   gene            complement(617963..618541)
FT                   /locus_tag="AOLE_02905"
FT   CDS_pept        complement(617963..618541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02905"
FT                   /product="Dual specificity phosphatase, catalytic domain
FT                   protein"
FT                   /note="COG2365 Protein tyrosine/serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02905"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89482"
FT                   /db_xref="GOA:D8JNT5"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNT5"
FT                   /protein_id="ADI89482.1"
FT   gene            complement(618538..619314)
FT                   /locus_tag="AOLE_02910"
FT   CDS_pept        complement(618538..619314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02910"
FT                   /product="Zn-dependent hydrolase, including glyoxylase"
FT                   /note="COG0491 Zn-dependent hydrolases, including
FT                   glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02910"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89483"
FT                   /db_xref="GOA:D8JNT6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNT6"
FT                   /protein_id="ADI89483.1"
FT   gene            complement(619765..620415)
FT                   /locus_tag="AOLE_02915"
FT   CDS_pept        complement(619765..620415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02915"
FT                   /product="peroxiredoxin"
FT                   /note="COG0450 Peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02915"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89484"
FT                   /db_xref="GOA:D8JNT7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNT7"
FT                   /protein_id="ADI89484.1"
FT   gene            620821..623541
FT                   /locus_tag="AOLE_02920"
FT   CDS_pept        620821..623541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02920"
FT                   /product="preprotein translocase subunit SecA"
FT                   /note="COG0653 Preprotein translocase subunit SecA (ATPase,
FT                   RNA helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02920"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89485"
FT                   /db_xref="GOA:D8JNT8"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNT8"
FT                   /protein_id="ADI89485.1"
FT   gene            623674..624117
FT                   /locus_tag="AOLE_02925"
FT   CDS_pept        623674..624117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02925"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02925"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89486"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNT9"
FT                   /protein_id="ADI89486.1"
FT   gene            complement(624187..625497)
FT                   /locus_tag="AOLE_02930"
FT   CDS_pept        complement(624187..625497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02930"
FT                   /product="MFS transporter, metabolite:H+ symporter (MHS)
FT                   family protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02930"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89487"
FT                   /db_xref="GOA:D8JNU0"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNU0"
FT                   /protein_id="ADI89487.1"
FT   gene            complement(625632..626273)
FT                   /locus_tag="AOLE_02935"
FT   CDS_pept        complement(625632..626273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02935"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="COG1272 Predicted membrane protein, hemolysin III
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02935"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89488"
FT                   /db_xref="GOA:D8JNU1"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNU1"
FT                   /protein_id="ADI89488.1"
FT   gene            626401..627612
FT                   /locus_tag="AOLE_02940"
FT   CDS_pept        626401..627612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02940"
FT                   /product="putative methyltransferase"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02940"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89489"
FT                   /db_xref="GOA:D8JNU2"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNU2"
FT                   /protein_id="ADI89489.1"
FT                   GCKC"
FT   gene            627625..628044
FT                   /locus_tag="AOLE_02945"
FT   CDS_pept        627625..628044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02945"
FT                   /product="Acetyltransferase (GNAT) family protein"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02945"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89490"
FT                   /db_xref="GOA:D8JNU3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNU3"
FT                   /protein_id="ADI89490.1"
FT   gene            complement(628074..628934)
FT                   /locus_tag="AOLE_02950"
FT   CDS_pept        complement(628074..628934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02950"
FT                   /product="Patatin-like phospholipase family protein"
FT                   /note="COG4667 Predicted esterase of the alpha-beta
FT                   hydrolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02950"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89491"
FT                   /db_xref="GOA:D8JNU4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNU4"
FT                   /protein_id="ADI89491.1"
FT                   WNAMK"
FT   gene            complement(628950..629204)
FT                   /locus_tag="AOLE_02955"
