(data stored in ACNUC7421 zone)

EMBL: CP002097

ID   CP002097; SV 2; circular; genomic DNA; STD; PRO; 2337241 BP.
XX
AC   CP002097;
XX
PR   Project:PRJNA48979;
XX
DT   19-JUL-2010 (Rel. 105, Created)
DT   16-DEC-2019 (Rel. 143, Last updated, Version 8)
XX
DE   Corynebacterium pseudotuberculosis FRC41, complete genome.
XX
KW   .
XX
OS   Corynebacterium pseudotuberculosis FRC41
OC   Bacteria; Actinobacteria; Corynebacteriales; Corynebacteriaceae;
OC   Corynebacterium.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2337241
RX   PUBMED; 21192786.
RA   Trost E., Ott L., Schneider J., Schroder J., Jaenicke S., Goesmann A.,
RA   Husemann P., Stoye J., Alves Dorella F., Souza Rocha F.,
RA   de Castro Soares S., D'Afonseca V., Miyoshi A., Ruiz J., Silva A.,
RA   Azevedo V., Burkovski A., Guiso N., Join-Lambert O.F., Kayal S., Tauch A.;
RT   "The complete genome sequence of Corynebacterium pseudotuberculosis FRC41
RT   isolated from a 12-year-old girl with necrotizing lymphadenitis reveals
RT   insights into gene-regulatory networks contributing to virulence";
RL   BMC Genomics 11:0-728(2010).
XX
RN   [2]
RC   Publication Status: Online-Only
RP   1-2337241
RX   PUBMED; 31705053.
RA   Sousa T.J., Parise D., Profeta R., Parise M.T.D., Gomide A.C.P., Kato R.B.,
RA   Pereira F.L., Figueiredo H.C.P., Ramos R., Brenig B.,
RA   Costa da Silva A.L.D., Ghosh P., Barh D., Goes-Neto A., Azevedo V.;
RT   "Re-sequencing and optical mapping reveals misassemblies and real
RT   inversions on Corynebacterium pseudotuberculosis genomes";
RL   Sci Rep 9(1):0-16387(2019).
XX
RN   [3]
RP   1-2337241
RA   Trost E.;
RT   ;
RL   Submitted (08-JUL-2010) to the INSDC.
RL   CeBiTec, Bielefeld University, Universitaetsstrasse 27, Bielefeld 33615,
RL   Germany
XX
RN   [4]
RC   Nucleotide sequence updated by submitter
RP   1-2337241
RA   Sousa T., Goncalves R., Gomide A., Seyffert N., Castro T., Soares S.,
RA   Bertram B., Azevedo V.;
RT   ;
RL   Submitted (05-DEC-2019) to the INSDC.
RL   Department of Genetics, Ecology and Evolution, UFMG, Av Antonio Carlos
RL   6627, Pampulha, Belo Horizonte, Minhas Gerais 31270-901, Brazil
XX
DR   MD5; 4b780aa7c6be83fba24cd663fb311366.
DR   BioSample; SAMN02603078.
DR   EnsemblGenomes-Gn; EBG00001437834.
DR   EnsemblGenomes-Gn; EBG00001437835.
DR   EnsemblGenomes-Gn; EBG00001437836.
DR   EnsemblGenomes-Gn; EBG00001437837.
DR   EnsemblGenomes-Gn; EBG00001437838.
DR   EnsemblGenomes-Gn; EBG00001437839.
DR   EnsemblGenomes-Gn; EBG00001437840.
DR   EnsemblGenomes-Gn; EBG00001437841.
DR   EnsemblGenomes-Gn; EBG00001437842.
DR   EnsemblGenomes-Gn; EBG00001437843.
DR   EnsemblGenomes-Gn; EBG00001437844.
DR   EnsemblGenomes-Gn; EBG00001437845.
DR   EnsemblGenomes-Gn; EBG00001437846.
DR   EnsemblGenomes-Gn; EBG00001437847.
DR   EnsemblGenomes-Gn; EBG00001437848.
DR   EnsemblGenomes-Gn; EBG00001437849.
DR   EnsemblGenomes-Gn; EBG00001437850.
DR   EnsemblGenomes-Gn; EBG00001437851.
DR   EnsemblGenomes-Gn; EBG00001437852.
DR   EnsemblGenomes-Gn; EBG00001437853.
DR   EnsemblGenomes-Gn; EBG00001437854.
DR   EnsemblGenomes-Gn; EBG00001437855.
DR   EnsemblGenomes-Gn; EBG00001437856.
DR   EnsemblGenomes-Gn; EBG00001437857.
DR   EnsemblGenomes-Gn; EBG00001437858.
DR   EnsemblGenomes-Gn; EBG00001437859.
DR   EnsemblGenomes-Gn; EBG00001437860.
DR   EnsemblGenomes-Gn; EBG00001437861.
DR   EnsemblGenomes-Gn; EBG00001437862.
DR   EnsemblGenomes-Gn; EBG00001437863.
DR   EnsemblGenomes-Gn; EBG00001437864.
DR   EnsemblGenomes-Gn; EBG00001437865.
DR   EnsemblGenomes-Gn; EBG00001437866.
DR   EnsemblGenomes-Gn; EBG00001437867.
DR   EnsemblGenomes-Gn; EBG00001437868.
DR   EnsemblGenomes-Gn; EBG00001437869.
DR   EnsemblGenomes-Gn; EBG00001437870.
DR   EnsemblGenomes-Gn; EBG00001437871.
DR   EnsemblGenomes-Gn; EBG00001437872.
DR   EnsemblGenomes-Gn; EBG00001437873.
DR   EnsemblGenomes-Gn; EBG00001437874.
DR   EnsemblGenomes-Gn; EBG00001437875.
DR   EnsemblGenomes-Gn; EBG00001437876.
DR   EnsemblGenomes-Gn; EBG00001437877.
DR   EnsemblGenomes-Gn; EBG00001437878.
DR   EnsemblGenomes-Gn; EBG00001437879.
DR   EnsemblGenomes-Gn; EBG00001437880.
DR   EnsemblGenomes-Gn; EBG00001437881.
DR   EnsemblGenomes-Gn; EBG00001437882.
DR   EnsemblGenomes-Gn; EBG00001437883.
DR   EnsemblGenomes-Gn; EBG00001437884.
DR   EnsemblGenomes-Gn; EBG00001437885.
DR   EnsemblGenomes-Gn; EBG00001437886.
DR   EnsemblGenomes-Gn; EBG00001437887.
DR   EnsemblGenomes-Gn; EBG00001437888.
DR   EnsemblGenomes-Gn; EBG00001437889.
DR   EnsemblGenomes-Gn; EBG00001437890.
DR   EnsemblGenomes-Gn; EBG00001437891.
DR   EnsemblGenomes-Gn; EBG00001437892.
DR   EnsemblGenomes-Gn; EBG00001437893.
DR   EnsemblGenomes-Gn; EBG00001437894.
DR   EnsemblGenomes-Gn; EBG00001437895.
DR   EnsemblGenomes-Gn; EBG00001437896.
DR   EnsemblGenomes-Gn; EBG00001437897.
DR   EnsemblGenomes-Gn; EBG00001437898.
DR   EnsemblGenomes-Gn; EBG00001437899.
DR   EnsemblGenomes-Gn; EBG00001437900.
DR   EnsemblGenomes-Gn; EBG00001437901.
DR   EnsemblGenomes-Gn; EBG00001437902.
DR   EnsemblGenomes-Gn; cpfrc_r001.
DR   EnsemblGenomes-Gn; cpfrc_r002.
DR   EnsemblGenomes-Gn; cpfrc_r003.
DR   EnsemblGenomes-Gn; cpfrc_r004.
DR   EnsemblGenomes-Gn; cpfrc_r005.
DR   EnsemblGenomes-Gn; cpfrc_r006.
DR   EnsemblGenomes-Gn; cpfrc_r007.
DR   EnsemblGenomes-Gn; cpfrc_r008.
DR   EnsemblGenomes-Gn; cpfrc_r009.
DR   EnsemblGenomes-Gn; cpfrc_r010.
DR   EnsemblGenomes-Gn; cpfrc_r011.
DR   EnsemblGenomes-Gn; cpfrc_r012.
DR   EnsemblGenomes-Gn; cpfrc_t001.
DR   EnsemblGenomes-Gn; cpfrc_t002.
DR   EnsemblGenomes-Gn; cpfrc_t003.
DR   EnsemblGenomes-Gn; cpfrc_t004.
DR   EnsemblGenomes-Gn; cpfrc_t005.
DR   EnsemblGenomes-Gn; cpfrc_t006.
DR   EnsemblGenomes-Gn; cpfrc_t007.
DR   EnsemblGenomes-Gn; cpfrc_t008.
DR   EnsemblGenomes-Gn; cpfrc_t009.
DR   EnsemblGenomes-Gn; cpfrc_t010.
DR   EnsemblGenomes-Gn; cpfrc_t011.
DR   EnsemblGenomes-Gn; cpfrc_t012.
DR   EnsemblGenomes-Gn; cpfrc_t013.
DR   EnsemblGenomes-Gn; cpfrc_t014.
DR   EnsemblGenomes-Gn; cpfrc_t015.
DR   EnsemblGenomes-Gn; cpfrc_t016.
DR   EnsemblGenomes-Gn; cpfrc_t017.