FT   CDS_pept        complement(628950..629204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02955"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02955"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89492"
FT                   /db_xref="GOA:D8JNU5"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNU5"
FT                   /protein_id="ADI89492.1"
FT   gene            complement(629369..631504)
FT                   /locus_tag="AOLE_02960"
FT   CDS_pept        complement(629369..631504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02960"
FT                   /product="putative 3-hydroxybutyryl-CoA epimerase"
FT                   /note="COG1024 Enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02960"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89493"
FT                   /db_xref="GOA:D8JNU6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNU6"
FT                   /protein_id="ADI89493.1"
FT                   TPPALLKTKAEQKQNIQ"
FT   gene            complement(631523..632728)
FT                   /locus_tag="AOLE_02965"
FT   CDS_pept        complement(631523..632728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02965"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number=""
FT                   /note="COG0183 Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02965"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89494"
FT                   /db_xref="GOA:D8JNU7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNU7"
FT                   /protein_id="ADI89494.1"
FT                   RV"
FT   gene            complement(632900..634057)
FT                   /locus_tag="AOLE_02970"
FT   CDS_pept        complement(632900..634057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02970"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207 AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02970"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89495"
FT                   /db_xref="GOA:D8JNU8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNU8"
FT                   /protein_id="ADI89495.1"
FT   gene            634121..635239
FT                   /locus_tag="AOLE_02975"
FT   CDS_pept        634121..635239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02975"
FT                   /product="acyl-CoA transferases/carnitine dehydratase"
FT                   /note="COG1804 Predicted acyl-CoA transferases/carnitine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02975"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89496"
FT                   /db_xref="GOA:D8JNU9"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNU9"
FT                   /protein_id="ADI89496.1"
FT   gene            635374..636627
FT                   /locus_tag="AOLE_02980"
FT   CDS_pept        635374..636627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02980"
FT                   /product="Porin B precursor (Outer membrane protein D1)
FT                   (Glucose porin)"
FT                   /note="COG3659 Carbohydrate-selective porin"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02980"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89497"
FT                   /db_xref="GOA:D8JNV0"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNV0"
FT                   /protein_id="ADI89497.1"
FT                   LKNGDNTWVGGIKFSTAF"
FT   gene            636802..639207
FT                   /locus_tag="AOLE_02985"
FT   CDS_pept        636802..639207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02985"
FT                   /product="Quinoprotein glucose dehydrogenase-A precursor"
FT                   /note="COG4993 Glucose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02985"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89498"
FT                   /db_xref="GOA:D8JNV1"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNV1"
FT                   /protein_id="ADI89498.1"
FT   gene            639373..641016
FT                   /locus_tag="AOLE_02990"
FT   CDS_pept        639373..641016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02990"
FT                   /product="sulfite reductase, beta subunit (hemoprotein)"
FT                   /note="COG0155 Sulfite reductase, beta subunit
FT                   (hemoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02990"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89499"
FT                   /db_xref="GOA:D8JNV2"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNV2"
FT                   /protein_id="ADI89499.1"
FT   gene            641009..641497
FT                   /locus_tag="AOLE_02995"
FT   CDS_pept        641009..641497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_02995"
FT                   /product="hypothetical protein"
FT                   /note="COG3749 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_02995"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89500"
FT                   /db_xref="InterPro:IPR008318"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNV3"
FT                   /protein_id="ADI89500.1"
FT   gene            complement(641547..641990)
FT                   /locus_tag="AOLE_03000"
FT   CDS_pept        complement(641547..641990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03000"
FT                   /product="hypothetical protein"
FT                   /note="COG2764 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03000"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89501"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNV4"
FT                   /protein_id="ADI89501.1"
FT   gene            complement(642121..643296)
FT                   /locus_tag="AOLE_03005"
FT   CDS_pept        complement(642121..643296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03005"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="COG0183 Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03005"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89502"