DR   EnsemblGenomes-Gn; cpfrc_t018.
DR   EnsemblGenomes-Gn; cpfrc_t019.
DR   EnsemblGenomes-Gn; cpfrc_t020.
DR   EnsemblGenomes-Gn; cpfrc_t021.
DR   EnsemblGenomes-Gn; cpfrc_t022.
DR   EnsemblGenomes-Gn; cpfrc_t023.
DR   EnsemblGenomes-Gn; cpfrc_t024.
DR   EnsemblGenomes-Gn; cpfrc_t025.
DR   EnsemblGenomes-Gn; cpfrc_t026.
DR   EnsemblGenomes-Gn; cpfrc_t027.
DR   EnsemblGenomes-Gn; cpfrc_t028.
DR   EnsemblGenomes-Gn; cpfrc_t029.
DR   EnsemblGenomes-Gn; cpfrc_t030.
DR   EnsemblGenomes-Gn; cpfrc_t031.
DR   EnsemblGenomes-Gn; cpfrc_t032.
DR   EnsemblGenomes-Gn; cpfrc_t033.
DR   EnsemblGenomes-Gn; cpfrc_t034.
DR   EnsemblGenomes-Gn; cpfrc_t035.
DR   EnsemblGenomes-Gn; cpfrc_t036.
DR   EnsemblGenomes-Gn; cpfrc_t037.
DR   EnsemblGenomes-Gn; cpfrc_t038.
DR   EnsemblGenomes-Gn; cpfrc_t039.
DR   EnsemblGenomes-Gn; cpfrc_t040.
DR   EnsemblGenomes-Gn; cpfrc_t041.
DR   EnsemblGenomes-Gn; cpfrc_t042.
DR   EnsemblGenomes-Gn; cpfrc_t043.
DR   EnsemblGenomes-Gn; cpfrc_t044.
DR   EnsemblGenomes-Gn; cpfrc_t045.
DR   EnsemblGenomes-Gn; cpfrc_t046.
DR   EnsemblGenomes-Gn; cpfrc_t047.
DR   EnsemblGenomes-Gn; cpfrc_t048.
DR   EnsemblGenomes-Gn; cpfrc_t049.
DR   EnsemblGenomes-Tr; EBT00001815434.
DR   EnsemblGenomes-Tr; EBT00001815435.
DR   EnsemblGenomes-Tr; EBT00001815436.
DR   EnsemblGenomes-Tr; EBT00001815437.
DR   EnsemblGenomes-Tr; EBT00001815438.
DR   EnsemblGenomes-Tr; EBT00001815439.
DR   EnsemblGenomes-Tr; EBT00001815440.
DR   EnsemblGenomes-Tr; EBT00001815441.
DR   EnsemblGenomes-Tr; EBT00001815442.
DR   EnsemblGenomes-Tr; EBT00001815443.
DR   EnsemblGenomes-Tr; EBT00001815444.
DR   EnsemblGenomes-Tr; EBT00001815445.
DR   EnsemblGenomes-Tr; EBT00001815446.
DR   EnsemblGenomes-Tr; EBT00001815447.
DR   EnsemblGenomes-Tr; EBT00001815448.
DR   EnsemblGenomes-Tr; EBT00001815449.
DR   EnsemblGenomes-Tr; EBT00001815450.
DR   EnsemblGenomes-Tr; EBT00001815451.
DR   EnsemblGenomes-Tr; EBT00001815452.
DR   EnsemblGenomes-Tr; EBT00001815453.
DR   EnsemblGenomes-Tr; EBT00001815454.
DR   EnsemblGenomes-Tr; EBT00001815455.
DR   EnsemblGenomes-Tr; EBT00001815456.
DR   EnsemblGenomes-Tr; EBT00001815457.
DR   EnsemblGenomes-Tr; EBT00001815458.
DR   EnsemblGenomes-Tr; EBT00001815459.
DR   EnsemblGenomes-Tr; EBT00001815460.
DR   EnsemblGenomes-Tr; EBT00001815461.
DR   EnsemblGenomes-Tr; EBT00001815462.
DR   EnsemblGenomes-Tr; EBT00001815463.
DR   EnsemblGenomes-Tr; EBT00001815464.
DR   EnsemblGenomes-Tr; EBT00001815465.
DR   EnsemblGenomes-Tr; EBT00001815466.
DR   EnsemblGenomes-Tr; EBT00001815467.
DR   EnsemblGenomes-Tr; EBT00001815468.
DR   EnsemblGenomes-Tr; EBT00001815469.
DR   EnsemblGenomes-Tr; EBT00001815470.
DR   EnsemblGenomes-Tr; EBT00001815471.
DR   EnsemblGenomes-Tr; EBT00001815472.
DR   EnsemblGenomes-Tr; EBT00001815473.
DR   EnsemblGenomes-Tr; EBT00001815474.
DR   EnsemblGenomes-Tr; EBT00001815475.
DR   EnsemblGenomes-Tr; EBT00001815476.
DR   EnsemblGenomes-Tr; EBT00001815477.
DR   EnsemblGenomes-Tr; EBT00001815478.
DR   EnsemblGenomes-Tr; EBT00001815479.
DR   EnsemblGenomes-Tr; EBT00001815480.
DR   EnsemblGenomes-Tr; EBT00001815481.
DR   EnsemblGenomes-Tr; EBT00001815482.
DR   EnsemblGenomes-Tr; EBT00001815483.
DR   EnsemblGenomes-Tr; EBT00001815484.
DR   EnsemblGenomes-Tr; EBT00001815485.
DR   EnsemblGenomes-Tr; EBT00001815486.
DR   EnsemblGenomes-Tr; EBT00001815487.
DR   EnsemblGenomes-Tr; EBT00001815488.
DR   EnsemblGenomes-Tr; EBT00001815489.
DR   EnsemblGenomes-Tr; EBT00001815490.
DR   EnsemblGenomes-Tr; EBT00001815491.
DR   EnsemblGenomes-Tr; EBT00001815492.
DR   EnsemblGenomes-Tr; EBT00001815493.
DR   EnsemblGenomes-Tr; EBT00001815494.
DR   EnsemblGenomes-Tr; EBT00001815495.
DR   EnsemblGenomes-Tr; EBT00001815496.
DR   EnsemblGenomes-Tr; EBT00001815497.
DR   EnsemblGenomes-Tr; EBT00001815498.
DR   EnsemblGenomes-Tr; EBT00001815499.
DR   EnsemblGenomes-Tr; EBT00001815500.
DR   EnsemblGenomes-Tr; EBT00001815501.
DR   EnsemblGenomes-Tr; EBT00001815502.
DR   EnsemblGenomes-Tr; cpfrc_r001-1.
DR   EnsemblGenomes-Tr; cpfrc_r002-1.
DR   EnsemblGenomes-Tr; cpfrc_r003-1.
DR   EnsemblGenomes-Tr; cpfrc_r004-1.
DR   EnsemblGenomes-Tr; cpfrc_r005-1.
DR   EnsemblGenomes-Tr; cpfrc_r006-1.
DR   EnsemblGenomes-Tr; cpfrc_r007-1.
DR   EnsemblGenomes-Tr; cpfrc_r008-1.
DR   EnsemblGenomes-Tr; cpfrc_r009-1.
DR   EnsemblGenomes-Tr; cpfrc_r010-1.
DR   EnsemblGenomes-Tr; cpfrc_r011-1.
DR   EnsemblGenomes-Tr; cpfrc_r012-1.
DR   EnsemblGenomes-Tr; cpfrc_t001-1.
DR   EnsemblGenomes-Tr; cpfrc_t002-1.
DR   EnsemblGenomes-Tr; cpfrc_t003-1.
DR   EnsemblGenomes-Tr; cpfrc_t004-1.
DR   EnsemblGenomes-Tr; cpfrc_t005-1.
DR   EnsemblGenomes-Tr; cpfrc_t006-1.
DR   EnsemblGenomes-Tr; cpfrc_t007-1.
DR   EnsemblGenomes-Tr; cpfrc_t008-1.
DR   EnsemblGenomes-Tr; cpfrc_t009-1.
DR   EnsemblGenomes-Tr; cpfrc_t010-1.
DR   EnsemblGenomes-Tr; cpfrc_t011-1.
DR   EnsemblGenomes-Tr; cpfrc_t012-1.
DR   EnsemblGenomes-Tr; cpfrc_t013-1.
DR   EnsemblGenomes-Tr; cpfrc_t014-1.
DR   EnsemblGenomes-Tr; cpfrc_t015-1.
DR   EnsemblGenomes-Tr; cpfrc_t016-1.
DR   EnsemblGenomes-Tr; cpfrc_t017-1.
DR   EnsemblGenomes-Tr; cpfrc_t018-1.
DR   EnsemblGenomes-Tr; cpfrc_t019-1.
DR   EnsemblGenomes-Tr; cpfrc_t020-1.
DR   EnsemblGenomes-Tr; cpfrc_t021-1.
DR   EnsemblGenomes-Tr; cpfrc_t022-1.
DR   EnsemblGenomes-Tr; cpfrc_t023-1.
DR   EnsemblGenomes-Tr; cpfrc_t024-1.
DR   EnsemblGenomes-Tr; cpfrc_t025-1.
DR   EnsemblGenomes-Tr; cpfrc_t026-1.
DR   EnsemblGenomes-Tr; cpfrc_t027-1.
DR   EnsemblGenomes-Tr; cpfrc_t028-1.
DR   EnsemblGenomes-Tr; cpfrc_t029-1.
DR   EnsemblGenomes-Tr; cpfrc_t030-1.
DR   EnsemblGenomes-Tr; cpfrc_t031-1.
DR   EnsemblGenomes-Tr; cpfrc_t032-1.
DR   EnsemblGenomes-Tr; cpfrc_t033-1.
DR   EnsemblGenomes-Tr; cpfrc_t034-1.
DR   EnsemblGenomes-Tr; cpfrc_t035-1.
DR   EnsemblGenomes-Tr; cpfrc_t036-1.
DR   EnsemblGenomes-Tr; cpfrc_t037-1.
DR   EnsemblGenomes-Tr; cpfrc_t038-1.
DR   EnsemblGenomes-Tr; cpfrc_t039-1.
DR   EnsemblGenomes-Tr; cpfrc_t040-1.
DR   EnsemblGenomes-Tr; cpfrc_t041-1.
DR   EnsemblGenomes-Tr; cpfrc_t042-1.
DR   EnsemblGenomes-Tr; cpfrc_t043-1.
DR   EnsemblGenomes-Tr; cpfrc_t044-1.
DR   EnsemblGenomes-Tr; cpfrc_t045-1.
DR   EnsemblGenomes-Tr; cpfrc_t046-1.
DR   EnsemblGenomes-Tr; cpfrc_t047-1.
DR   EnsemblGenomes-Tr; cpfrc_t048-1.
DR   EnsemblGenomes-Tr; cpfrc_t049-1.
DR   EuropePMC; PMC3019927; 21037006.
DR   EuropePMC; PMC3022926; 21192786.
DR   EuropePMC; PMC3917457; 23199210.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002097.
DR   SILVA-SSU; CP002097.
XX
CC   On Dec 13, 2019 this sequence version replaced CP002097.1.
CC   Source DNA is available from Vasco Azevedo, Depto de Biologia
CC   Geral, ICB/UFMG. Av. Antonio Carlos,6627. Pampulha, Belo Horizonte,
CC   Brazil.
CC   The annotation was added by the NCBI Prokaryotic Genome Annotation
CC   Pipeline (PGAP). Information about PGAP can be found here:
CC   https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
CC   ##Genome-Assembly-Data-START##
CC   Assembly Date          :: OCT-2019
CC   Assembly Method        :: edena v. 3.13
CC   Assembly Name          :: B208
CC   Genome Representation  :: Full
CC   Expected Final Version :: Yes
CC   Genome Coverage        :: 602.0x
CC   Sequencing Technology  :: Illumina HiSeq
CC   ##Genome-Assembly-Data-END##
CC   ##Genome-Annotation-Data-START##
CC   Annotation Provider               :: NCBI
CC   Annotation Date                   :: 12/12/2019 14:19:30
CC   Annotation Pipeline               :: NCBI Prokaryotic Genome
CC                                        Annotation Pipeline (PGAP)
CC   Annotation Method                 :: Best-placed reference protein
CC                                        set; GeneMarkS-2+
CC   Annotation Software revision      :: 4.10
CC   Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
CC                                        repeat_region
CC   Genes (total)                     :: 2,131
CC   CDSs (total)                      :: 2,068
CC   Genes (coding)                    :: 2,014
CC   CDSs (with protein)               :: 2,014
CC   Genes (RNA)                       :: 63
CC   rRNAs                             :: 4, 4, 4 (5S, 16S, 23S)
CC   complete rRNAs                    :: 4, 4, 4 (5S, 16S, 23S)
CC   tRNAs                             :: 48
CC   ncRNAs                            :: 3
CC   Pseudo Genes (total)              :: 54
CC   CDSs (without protein)            :: 54
CC   Pseudo Genes (ambiguous residues) :: 0 of 54
CC   Pseudo Genes (frameshifted)       :: 48 of 54
CC   Pseudo Genes (incomplete)         :: 4 of 54
CC   Pseudo Genes (internal stop)      :: 5 of 54
CC   Pseudo Genes (multiple problems)  :: 3 of 54
CC   ##Genome-Annotation-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2337241
FT                   /organism="Corynebacterium pseudotuberculosis FRC41"
FT                   /strain="FRC41"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:765874"
FT   gene            1..1812
FT                   /gene="dnaA"
FT                   /locus_tag="CPFRC_00005"
FT                   /old_locus_tag="cpfrc_00001"
FT   CDS_pept        1..1812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="CPFRC_00005"
FT                   /old_locus_tag="cpfrc_00001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00001"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27794"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400874.1"
FT                   /protein_id="ADK27794.2"
FT                   /translation="MSEAPSTWNERWQEVTNELLSQSQDPESGISITRQQSAYLRLVKP
FT                   VAFVEGIAVLSVPHARAKKEIETTLGPVITEVLSRRLGRQYSLAVSVHAPEENPEVSSA
FT                   TPDAVSDYQEQSAVSGQYGATSANADFQNQQSTIYRKPQESQYPVTFGASSYGNEKYQE
FT                   NSQDQGISHHPYGFNEAQRIASSASHAVPQSGSELLHDPVHTRRTDAALDQNYPGNTGG
FT                   WRTEHIQEPMPTEQIPSGTPRTREQPSFNPDRALALNPHYTFDSYVVSDSNKLPCSAAI
FT                   AVAEKPARAYNPLFIWGDSGLGKTHLMHAVGNYAQYLNPRLRIKYVSSEEFTNEYINSV
FT                   RDDRQEAFKRKYRELDILMVDDIQFLQGKEGTQEEFFHTFNALYQANKQIVLSSDRPPK
FT                   QLTTLEDRLRTRFQAGLIADIYPPDLETRIAILMKKAASESIVADREAIELIASRFNTS
FT                   IRELEGAFIRVSAYASLMSPDKGKHRIDLRIAEKALEDMMPEQANEEITATTILAATAE
FT                   YFEMDVNALKGSGKTRAVAHARQLAMYLCRELTDLSLPKIGEQFGGKDHTTVMYADRKI
FT                   RKEITEKKETYDEIQLLTQQIKSSSRG"
FT   gene            2053..2232
FT                   /locus_tag="CPFRC_00010"
FT   CDS_pept        2053..2232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00010"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366209.1"
FT                   /protein_id="QGW57305.1"
FT                   /translation="MWIISRGKKLSTGRTCYPPKFHSPLHNSKICNNRRISLSFHRVHR
FT                   TYCYYQRFTLKGTK"
FT   gene            2397..3584
FT                   /locus_tag="CPFRC_00015"
FT                   /old_locus_tag="cpfrc_00002"
FT   CDS_pept        2397..3584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00015"
FT                   /old_locus_tag="cpfrc_00002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /EC_number="2.7.7.7"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00002"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27795"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240862.1"
FT                   /protein_id="ADK27795.1"
FT                   /translation="MDAQAVSFRVEKEDLSGAVSWVARNLPTKPTQPVLRAVVITADDE
FT                   GLEFAGFDYEISTKVRISADVSQPGRIAVAGKLLSDIIGTLPAKPVEIFVEGSQALVVC
FT                   GSSRFELPLIPLDEYPILPKLPAATGAIDPKLFADAVLQVAAAAGKDDTLPMLTGIHME
FT                   IDGEDVTLTATDRFRLALRRFQWTPAVPDAKADLLIPAKNLSDNARSLDQNSTDPVEIA
FT                   VGAGESIGSEGLFGIHIDSRQTTTRMLDADFPNVNPLLPKVHKSMASVEISALADAIRR
FT                   VALVAERNAQIRLQFSKNEVILSAGGSDAGHAEESVPCAYTGDEDFLIAFNSGYLRDGL
FT                   SVIKTNRVVFGFTEPSRPAIMIPEPEELPEADSDGTFPTPNTDFTYLLMPVRLPG"
FT   gene            3651..4865
FT                   /gene="recF"
FT                   /locus_tag="CPFRC_00020"
FT                   /old_locus_tag="cpfrc_00003"
FT   CDS_pept        3651..4865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="CPFRC_00020"
FT                   /old_locus_tag="cpfrc_00003"
FT                   /product="DNA replication/repair protein RecF"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00003"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27796"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400877.1"
FT                   /protein_id="ADK27796.2"
FT                   /translation="MYIRELSLRDFRSWADCHVNLEPGVTVFVGRNGFGKTNIVEAIGY
FT                   IAHLGSHRVSQDSPLVHQGKDSARVSVTAVNQGRELTAHMLIKSKGTNQAQINRTRLKS
FT                   PRGLLGVVRTVLFSPEDLSLVRGEPGERRRYLDHIVATRKPRLAGVKADYDKVLKQRNS
FT                   LLKTASASLRRGYGADDGTLCTLDVWDAQLARLGSELIHARHSLVEELTPLVHSAYARI
FT                   APESRPARINYESTVPVPVAVTDAEEASSSIPDLDVLEASMLSQLGVQRKKEIDRGLTL
FT                   VGPHRDDLAVLLGDYPAKGYASHGETWSMALALRLAEFHLLSADGSEPILILDDVFAEL
FT                   DSKRRQKLVGIAMEAEQVLITAAVGDDLPDNLAESVVHRHTVTMTDTSEGRISELDKEG
FT                   TSDEQ"
FT   gene            4855..5427
FT                   /locus_tag="CPFRC_00025"
FT                   /old_locus_tag="cpfrc_00004"
FT   CDS_pept        4855..5427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00025"
FT                   /old_locus_tag="cpfrc_00004"
FT                   /product="DUF721 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00004"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27797"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240864.1"