FT                   /db_xref="GOA:D8JNV5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNV5"
FT                   /protein_id="ADI89502.1"
FT   gene            complement(643405..643920)
FT                   /locus_tag="AOLE_03010"
FT   CDS_pept        complement(643405..643920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03010"
FT                   /product="Tfp pilus assembly protein FimT"
FT                   /note="COG4970 Tfp pilus assembly protein FimT"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03010"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89503"
FT                   /db_xref="GOA:D8JNV6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNV6"
FT                   /protein_id="ADI89503.1"
FT                   RLEELQNC"
FT   gene            644300..645343
FT                   /locus_tag="AOLE_03015"
FT   CDS_pept        644300..645343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03015"
FT                   /product="Outer membrane porin F precursor (Root adhesin)"
FT                   /note="COG2885 Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03015"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89504"
FT                   /db_xref="GOA:D8JNV7"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNV7"
FT                   /protein_id="ADI89504.1"
FT                   AAPAAAQ"
FT   gene            complement(645468..645626)
FT                   /locus_tag="AOLE_03020"
FT   CDS_pept        complement(645468..645626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03020"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89505"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNV8"
FT                   /protein_id="ADI89505.1"
FT                   QLRKGDW"
FT   gene            complement(645630..646835)
FT                   /locus_tag="AOLE_03025"
FT   CDS_pept        complement(645630..646835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03025"
FT                   /product="hypothetical protein"
FT                   /note="COG1690 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03025"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89506"
FT                   /db_xref="GOA:D8JNV9"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNV9"
FT                   /protein_id="ADI89506.1"
FT                   KG"
FT   gene            complement(647102..648562)
FT                   /locus_tag="AOLE_03030"
FT   CDS_pept        complement(647102..648562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03030"
FT                   /product="Lysine-specific permease"
FT                   /note="COG0833 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03030"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89507"
FT                   /db_xref="GOA:D8JNW0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNW0"
FT                   /protein_id="ADI89507.1"
FT   gene            complement(648584..649597)
FT                   /locus_tag="AOLE_03035"
FT   CDS_pept        complement(648584..649597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03035"
FT                   /product="Ribosomal RNA small subunit methyltransferase C"
FT                   /note="COG2813 16S RNA G1207 methylase RsmC"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03035"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89508"
FT                   /db_xref="GOA:D8JNW1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNW1"
FT                   /protein_id="ADI89508.1"
FT   gene            complement(649661..651019)
FT                   /locus_tag="AOLE_03040"
FT   CDS_pept        complement(649661..651019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03040"
FT                   /product="Putative purine permease yicE"
FT                   /note="COG2233 Xanthine/uracil permeases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03040"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89509"
FT                   /db_xref="GOA:D8JNW2"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNW2"
FT                   /protein_id="ADI89509.1"
FT   gene            651197..653026
FT                   /locus_tag="AOLE_03045"
FT   CDS_pept        651197..653026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03045"
FT                   /product="GTP-binding elongation factor family protein"
FT                   /note="COG1217 Predicted membrane GTPase involved in stress
FT                   response"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03045"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89510"
FT                   /db_xref="GOA:D8JNW3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNW3"
FT                   /protein_id="ADI89510.1"
FT   gene            653285..653716
FT                   /gene="mscL"
FT                   /locus_tag="AOLE_03050"
FT   CDS_pept        653285..653716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="AOLE_03050"
FT                   /product="large-conductance mechanosensitive channel"
FT                   /note="COG1970 Large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03050"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89511"
FT                   /db_xref="GOA:D8JNW4"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNW4"
FT                   /protein_id="ADI89511.1"
FT   gene            653858..654211
FT                   /locus_tag="AOLE_03055"
FT   CDS_pept        653858..654211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03055"
FT                   /product="hypothetical protein"
FT                   /note="COG2105 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03055"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89512"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNW5"