FT                   /protein_id="ADK27797.1"
FT                   /translation="MSNKPADAGSEDPVAEAFAAIRAEAQRRTGRIPDLSVQAPRSGLK
FT                   LNHAPAAPRKHQKTGKPTGLDGRRLRRSYDVEPVGSVLSKEIQRRGWKHGIAGGWVHSH
FT                   WDELVGEKIAAHTKVEMLKDKSLFISCNSTAWATNLRMMQRTILQAIAEKVGPDVVAEL
FT                   KIFGPKTPSWRHGPLHVKGRGPRDTYG"
FT   gene            5567..7612
FT                   /gene="gyrB"
FT                   /locus_tag="CPFRC_00030"
FT                   /old_locus_tag="cpfrc_00005"
FT   CDS_pept        5567..7612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="CPFRC_00030"
FT                   /old_locus_tag="cpfrc_00005"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing) subunit B"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27798"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599257.1"
FT                   /protein_id="ADK27798.1"
FT                   /translation="MATAEHEYGASSITILEGLEAVRKRPGMYIGSTGERGLHHLVWEV
FT                   VDNSVDEAMAGHATHVDVTLLEDGGVEVVDNGRGIPVDMHASGAPTVQVVMTQLHAGGK
FT                   FDSDSYAVSGGLHGVGISVVNALSTRVEADIKLHGKHWYQNFSNAVPDELVQGGNARGT
FT                   GTTIRFWPDAEIFETTTFKFDIIARRLQEMAFLNKGLTLSLTDKRVSDEELELEAIADE
FT                   GDTAENVSLEKIDSDADGNIEAPAAPKKREKKKVFYYPEGLKDYVAHLNKSKQVIHPTI
FT                   VAFEAKGDDHEVEVAMQWNNGYAQSVHTFANTINTIEGGTHEEGFRAALTTLMNRYARE
FT                   HRLLKEKESNLTGDDCREGLSAVISVRVGDPQFEGQTKTKLGNTEVKGFVQRMVNEHVA
FT                   DWLDANPAEAKTIINKAVSSAHARMAARKARDLVRRKSATDLGGLPGKLADCRSKDPVK
FT                   SELYVVEGDSAGGSAKAGRDSLYQAILPLRGKILNVEKARLDKVLKNAEVQAIITALGT
FT                   GIHDEFDINKLRYHKIVLMADADVDGSHIATLLLTLLFRFMPQLIEEGHVYLAQPPLYK
FT                   LKWGKGDPGFAYSDAERDSLLEEGLAQGRKINKDDGIQRYKGLGEMNASELWETTLDPE
FT                   FRVLRRVDINDAQRADEIFSILMGDDVAARRSFITRRAKDVRFLDI"
FT   gene            complement(7694..8128)
FT                   /locus_tag="CPFRC_00035"
FT                   /old_locus_tag="cpfrc_00006"
FT   CDS_pept        complement(7694..8128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00035"
FT                   /old_locus_tag="cpfrc_00006"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00006"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27799"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400878.1"
FT                   /protein_id="ADK27799.1"
FT                   /translation="MSSLKSLLETKHATVGAELSAFIETTVAEQKGISGMALKGAIGAA
FT                   KAVNSDIVTKAANRLLPDVIEVLDPYWTQFEESGATDFGVFLAERKTEVSSELLVMADR
FT                   NAEKIDVPALKKAYSSLRGKAAGFIEPNVEGLGRIMQNHM"
FT   gene            complement(8442..8705)
FT                   /locus_tag="CPFRC_00040"
FT                   /old_locus_tag="cpfrc_00007"
FT   CDS_pept        complement(8442..8705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00040"
FT                   /old_locus_tag="cpfrc_00007"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00007"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27800"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799817.1"
FT                   /protein_id="ADK27800.1"
FT                   /translation="MRGLSPEQVLMLADDFCSTCNATINDFAAIAAIAAVTTASFEGSS
FT                   PFSSPAQQSEYLRSFVPQVSPLTRGNESFGIFLSRVLKDLNA"
FT   gene            complement(8702..8914)
FT                   /locus_tag="CPFRC_00045"
FT                   /old_locus_tag="cpfrc_00008"
FT   CDS_pept        complement(8702..8914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00045"
FT                   /old_locus_tag="cpfrc_00008"
FT                   /product="CopG family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00008"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27801"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400879.1"
FT                   /protein_id="ADK27801.2"
FT                   /translation="MAMTLRLTPEQDRALTLLAEIQGSSKHEAAVRAIINTAVRALADS
FT                   EIRELARAHLPAFTATERRIRGNRP"
FT   gene            9082..11646
FT                   /gene="gyrA"
FT                   /locus_tag="CPFRC_00050"
FT                   /old_locus_tag="cpfrc_00009"
FT   CDS_pept        9082..11646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="CPFRC_00050"
FT                   /old_locus_tag="cpfrc_00009"
FT                   /product="DNA gyrase subunit A"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00009"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27802"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799819.1"
FT                   /protein_id="ADK27802.1"
FT                   /translation="MSDDLLGGEGFDRIHPIDLNEEMETSYIDYAMSVIVGRALPEVRD
FT                   GLKPVHRRILYAMYDSGYRPERGYVKSARPVSDTMGQFHPHGDSAIYDTLVRLAQDWNM
FT                   RYPLVDGQGNFGSRGNDGPAAMRYTECRLTPLAMEMVRDIRENTVDFSPNYDGKTQEPD
FT                   VLPSRVPNLLMNGSNGIAVGMATNIPPHNLNELADAIFWLLENPDADEAAALEACMSYV
FT                   KGPDFPTSGQIVGSQGINDAYTTGRGSIRMRGVTSIEEEGSRQIIVITELPYQVNPDNM
FT                   ISNIAEQVRDGKLAGISKIEDESSDRVGMRIVVTLKRDAVPRVVLNNLYKHSQLQTNFG
FT                   ANMLSIVDGVPRTLRLDQMLRYYVTHQIEVIVRRTQHRLEEAEKRAHILRGLVKALDML
FT                   DEVIALIRRSATVDVARSGLIDLLTIDEIQADAILAMQLRRLAALERQKIIDELAEIEI
FT                   EIADYKDILAKPERQRAIVRDELKEIVTKYGDERRTQIIAATGDVTEEDLIARENVVVT
FT                   ITSTGYAKRTKVDAYKSQRRGGKGVRGAELKQDDVVRHFFVCSTHDWILFFTNFGRVYR
FT                   LKAYELPEASRTARGQHVANLLEFQPEERIAQVIQLQSYEDAPYLVLATAQGRVKKSRL
FT                   SDYESNRSGGLIAINLGEEDKLIGAALCSNDDELLLVSEEGQSIRFSADDDQLRPMGRA
FT                   TAGVKGMRFRGDDQLLAMTVVRSDAYLLVATSGGYGKRTSLEEYSQQGRGGLGVVTFKY
FT                   TPKRGKLIAAVVVDEDDQIFAITSAGGVIRTEVNQIRPSSRATMGVRLVNLEDGVELLA
FT                   IDRNVEGEGEETAEAVATGAIDGPADRGRQTEVNIEPEGADQ"
FT   gene            11646..11990
FT                   /locus_tag="CPFRC_00055"
FT                   /old_locus_tag="cpfrc_00010"
FT   CDS_pept        11646..11990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00055"
FT                   /old_locus_tag="cpfrc_00010"
FT                   /product="DUF3566 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27803"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525073.1"
FT                   /protein_id="ADK27803.1"
FT                   /translation="MATRHVVITRISPVSAFKTALSLSLIGLAAWVICVALLYLGMQAV
FT                   GVWDNVNEVIGGVGGSQIVTFGLVLSVAALMGAITSIIVTVLAPLGAIIYNAIVDLFGG
FT                   LAITYREEND"
FT   gene            12176..12252
FT                   /locus_tag="CPFRC_00060"
FT                   /old_locus_tag="cpfrc_t001"
FT   tRNA            12176..12252
FT                   /locus_tag="CPFRC_00060"
FT                   /old_locus_tag="cpfrc_t001"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:12210..12212,aa:Ile,seq:gat)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            12261..12333
FT                   /locus_tag="CPFRC_00065"
FT                   /old_locus_tag="cpfrc_t002"
FT   tRNA            12261..12333
FT                   /locus_tag="CPFRC_00065"
FT                   /old_locus_tag="cpfrc_t002"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:12294..12296,aa:Ala,seq:tgc)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            12433..13212
FT                   /locus_tag="CPFRC_00070"
FT                   /old_locus_tag="cpfrc_00011"
FT   CDS_pept        12433..13212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00070"
FT                   /old_locus_tag="cpfrc_00011"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27804"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400880.1"
FT                   /protein_id="ADK27804.2"
FT                   /translation="MTRVSTPRKSRRSPGWIPNQHGAWFMVTVPAIIGVALAPAWIDIP
FT                   LLLLWWCGYFAFFAASVWMRGRYRKHHLPPLVTYGVVTGISGLVVLLCQWQLVVWIPAF
FT                   LPLIGIAVYETWRRRPRSLLSGLATVCAACLILPVITWAGDGLTVRVWAICGVLLLYFA
FT                   GSIPYVKTLIRERGSRPWLIGSITFHIVFLIIACVAAAYQMVHVAVAVVAGILLLRAWL
FT                   MPVTGARRERLWTPRQVGLLDALLGVLVVLTAVLPPA"
FT   gene            13540..14055
FT                   /locus_tag="CPFRC_00075"
FT                   /old_locus_tag="cpfrc_00012"
FT   CDS_pept        13540..14055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00075"
FT                   /old_locus_tag="cpfrc_00012"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00012"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27805"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799820.1"
FT                   /protein_id="ADK27805.2"
FT                   /translation="MSSNKNVALRNLAVAAGATALGLGAVFGTAGAAMAADEPATPPAV
FT                   NAEKPAPSIEQDTPVDVDKPETLDPDEKTPEIDDRDDVLKYEPTTVKAGHTAYAEIKGD
FT                   VDEDTIFGYSQSGIPEGWFVSVDEETGKVSVSASPDAKPGDTYTVKVKVVDLDGKVTWA
FT                   EAPFTVGE"
FT   gene            14288..14360
FT                   /locus_tag="CPFRC_00080"
FT                   /old_locus_tag="cpfrc_t003"
FT   tRNA            14288..14360
FT                   /locus_tag="CPFRC_00080"
FT                   /old_locus_tag="cpfrc_t003"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:14321..14323,aa:Ala,seq:tgc)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            14365..14613
FT                   /locus_tag="CPFRC_00085"
FT                   /old_locus_tag="cpfrc_00013"
FT   CDS_pept        14365..14613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00085"
FT                   /old_locus_tag="cpfrc_00013"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: GeneMarkS-2+."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00013"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27806"
FT                   /inference="COORDINATES:ab initio prediction:GeneMarkS-2+"
FT                   /protein_id="ADK27806.2"
FT                   /translation="MKKTTSKFLEVVFLHEIGFEGMGGGVDTLKTITPNYQDAAAEVQQ
FT                   PSLEKETGLWADAAHPTGTGMRGCPRLRGEACAAQAL"
FT   gene            14686..15687
FT                   /locus_tag="CPFRC_00090"
FT                   /old_locus_tag="cpfrc_00014"
FT   CDS_pept        14686..15687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00090"
FT                   /old_locus_tag="cpfrc_00014"
FT                   /product="substrate-binding domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00014"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27807"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558533.1"
FT                   /protein_id="ADK27807.1"
FT                   /translation="MKNLRFPLHAAVITLAASVVLSACSATGGAPRSSNITGGQSGGVD
FT                   TPRYVVAMVTHGAPGDTFWNLIRKGAEDAAKKSNIELRYASDPEAPNQSNLIQNAIDSK
FT                   VDGIAVTMPNAEAIGPTAKKAVAAKIPTVALNAGLDAYQKYDISAFFGQEEKVAGTLAG
FT                   KRLAQDGAKHALCVIHEQGNSSQEARCAGLKEGLADADVEILYVNGKDMTSVQSTVQAK
FT                   LAQDKSIDWVMGLVAPVALTSVDAVKNSGSSAKISTFDTNAQLVTAIKNGTVQWAVDQQ
FT                   PYLQGYLAIDALWLAQRNGSTVGGNRPVYTGPSFVDATNVDKIADSAKEGLR"
FT   gene            15684..16769
FT                   /locus_tag="CPFRC_00095"
FT                   /old_locus_tag="cpfrc_00015"
FT   CDS_pept        15684..16769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00095"
FT                   /old_locus_tag="cpfrc_00015"
FT                   /product="ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27808"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799822.1"
FT                   /protein_id="ADK27808.1"
FT                   /translation="MIIPRPTAQSAAASTADVGTATKSDDRLRRRTGFSALIRRPEFAS
FT                   LLGAVAIFVLFLSVAPSFRSIDALTTVLYASSTLGIVAVSVGLLMIGSEFDLSSGVAVT
FT                   TAALAATMLNYNLHLNSWVGALLSLFIALAIGALSGYLVTKTGIDSFLITLAAFLMLQG
FT                   LNLAITKLVTSQVATPSIADMEGFPSAQKVFAGTVHIGSVSVRATVFWWIFFVAASSWL
FT                   LFKTRFGNWIFAVGGDANAARASGVPVARVKIILFMFVGFAAWFVGMHNLFTFDSIQAG
FT                   QGVGNEFLYIIAAVIGGCAMTGGRGTIIGTAIGALIFGMTNQGIVYAGWNPDWFKFFLG
FT                   AMLLFAVLTNTSFATLTKGRK"
FT   gene            16771..17544
FT                   /locus_tag="CPFRC_00100"
FT                   /old_locus_tag="cpfrc_00016"
FT   CDS_pept        16771..17544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00100"
FT                   /old_locus_tag="cpfrc_00016"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00016"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27809"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910426.1"
FT                   /protein_id="ADK27809.1"
FT                   /translation="MDTSTTPIIELRDITKSYGAFDALRGVNLSVASGEVTCVLGDNGA
FT                   GKSTLIKILSGLHKQTSGELLIDGQPVTFSGPREALDNGIATVHQNLAVVGQMSVWRNF
FT                   FLGQELTGFLGRLRESEMRSIAQEQLKTMGIDLPDIDVEVESLSGGQRQVVAIARAVYF
FT                   GARVIILDEPTAALGVKQSSMVLRFVAAARDKGLGVVLITHNPHHAYLVGDRFTILNLG
FT                   NQILNASRDQVTLEQLTQQMAGGGELEALSHELSR"
FT   gene            complement(17612..18283)
FT                   /locus_tag="CPFRC_00105"
FT                   /old_locus_tag="cpfrc_00017"
FT   CDS_pept        complement(17612..18283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00105"
FT                   /old_locus_tag="cpfrc_00017"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00017"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27810"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654890.1"
FT                   /protein_id="ADK27810.1"
FT                   /translation="MNSSTIRGAILVTKAAYDKYANYRDRKTREAYDALLNAADSYDDI
FT                   HKDVKANVTEFYDQSQERVSSLTEQARKRLDSAIADAAAAKDNTVKTVNKKSKKAQKAA
FT                   RKAAKSAKKSAAPKKQPSFGKRLFNFSVFTTILATIGAVAYYFLSKRNVVSTEPPHVED
FT                   FGADSVNTEESRLVYSTQTPVDDEEEHVSSPEEGATERDEKLLGSLEDQLRQHTDSKDT
FT                   K"
FT   gene            18361..18897
FT                   /locus_tag="CPFRC_00110"
FT                   /old_locus_tag="cpfrc_00018"
FT   CDS_pept        18361..18897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00110"
FT                   /old_locus_tag="cpfrc_00018"
FT                   /product="peptidylprolyl isomerase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00018"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27811"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910428.1"
FT                   /protein_id="ADK27811.1"
FT                   /translation="MMVRMTLKTATAILHTNRGDVAIELFGNHAPKTVENFVTLSDGSA
FT                   DYKTENASGTTEGPFYDGAVFHRIIDGFMIQGGDPTGTGRGGPGYMFADEFHPELQFDR
FT                   PFLLAMANAGPGTNGSQFFITVVPTPHLNNHHTIFGEVTDPASQKVVMDIAQTATDRMD
FT                   RPVEPVVIESVEITE"
FT   gene            18959..19729
FT                   /locus_tag="CPFRC_00115"
FT                   /old_locus_tag="cpfrc_00019"
FT   CDS_pept        18959..19729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00115"
FT                   /old_locus_tag="cpfrc_00019"
FT                   /product="rhomboid family intramembrane serine protease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00019"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27812"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523731.1"
FT                   /protein_id="ADK27812.1"
FT                   /translation="MFHENGGMSDPRILHAAYKQAPVTVLLSLSTLIIFLITAFQSQSI
FT                   TDNLYDSWIGTHWILYTPEMHEPLGMLRAIGSMFLHIGPGHLAINIFLLFFLGREIEQC
FT                   IGSALFCAAYFISGLGASLMIMIMDPLSPTAGASGAIYGLMAIMVAIAVTRKTDIRAPL
FT                   ILVAVNVGYSLIADNVSLWGHIGGLVAGSVVALPLMAFHRKHVIAGGTGGFLVYGMPRN
FT                   HRAFTKDRLITWFVVAAIVVCEAIGIWIVGMKLL"
FT   gene            20672..21019
FT                   /locus_tag="CPFRC_00120"
FT                   /old_locus_tag="cpfrc_00022"
FT   CDS_pept        20672..21019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00120"
FT                   /old_locus_tag="cpfrc_00022"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00022"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27815"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654892.1"
FT                   /protein_id="ADK27815.1"
FT                   /translation="MAERSVVALRSLAPVARGRGSKGGFTIEKIVSGERTSKQFSFAWS
FT                   CTSQGKEMKNGTIKLTNGDVHHEKQLDKDASCVIKEEDADAASEKKHSLKWSVDSEEKR