FT                   /protein_id="ADI89512.1"
FT                   QLNAQAQAFEKNN"
FT   gene            complement(654222..654512)
FT                   /locus_tag="AOLE_03060"
FT   CDS_pept        complement(654222..654512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03060"
FT                   /product="peptidyl-prolyl cis-trans isomerase precursor"
FT                   /note="COG0760 Parvulin-like peptidyl-prolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03060"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89513"
FT                   /db_xref="GOA:D8JNW6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNW6"
FT                   /protein_id="ADI89513.1"
FT   gene            complement(654532..655356)
FT                   /locus_tag="AOLE_03065"
FT   CDS_pept        complement(654532..655356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03065"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /note="COG0266 Formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03065"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89514"
FT                   /db_xref="GOA:D8JNW7"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNW7"
FT                   /protein_id="ADI89514.1"
FT   gene            655432..655998
FT                   /locus_tag="AOLE_03070"
FT   CDS_pept        655432..655998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03070"
FT                   /product="DNA-3-methyladenine glycosylase"
FT                   /note="COG2094 3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03070"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89515"
FT                   /db_xref="GOA:D8JNW8"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNW8"
FT                   /protein_id="ADI89515.1"
FT   gene            656133..658262
FT                   /locus_tag="AOLE_03075"
FT   CDS_pept        656133..658262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03075"
FT                   /product="Outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /note="COG1629 Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03075"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89516"
FT                   /db_xref="GOA:D8JNW9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNW9"
FT                   /protein_id="ADI89516.1"
FT                   DGRNWSAGLRVIKQF"
FT   gene            658272..659381
FT                   /locus_tag="AOLE_03080"
FT   CDS_pept        658272..659381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03080"
FT                   /product="NADH:flavin oxidoreductase"
FT                   /note="COG1902 NADH:flavin oxidoreductases, Old Yellow
FT                   Enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03080"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89517"
FT                   /db_xref="GOA:D8JNX0"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNX0"
FT                   /protein_id="ADI89517.1"
FT   gene            659438..660361
FT                   /locus_tag="AOLE_03085"
FT   CDS_pept        659438..660361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03085"
FT                   /product="permease"
FT                   /note="COG0679 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03085"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89518"
FT                   /db_xref="GOA:D8JNX1"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNX1"
FT                   /protein_id="ADI89518.1"
FT   gene            complement(660388..661212)
FT                   /locus_tag="AOLE_03090"
FT   CDS_pept        complement(660388..661212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03090"
FT                   /product="TPR repeat-containing SEL1 subfamily protein"
FT                   /note="COG0790 FOG: TPR repeat, SEL1 subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03090"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89519"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNX2"
FT                   /protein_id="ADI89519.1"
FT   gene            complement(661396..662106)
FT                   /locus_tag="AOLE_03095"
FT   CDS_pept        complement(661396..662106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03095"
FT                   /product="Thiol:disulfide interchange protein dsbC
FT                   precursor"
FT                   /note="COG1651 Protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03095"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89520"
FT                   /db_xref="GOA:D8JNX3"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNX3"
FT                   /protein_id="ADI89520.1"
FT                   SDAKQIEALLQSAK"
FT   gene            complement(662252..662974)
FT                   /locus_tag="AOLE_03100"
FT   CDS_pept        complement(662252..662974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03100"
FT                   /product="GcvT-like aminomethyltransferase"
FT                   /note="COG0354 Predicted aminomethyltransferase related to
FT                   GcvT"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03100"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89521"
FT                   /db_xref="GOA:D8JNX4"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNX4"
FT                   /protein_id="ADI89521.1"
FT                   LQILELPEALSGDVARPQ"
FT   gene            663190..663639
FT                   /locus_tag="AOLE_03105"
FT   CDS_pept        663190..663639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03105"
FT                   /product="hypothetical protein"
FT                   /note="COG3832 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03105"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89522"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNX5"