FT                   RGVRNHIHQAA"
FT   gene            22237..22590
FT                   /locus_tag="CPFRC_00125"
FT                   /old_locus_tag="cpfrc_00027"
FT   CDS_pept        22237..22590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00125"
FT                   /old_locus_tag="cpfrc_00027"
FT                   /product="CRISPR-associated protein Cas5"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00027"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27820"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240887.1"
FT                   /protein_id="ADK27820.1"
FT                   /translation="MTSIIQRTYLAEAEFIVEVASDTHGELLRDALRAPKFSTYLGRKA
FT                   FAPAFPFFLGATADVDVLHRIPACDLSGTKRDTAWVQIHHRSAGLQTSAEHINVPAVQE
FT                   RSDWLEKTKALFT"
FT   gene            complement(22665..23705)
FT                   /locus_tag="CPFRC_00130"
FT                   /old_locus_tag="cpfrc_00028"
FT   CDS_pept        complement(22665..23705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00130"
FT                   /old_locus_tag="cpfrc_00028"
FT                   /product="transposase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27821"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799830.1"
FT                   /protein_id="ADK27821.1"
FT                   /translation="MIMASHPYRNHCNVCGNLLKKNGKTSTGKTRYRCKGCGASSTATR
FT                   SGTLHQRQMKDFITWLLGPTSRYNNDISRAQRRSMSWCWQVPVPQPEMLDNAYILVLDK
FT                   GASFRPEHLLVAYNSSHVLGWKWVDKDNKIACMQVHDHFPQPSAAVIDGSQSTAQTIQS
FT                   IWPGIPVRRCLSHIRKSVDQKTSQTPRTQPAIEIKELTDSLKNVYTSEQAKLWLARYAR
FT                   WEDRWKELLKHRTNVSKDNCSIDDYEWEWTHKELRTIRFMYRKLIKKEELFFPFSGSDI
FT                   VAHNVFLSRRDSQLGETISTDITNLFSAHRGINHDHGCRMVEWYLNSKTESPFIPERII
FT                   SHDHWR"
FT   gene            24114..25037
FT                   /locus_tag="CPFRC_00135"
FT                   /old_locus_tag="cpfrc_00029"
FT   CDS_pept        24114..25037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00135"
FT                   /old_locus_tag="cpfrc_00029"
FT                   /product="phospholipase D"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00029"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27822"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799831.1"
FT                   /protein_id="ADK27822.1"
FT                   /translation="MREKVVLFLSIIMAIMLPVGNAAAAPVVHNPASTANRPVYAIAHR
FT                   VLTTQGVDDAVAIGANALEIDFTAWGRGWWADHDGIPTSAGATAEEIFKHIADKRKQGA
FT                   NITFTWLDIKNPDYCRDARSVCSINALRDLARKYLEPAGVRVLYGFYKTVGGPAWKTIT
FT                   ADLRDGEAVALSGPAQDVLNDFARSENKILTKQKIADYGYYNINQGFGNCYGTWNRTCD
FT                   QLRKSSEARDQGKLGKTFGWTIATGQDARVNDLLGKANVDGLIFGFKITHFYRHADTEN
FT                   SFKAIKRWVDKHSATHHLATVADNPW"
FT   gene            complement(25090..25956)
FT                   /locus_tag="CPFRC_00140"
FT                   /old_locus_tag="cpfrc_00030"
FT   CDS_pept        complement(25090..25956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00140"
FT                   /old_locus_tag="cpfrc_00030"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27823"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366233.1"
FT                   /protein_id="ADK27823.1"
FT                   /translation="MHTPKTISTDLPTTAGISTDHTSALRTENVTLSWDKHVVSTDLSV
FT                   DIPTGKFTAIIGPNGCGKSTLLKSCARILAPDTGSIYLNQHNLTHLHTKEIAKQLALLP
FT                   QSTITPADITVEELVRRGRFPHHNWLHQWTAEDTRAVDAALNAASVKELTHKRVTDLSG
FT                   GQRQRVWLAMVLAQNTPTVLLDEPTTFLDIAHQYQLLELARSLTTQLNRTVVAVLHDLQ
FT                   QAVRYADHLIVMKNGSIVATGSPQEVISAELISEVFNITVRTMLIDDQLIVIPTELPVP
FT                   NVAMMQG"
FT   gene            complement(25965..26951)
FT                   /locus_tag="CPFRC_00145"
FT                   /old_locus_tag="cpfrc_00031"
FT   CDS_pept        complement(25965..26951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00145"
FT                   /old_locus_tag="cpfrc_00031"
FT                   /product="iron chelate uptake ABC transporter family
FT                   permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00031"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27824"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366234.1"
FT                   /protein_id="ADK27824.1"
FT                   /translation="MTHRRSLYTALILTLLLAISAAVAVSLPGAGITTAKVWSVFQGDD
FT                   SSLAHTIVFSWRAPRIVTALFVGAALGIAGSLFQALTRNPLGSPDIIGFNTGAYTGVLL
FT                   TMMAGMTSFASVAFGALAGGLATALAVMAFSVRVRIDGLRIILVGLGVSAMLSAFNRWL
FT                   ITRGDLNTALSAASWGAGTLNGIRWAAATPAVIALGIIVALALLLGSRIDILNLGDDTA
FT                   TALGLPVNPSKFVLLIVGVLLIATTTAIAGPISFIALASPHIAQRITASPRTPLLVSAL
FT                   TGATLLLVADIIAQRAFAPVQLPVGLVTVVIGGIYLLSLIASASRRA"
FT   gene            complement(26951..28018)
FT                   /locus_tag="CPFRC_00150"
FT                   /old_locus_tag="cpfrc_00032"
FT   CDS_pept        complement(26951..28018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00150"
FT                   /old_locus_tag="cpfrc_00032"
FT                   /product="iron chelate uptake ABC transporter family
FT                   permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00032"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27825"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523733.1"
FT                   /protein_id="ADK27825.1"
FT                   /translation="MVSTASSNPSPIRGFLRKSQPNVQRTRRSLLVVVLLLAVLLVVGS
FT                   IASVMIGARLIPLPEILNALFHPDPTNVSSTIVWDRRVPRTLLAIVAGMSLGLAGTLSQ
FT                   ALTRNPLADTGALGINSGAAFAIVVGIALFGASSPWAFLALALLGACGAAAVVYSVGTH
FT                   RSATADPVRLVLSGVALSAILSGIGEGLSLVNPQAFDRLKSWMVGSVDVGTLMPLGIAG
FT                   VGLAFGIVLTIACAHGLNALALGDAMATSIGASTARIRFISFIAVVILAASATAAAGVI
FT                   IFLGLMVPHVARWIVGPDLPRVLITSLLLGPLVLVVADIVGRLIVPGEFPAGVVVSFIG
FT                   APFLIAYAQSRKGDM"
FT   gene            28065..29117
FT                   /locus_tag="CPFRC_00155"
FT                   /old_locus_tag="cpfrc_00033"
FT   CDS_pept        28065..29117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00155"
FT                   /old_locus_tag="cpfrc_00033"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00033"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27826"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910452.1"
FT                   /protein_id="ADK27826.2"
FT                   /translation="MKDTQSLNTWSHRIAVMLALFLSISLIFSLAACSSEEKQSKDAGQ
FT                   GNADVATGGAHFSTADAETAKLGSDAAPGEFPRTVKHALGETEIKEQPKRVVVLDTGEL
FT                   DSVLSLGITPVGMVTTKGANPVPSYLADKVKDVKSVGTINEINVEEIAALQPDLILGSK
FT                   LRADKIYAQLAEVAPTVFSIRPGFPWKENFLLIGDALGKEKEAEAKLNEYTEKVETIKA
FT                   SVPADTTVSLLRFMPKRIRLYGNKSLLGVILKDAGLARPENQNIDELATEISPETIDQA
FT                   EGSVIFYSSYGKPDATGQDAIVNGAAWKNLNAVKNGQAHEVNDDVWFLGLGPTGAMQIV
FT                   EELKELLPKK"
FT   gene            complement(29249..29518)
FT                   /gene="crgA"
FT                   /locus_tag="CPFRC_00160"
FT                   /old_locus_tag="cpfrc_00034"
FT   CDS_pept        complement(29249..29518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crgA"
FT                   /locus_tag="CPFRC_00160"
FT                   /old_locus_tag="cpfrc_00034"
FT                   /product="cell division protein CrgA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00034"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27827"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910453.1"
FT                   /protein_id="ADK27827.1"
FT                   /translation="MPKSKITQSSAPFASSSTSNRTPVKINSTGTPVWYKTIMFGLILA
FT                   GLLWLIVNYLAGEDIAFMMSLGAWNYGIGFGLFIVGLLMTMGWR"
FT   gene            complement(29631..31625)
FT                   /gene="pknB"
FT                   /locus_tag="CPFRC_00165"
FT                   /old_locus_tag="cpfrc_00035"
FT   CDS_pept        complement(29631..31625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknB"