FT                   /protein_id="ADI89522.1"
FT   gene            663748..664104
FT                   /locus_tag="AOLE_03110"
FT   CDS_pept        663748..664104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03110"
FT                   /product="hypothetical protein"
FT                   /note="COG3189 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03110"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89523"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNX6"
FT                   /protein_id="ADI89523.1"
FT                   AIILKEYLLSKNSK"
FT   gene            664194..664538
FT                   /locus_tag="AOLE_03115"
FT   CDS_pept        664194..664538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03115"
FT                   /product="putative alkylphosphonate uptake protein (PhnA)
FT                   in phosphonate metabolism"
FT                   /note="COG2824 Uncharacterized Zn-ribbon-containing protein
FT                   involved in phosphonate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03115"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89524"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNX7"
FT                   /protein_id="ADI89524.1"
FT                   KLKSEFVKKA"
FT   gene            664750..665091
FT                   /locus_tag="AOLE_03120"
FT   CDS_pept        664750..665091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03120"
FT                   /product="hypothetical protein"
FT                   /note="COG3422 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03120"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89525"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNX8"
FT                   /protein_id="ADI89525.1"
FT                   TIKDLTVQA"
FT   gene            complement(665146..666861)
FT                   /locus_tag="AOLE_03125"
FT   CDS_pept        complement(665146..666861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03125"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG0442 Prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03125"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89526"
FT                   /db_xref="GOA:D8JNX9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNX9"
FT                   /protein_id="ADI89526.1"
FT   gene            complement(666920..670018)
FT                   /locus_tag="AOLE_03130"
FT   CDS_pept        complement(666920..670018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03130"
FT                   /product="nodulation protein precursor"
FT                   /note="COG0841 Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03130"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89527"
FT                   /db_xref="GOA:D8JNY0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNY0"
FT                   /protein_id="ADI89527.1"
FT   gene            complement(670034..671152)
FT                   /locus_tag="AOLE_03135"
FT   CDS_pept        complement(670034..671152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03135"
FT                   /product="membrane-fusion protein"
FT                   /note="COG0845 Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03135"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89528"
FT                   /db_xref="GOA:D8JNY1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNY1"
FT                   /protein_id="ADI89528.1"
FT   gene            complement(671212..671847)
FT                   /locus_tag="AOLE_03140"
FT   CDS_pept        complement(671212..671847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89529"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNY2"
FT                   /protein_id="ADI89529.1"
FT   gene            672133..672516
FT                   /locus_tag="AOLE_03145"
FT   CDS_pept        672133..672516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03145"
FT                   /product="Protein pilG"
FT                   /note="COG0784 FOG: CheY-like receiver"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03145"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89530"
FT                   /db_xref="GOA:D8JNY3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNY3"
FT                   /protein_id="ADI89530.1"
FT   gene            672540..672902
FT                   /locus_tag="AOLE_03150"
FT   CDS_pept        672540..672902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03150"
FT                   /product="Protein pilH"
FT                   /note="COG0784 FOG: CheY-like receiver"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03150"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89531"
FT                   /db_xref="GOA:D8JNY4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNY4"
FT                   /protein_id="ADI89531.1"
FT                   PIEEKQLIDVIKQFLN"
FT   gene            672962..673498
FT                   /locus_tag="AOLE_03155"
FT   CDS_pept        672962..673498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03155"
FT                   /product="chemotaxis signal transduction protein"
FT                   /note="COG0835 Chemotaxis signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03155"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89532"
FT                   /db_xref="GOA:D8JNY5"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNY5"
FT                   /protein_id="ADI89532.1"
FT                   LQNPHYMNASTKFIN"
FT   gene            673542..675623
FT                   /locus_tag="AOLE_03160"
FT   CDS_pept        673542..675623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03160"
FT                   /product="Protein pilJ"