FT                   /locus_tag="CPFRC_00165"
FT                   /old_locus_tag="cpfrc_00035"
FT                   /product="Stk1 family PASTA domain-containing Ser/Thr
FT                   kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27828"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240895.1"
FT                   /protein_id="ADK27828.1"
FT                   /translation="MNDVIAGRYELGEVIGTGGMSEVYSATDTLLGREVAIKMLRADLA
FT                   RDVNFRERFRREAQNSGKLNHPAIVAVYDTGETERAGISTPYIVMERVHGRTLRDIVRE
FT                   DGPLSPTEAAQTLLPVCQALQFSHDAGIIHRDIKPANVMITNTGAVKIMDFGIARALDD
FT                   ATSAMTQTSAVIGTAQYLSPEQARGKLADARSDVYALGCVLYETLTGRPPFEGETPFAV
FT                   AYQHVQEDPAKPSEFVSDLTPTAAVNVDAVVLTAMAKHPGDRYQTAMEMGADLERLARH
FT                   AVTEAARHYVSPASLISQEPNPTTIVPVTQLDQPEADPVTSRAERAGYERSAFAGPAHA
FT                   AEEDRSGMSKAMKAVLAVLAVLVLGVGGAFAYDYVSNSSKNRSLVNIPKLEKTSQQDAV
FT                   NQLEQLGLQVNVIEEANPEVPRGKVIRTNPTSGSSVQKNTTVTVIVSSGKEVTEVPDLA
FT                   RKNTADAAKILEEAGLQLDSTVREESSDSVPNGEIIEQTPSAGSQVSRGSKVVITVSTG
FT                   VQNVRVPVVTGMKWDQAEGNLTSLGFVPDVRTVDAPEPAGTVVAVSGEGTEVPKGSTIT
FT                   VKVSNGQMFNVPNITRLTVADAVRALNAAGWTGTASKLTQGERVPTVSLSDQNLIASQV
FT                   PAAGTPLRKDSPIEIHLYEFSLSALTGTR"
FT   gene            complement(31622..33142)
FT                   /locus_tag="CPFRC_00170"
FT                   /old_locus_tag="cpfrc_00036"
FT   CDS_pept        complement(31622..33142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00170"
FT                   /old_locus_tag="cpfrc_00036"
FT                   /product="protein kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00036"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27829"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799836.1"
FT                   /protein_id="ADK27829.1"
FT                   /translation="MSIDYASPDPALQALIGDDYRLQWVVGTGGMSTVWLADDTRNQRE
FT                   VAVKVLRPEFSDNNEFLSRFRNEALASENIISENVVQTFDYRELTDPSGRTLCFIVMEY
FT                   VRGESLADMLARKGTLDEDLALDVLEQAAHGLSIIHRMGMVHRDIKPGNLLITQNGKVK
FT                   ITDFGIAKAAAAVPLTRTGMVVGTAQYVSPEQAQGKDVTEASDVYSLGVVGYEMLAGRR
FT                   PFTGDSSVSVAIAHINQAPPALPTTVSAPARELIGIALRKDPAHRYADGNELALAVSTT
FT                   RMGQRPPQPQSAQLQQIAPEPTPTASTHALGQTAQPTTVIPATGEVPQTVSVGQMTGTH
FT                   TGYSAAPATIPPEEKKKSSGGVGTGLAVGVLLAALFGAGVWAASQGIFGDLLGGSDQPS
FT                   SSVNPETITATVTETPTIREEPRPIQRPQVTPTISSEPSEFPDASESVVPLPPTDNPRT
FT                   APTVDLNERSQVPSTHQNTSPTPTRGNGSDPIADLLNTLNTPEQGGAP"
FT   gene            complement(33150..34610)
FT                   /locus_tag="CPFRC_00175"
FT                   /old_locus_tag="cpfrc_00037"
FT   CDS_pept        complement(33150..34610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00175"
FT                   /old_locus_tag="cpfrc_00037"
FT                   /product="penicillin-binding protein 2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00037"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27830"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240897.1"
FT                   /protein_id="ADK27830.1"
FT                   /translation="MNRSIRFTSVFALLLILVLLVNLTRIQGFSQEKYAQSPYNRRAFI
FT                   EAKSQARGQISAGGQVLAESYKDENGYYQRRYVTNPIAYGPVQGYLSDIYGTAGLESSY
FT                   NGILNGTDDSLGFSRWWDDLLGNEHKGANVELTLVPSVQEVAYNQLANAGYEGAVVALR
FT                   PSTGEVLAMASTPSFDPAAIVDPTTAESTWAALNSNPGNPLLNHATQEILPPGSTFKVI
FT                   TTAAGLNAGYGPDSKLTGQSQITLPGTTATLENYAGQTCAGAKEVTLATAFQFSCNTAF
FT                   VQMGIDTGAEKLQEAANAFGVGDSYDLGIGMARGTIGDISSAAARGQSAIGQKDVAMSV
FT                   LQNAVIAATVANGGKRMEPYLVSKIVGQDLKTISETKPRELNQAISPQVSTTLTQLMRL
FT                   SERHTAGYTGADIASKTGTAEHGEDSRNSNPHAWYIAFGPSVNADVAVAVVVKNGGSAG
FT                   QAATGGSVAAPIGRAVIAAAQAARGAQR"
FT   gene            complement(34607..35980)
FT                   /locus_tag="CPFRC_00180"
FT                   /old_locus_tag="cpfrc_00038"
FT   CDS_pept        complement(34607..35980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00180"
FT                   /old_locus_tag="cpfrc_00038"
FT                   /product="cell division protein FtsW"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00038"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27831"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400888.1"
FT                   /protein_id="ADK27831.1"
FT                   /translation="MSFAQRLASRRIEFGLLVLATVLIGVTLINLNMAQGLKVTTETLW
FT                   VIGGFIGVFTIAHLAICFTAPNADQLMLPVASVLNGLGLVTVYRLDLATGKSLAGRQVI
FT                   WTLVAIILMIVVLTVIRNHRILSRYSYILGLLGLVLLALPLVWPTKMNADANIWISIGP
FT                   FSVQPGEFSKILLLLFFAQLLVNKRALFNVAGYRLLGLEFPRLRDLGPILAVWFFAILV
FT                   MAGENDFGPALLLFSTVLGMLYLATNRVSWLLIGAMLVVIGGTTLYQISSKIQSRVNNF
FT                   MDPLANFNGTGYQLSQSLFGLSSGGVAGSGLGQGHPELIPVAESDFILAVLGEEIGLVG
FT                   LAAILVLFAIFVTRGFRTALRARDSYGKLVASGLSLTIAIQVFVVTAGITALMPMTGLT
FT                   TPFMSQGGSSLMANYILLGLILRISHSAHSGQSDVAGATAQGGSSVGHRPVVSKEAQR"
FT   gene            complement(35981..37492)
FT                   /locus_tag="CPFRC_00185"
FT                   /old_locus_tag="cpfrc_00039"
FT   CDS_pept        complement(35981..37492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00185"
FT                   /old_locus_tag="cpfrc_00039"
FT                   /product="protein phosphatase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00039"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27832"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240899.1"
FT                   /protein_id="ADK27832.1"
FT                   /translation="MLRLNYAVASDRGLVRGNNEDSAYAGPHLIALADGMGGHAAGEVA
FT                   SQLMIKHLMPLDASPDDNDMLALLASGADDANRAIAQGVRDEPATNGMGTTLTAIMFNG
FT                   TDLAMCHVGDSRGYRYRNGELEQITVDDTYVQSLVDKGELSPEDVSTHPQRSMILKAYT
FT                   GRPVEPTLTMLEARAGDRLLLCSDGLSDPVTHSTIETAIAQGTPAEVARKLVDLALRSG
FT                   GPDNVTVVVADIVEGPSDDQELPVVPVTAGALNGEQPEDPRPDTSAGRAAIVMAARQPQ
FT                   TIPARDAHTVTADQANAVNTNEPPTDGEKKSGRGKFWAGIITLLVIAAAIAGGWWAKTM
FT                   VDNNYYVTTANEEGLENAIVIERGVDLEFFGKPLHSTYQYACLNSSGDLSLIPENSHDT
FT                   CHRFRLKDLTESARSSVASLPEGNYNDVQQQVQQLANQLLPVCVTREAVTKPEEKKPED
FT                   QAPNGAPPQAEANPAAPQEQEGASPSKKPEPGDLSTPGVTCREVK"
FT   gene            complement(37492..37971)
FT                   /locus_tag="CPFRC_00190"
FT                   /old_locus_tag="cpfrc_00040"
FT   CDS_pept        complement(37492..37971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00190"
FT                   /old_locus_tag="cpfrc_00040"
FT                   /product="FHA domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27833"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240900.1"
FT                   /protein_id="ADK27833.1"
FT                   /translation="MESVIVFSLRIALLVLLWLLILLALWIQRKDAKTASQSSGAPVAA
FT                   PAIPGAMNVSKPAKRGGTPRQIVIVEGPLMGSRLDLGSLDEITLGRAKECTFVVGDDYA
FT                   SARHARLIKRGNEWFVEDLDSRNGTFVGGYRIDQPEKISTGSDIKIGRTTVRLAA"
FT   gene            complement(38048..39001)
FT                   /locus_tag="CPFRC_00195"
FT                   /old_locus_tag="cpfrc_00041"
FT   CDS_pept        complement(38048..39001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00195"
FT                   /old_locus_tag="cpfrc_00041"
FT                   /product="DUF3662 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27834"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240901.1"
FT                   /protein_id="ADK27834.1"
FT                   /translation="MSLMDKMARLDSAMQRGLDNGFAFVFGGKVVPAEIEELLKQEAQD
FT                   NLVRTYEGDVEAPNVFHIGVSPKDLANLSQRYPSLADDFADQMSRYNRNQGWTCVGPVV
FT                   VTIAIESGLRTGQLRAFSSVDPTPTGYSGFQGIDYAAPDSVDADDIEDIEDADNTDPKG
FT                   SQWDSDSFQDDESEDVVQHYQSPQFPQEPRTEYLTAQAPEAIHTEVPVPPAAPTTPTVS
FT                   LLLQDGSSRTYLVHEGSNIIGRSNDADFRLPDTGVSRQHAEITWNGHDAILTDLKSTNG
FT                   TTVNDTPIDNWLLEDGDVITVGHSHIEVRIVHPTYY"