FT                   /note="COG0840 Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03160"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89533"
FT                   /db_xref="GOA:D8JNY6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNY6"
FT                   /protein_id="ADI89533.1"
FT   gene            675771..680273
FT                   /locus_tag="AOLE_03165"
FT   CDS_pept        675771..680273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03165"
FT                   /product="chemotaxis protein histidine kinase"
FT                   /note="COG0643 Chemotaxis protein histidine kinase and
FT                   related kinases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03165"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89534"
FT                   /db_xref="GOA:D8JNY7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNY7"
FT                   /protein_id="ADI89534.1"
FT   gene            680273..680740
FT                   /locus_tag="AOLE_03170"
FT   CDS_pept        680273..680740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03170"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89535"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNY8"
FT                   /protein_id="ADI89535.1"
FT   gene            complement(680774..681910)
FT                   /locus_tag="AOLE_03175"
FT   CDS_pept        complement(680774..681910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03175"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /note="COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03175"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89536"
FT                   /db_xref="GOA:D8JNY9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNY9"
FT                   /protein_id="ADI89536.1"
FT   gene            complement(682036..682176)
FT                   /locus_tag="AOLE_03180"
FT   CDS_pept        complement(682036..682176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03180"
FT                   /product="bacteriolytic lipoprotein entericidin B"
FT                   /note="COG5510 Predicted small secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03180"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89537"
FT                   /db_xref="GOA:D8JNZ0"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNZ0"
FT                   /protein_id="ADI89537.1"
FT                   M"
FT   gene            complement(682302..683183)
FT                   /locus_tag="AOLE_03185"
FT   CDS_pept        complement(682302..683183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03185"
FT                   /product="hypothetical protein"
FT                   /note="COG3782 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03185"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89538"
FT                   /db_xref="InterPro:IPR015003"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNZ1"
FT                   /protein_id="ADI89538.1"
FT                   YLKFKCNFQKFK"
FT   gene            683287..683655
FT                   /locus_tag="AOLE_03190"
FT   CDS_pept        683287..683655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03190"
FT                   /product="hypothetical protein"
FT                   /note="COG2832 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03190"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89539"
FT                   /db_xref="GOA:D8JNZ2"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNZ2"
FT                   /protein_id="ADI89539.1"
FT                   MFIVAVWLWLRPEPKIKD"
FT   gene            683867..684370
FT                   /locus_tag="AOLE_03195"
FT   CDS_pept        683867..684370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03195"
FT                   /product="hypothetical protein"
FT                   /note="COG1376 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03195"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89540"
FT                   /db_xref="GOA:D8JNZ3"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNZ3"
FT                   /protein_id="ADI89540.1"
FT                   QSLT"
FT   gene            684577..684652
FT                   /locus_tag="AOLE_t19520"
FT   tRNA            684577..684652
FT                   /locus_tag="AOLE_t19520"
FT                   /product="tRNA-Val"
FT   gene            684677..684753
FT                   /locus_tag="AOLE_t19522"
FT   tRNA            684677..684753
FT                   /locus_tag="AOLE_t19522"
FT                   /product="tRNA-Asp"
FT   gene            684801..684877
FT                   /locus_tag="AOLE_t19524"
FT   tRNA            684801..684877
FT                   /locus_tag="AOLE_t19524"
FT                   /product="tRNA-Asp"
FT   gene            684964..685039
FT                   /locus_tag="AOLE_t19526"
FT   tRNA            684964..685039
FT                   /locus_tag="AOLE_t19526"
FT                   /product="tRNA-Val"
FT   gene            685076..685152
FT                   /locus_tag="AOLE_t19528"
FT   tRNA            685076..685152
FT                   /locus_tag="AOLE_t19528"
FT                   /product="tRNA-Asp"
FT   gene            685219..685294
FT                   /locus_tag="AOLE_t19530"
FT   tRNA            685219..685294
FT                   /locus_tag="AOLE_t19530"
FT                   /product="tRNA-Val"
FT   gene            complement(685664..686449)
FT                   /locus_tag="AOLE_03200"
FT   CDS_pept        complement(685664..686449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03200"
FT                   /product="hypothetical protein"
FT                   /note="COG1434 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03200"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89541"
FT                   /db_xref="GOA:D8JNZ4"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNZ4"
FT                   /protein_id="ADI89541.1"
FT   gene            complement(686567..689149)
FT                   /locus_tag="AOLE_03205"
FT   CDS_pept        complement(686567..689149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03205"
FT                   /product="Sulfite reductase [NADPH] flavoprotein
FT                   alpha-component(SIR-FP)"
FT                   /note="COG3182 Uncharacterized iron-regulated membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03205"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89542"
FT                   /db_xref="GOA:D8JNZ5"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNZ5"
FT                   /protein_id="ADI89542.1"
FT   gene            complement(689305..689880)
FT                   /locus_tag="AOLE_03210"
FT   CDS_pept        complement(689305..689880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03210"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89543"
FT                   /db_xref="GOA:D8JNZ6"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNZ6"
FT                   /protein_id="ADI89543.1"
FT   gene            complement(689981..692155)
FT                   /locus_tag="AOLE_03215"
FT   CDS_pept        complement(689981..692155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03215"
FT                   /product="Inner membrane protein yccS"
FT                   /note="COG1289 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03215"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89544"
FT                   /db_xref="GOA:D8JNZ7"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNZ7"
FT                   /protein_id="ADI89544.1"
FT   gene            692283..693497
FT                   /locus_tag="AOLE_03220"
FT   CDS_pept        692283..693497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03220"
FT                   /product="Bicyclomycin resistance protein (Sulfonamide
FT                   resistance protein)"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03220"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89545"
FT                   /db_xref="GOA:D8JNZ8"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNZ8"
FT                   /protein_id="ADI89545.1"
FT                   IKPFS"
FT   gene            complement(693523..694230)
FT                   /locus_tag="AOLE_03225"
FT   CDS_pept        complement(693523..694230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03225"
FT                   /product="Nitroreductase family protein"
FT                   /note="COG0778 Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03225"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89546"
FT                   /db_xref="GOA:D8JNZ9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D8JNZ9"
FT                   /protein_id="ADI89546.1"
FT                   REPVENFAVFLDE"
FT   gene            694738..694941
FT                   /locus_tag="AOLE_03230"
FT   CDS_pept        694738..694941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03230"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89547"
FT                   /db_xref="UniProtKB/TrEMBL:D8JP00"
FT                   /protein_id="ADI89547.1"
FT   gene            695366..696841
FT                   /locus_tag="AOLE_03235"
FT   CDS_pept        695366..696841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03235"
FT                   /product="amino acid carrier family protein"
FT                   /note="COG1115 Na+/alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03235"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89548"
FT                   /db_xref="GOA:D8JP01"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D8JP01"
FT                   /protein_id="ADI89548.1"
FT   gene            697012..697986
FT                   /locus_tag="AOLE_03240"
FT   CDS_pept        697012..697986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03240"
FT                   /product="Patatin-like phospholipase family protein"
FT                   /note="COG1752 Predicted esterase of the alpha-beta
FT                   hydrolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03240"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89549"
FT                   /db_xref="GOA:D8JP02"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D8JP02"
FT                   /protein_id="ADI89549.1"
FT   gene            698190..699425
FT                   /locus_tag="AOLE_03245"
FT   CDS_pept        698190..699425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03245"
FT                   /product="threonine dehydratase"
FT                   /note="COG1171 Threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03245"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89550"
FT                   /db_xref="GOA:D8JP03"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D8JP03"
FT                   /protein_id="ADI89550.1"
FT                   QLEGYIVRKEEI"
FT   gene            699663..700859
FT                   /locus_tag="AOLE_03250"
FT   CDS_pept        699663..700859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03250"
FT                   /product="transport protein"
FT                   /note="COG1133 ABC-type long-chain fatty acid transport
FT                   system, fused permease and ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:AOLE_03250"
FT                   /db_xref="EnsemblGenomes-Tr:ADI89551"
FT                   /db_xref="GOA:D8JDB4"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="UniProtKB/TrEMBL:D8JDB4"
FT                   /protein_id="ADI89551.1"
FT   gene            complement(700900..701649)
FT                   /locus_tag="AOLE_03255"
FT   CDS_pept        complement(700900..701649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AOLE_03255"