FT   gene            39351..39434
FT                   /locus_tag="CPFRC_00200"
FT                   /old_locus_tag="cpfrc_t004"
FT   tRNA            39351..39434
FT                   /locus_tag="CPFRC_00200"
FT                   /old_locus_tag="cpfrc_t004"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:39385..39387,aa:Leu,seq:cag)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            complement(39657..40370)
FT                   /locus_tag="CPFRC_00205"
FT                   /old_locus_tag="cpfrc_00042"
FT   CDS_pept        complement(39657..40370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00205"
FT                   /old_locus_tag="cpfrc_00042"
FT                   /product="CPBP family intramembrane metalloprotease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00042"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27835"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522938.1"
FT                   /protein_id="ADK27835.1"
FT                   /translation="MSQTQNRYAGISPPPRITHLLWATVLLISMVIGAVSGGFAAGFLA
FT                   KKIQAPVTDFIVVGGMLGASLLGIALFYLGFIQRCHWGRRELGFISSSRSLWHLMWWFP
FT                   LTVTIGSIGAMIVGTSMGLSSKEADNAAAGFHLGPIASIALLAGTILIVPFFEEVIFRR
FT                   VLLDWLATKMPIQFASFLVILAFTLAHVSPAIMAYVFFLGISLGLARLWFSTMWAPLIV
FT                   HAANNALVTIIALSA"
FT   gene            complement(40509..41039)
FT                   /locus_tag="CPFRC_00210"
FT                   /old_locus_tag="cpfrc_00043"
FT   CDS_pept        complement(40509..41039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00210"
FT                   /old_locus_tag="cpfrc_00043"
FT                   /product="DUF2812 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00043"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27836"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799839.1"
FT                   /protein_id="ADK27836.1"
FT                   /translation="MNTIRIGSGLAFSPNKDLELFSRMAAKGKHLSGVGLAGHGWTFKD
FT                   GEPEHAIFDLVYEHNPHQDFYDIFAAAGWTHVLSASNIHVFKAPPGTTPAHTSIESKRE
FT                   EFTRQIKIFSRYSATALAVFIAAVFIITYVQLPSWVAPLVLVITLAPVVYTVMPLLGYC
FT                   WHRFRLPAPQSLA"
FT   gene            complement(41036..41359)
FT                   /locus_tag="CPFRC_00215"
FT                   /old_locus_tag="cpfrc_00044"
FT   CDS_pept        complement(41036..41359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00215"
FT                   /old_locus_tag="cpfrc_00044"
FT                   /product="PadR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00044"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27837"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910473.1"
FT                   /protein_id="ADK27837.1"
FT                   /translation="MARSSGFDNGNLSDAAVHILLALIEPRHGYAVMQFLHDASHGHID
FT                   IGPASLYTTLKKLTAANLITEVDTDENRRIYHITPHGHEVLTDNLERRRQLITMVDSIL
FT                   ETS"
FT   gene            complement(41535..42533)
FT                   /locus_tag="CPFRC_00220"
FT                   /old_locus_tag="cpfrc_00045"
FT   CDS_pept        complement(41535..42533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00220"
FT                   /old_locus_tag="cpfrc_00045"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27838"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240905.1"
FT                   /protein_id="ADK27838.1"
FT                   /translation="MRISQSLTVITSTALLLTACGSSVTAPETSTSSTAKAVTISNCGR
FT                   ELSFDKAPEALVGMHPAQTELLIRLGLKDKIVGQAQAKAQALPDDVVDKAKNIPTIGGV
FT                   MPPSREELLAVKPDFVYSPTTYEFSAKQGFASIEQLKEAGAAAYVATGGCEDRRMTGEV
FT                   SDLFTDLANLGTIFGVQEEAQKMIDKDKAELEGVENALKDQKKLRVAQIYREGDTLQAI
FT                   GAGIEYDILKRAGADNVFTPDQKNFSEFFASTLTPEALAAENPEAIVFAAYDADHEQST
FT                   RDYLTKTFPDMPAVRENRIISVSTSDMFPGTQGNIKAVKHIASQLYPGAVK"
FT   gene            complement(42543..43313)
FT                   /locus_tag="CPFRC_00225"
FT                   /old_locus_tag="cpfrc_00046"
FT   CDS_pept        complement(42543..43313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00225"
FT                   /old_locus_tag="cpfrc_00046"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00046"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27839"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910474.1"
FT                   /protein_id="ADK27839.1"
FT                   /translation="MNIEFDCVSVELSGRTVVDRVSASVESGQILGLVGPNGSGKSTLL
FT                   RTVYRGLNPASGTVRLGGEDVRALSHREVARRVAVMLQDSPTDFDLTVEETVMLGRAPH
FT                   HSILGRDTDKDVRIVEEAMHATDVVELADRMVFTLSGGQRQRVLLARALAQRTPALLLD
FT                   EPSNHLDISHQHELMSTVAYHGGTVIAALHDLNLAMHYCDRVLLLKQGSVVAMGTPSQV
FT                   LTPELIRETFAINAHLLPGPVDPVLAFTPLSSSL"
FT   gene            complement(43310..44434)
FT                   /locus_tag="CPFRC_00230"
FT                   /old_locus_tag="cpfrc_00047"
FT   CDS_pept        complement(43310..44434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00230"
FT                   /old_locus_tag="cpfrc_00047"
FT                   /product="iron chelate uptake ABC transporter family
FT                   permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00047"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27840"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522074.1"
FT                   /protein_id="ADK27840.1"
FT                   /translation="MPHHNAIKQLSGKTAGASKQLTTRRRQTAKTRLICAVLTVAILIL
FT                   LIVSGATGTVDVSLLEAAQIVTGHLIPNMPWMSDGSLSTLQDQAVWQFRLPRTLLAGVA
FT                   GAGLALAGALMQVTVRNPLAEPYILGVSSGASVGAVLVIVLGSAALGGLPLNIAAFLGA
FT                   LCACIAVSLLARKDGTLSPTRMILAGVALGTLLSAITSYLTISTSAQNVVSVMFFLLGS
FT                   VSAASLSSVVAPLVALLVSLVVTYMLARHLNVLMTGDESAMSLGVNATKLRALLLVIAS
FT                   VLTGTVVAVAGGIGFVGLVVPHIARIAVGADHRRMIPVTVLGGMAFLMAADLLARTIAH
FT                   PTEIPLGILTAFVGAPFFLWLMRQGGAEKAGYGR"
FT   gene            complement(44505..45887)
FT                   /locus_tag="CPFRC_00235"
FT                   /old_locus_tag="cpfrc_00048"
FT   CDS_pept        complement(44505..45887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00235"
FT                   /old_locus_tag="cpfrc_00048"
FT                   /product="magnesium transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00048"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27841"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240908.1"
FT                   /protein_id="ADK27841.1"
FT                   /translation="MHQANLSPTTPSADATMVEVLRSHTPEAAAQWFAAMPHSTVTTLI
FT                   TDLSTDDLYTLATTLTPENARTLLTVFGPEATARVLHALSPRECAELVVTLDTDVAAQT
FT                   LRRLAMDSEEFVDDLLSALPVATSAVLSRVLSWPAECAGAWMRPEAIKIPVHSSVGTAA
FT                   EACRQAPSTFNEGIFIVDSDMHLVGWLAPATLITSPDRTPVEDVMVDAATVRTWSTKPL
FT                   SDQEQATELAHRSPTGTVPVLDADHVLGVITRNSITRIHESELREDNALQGGASPLEVS
FT                   YRQASIKQLWRVRIVWLALLFLAEMYTGTVLRHFQDELEAVVALAFFIPLLIGTGGNIG
FT                   TQITTTLIRAMSTESLRLHDMGRVLPKELGAGLLLGLAMGLLGAIRAWSLGVVQPVILT
FT                   VAIALVCICLWSSLIASFLPLLLKRFGADPAVVSGPMISTIVDGTGLVIYFTVARLIIL
FT                   GN"
FT   gene            complement(46165..47763)
FT                   /locus_tag="CPFRC_00240"
FT                   /old_locus_tag="cpfrc_00049"
FT   CDS_pept        complement(46165..47763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00240"
FT                   /old_locus_tag="cpfrc_00049"
FT                   /product="DUF3459 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00049"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27842"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525116.1"
FT                   /protein_id="ADK27842.1"
FT                   /translation="MFNPRNGLPVPPAWLETAIFYEIYPQSFYDSNGDGIGDIQGIVDK
FT                   LDYIADLGANALWINPCFDSPFKDVGYDVRDYYTVAPRYGTNADLEKLFTEAHNRGIKV
FT                   LLDLVPGHTSEQNDWFQYSCKAEPNQYSDRYIWTSHAFDNGDGLPFIGGEAPRNGTYIL
FT                   NFFKSQPALNYGFNKKTRPWQQSVDAPGPVANQEEMANIMRYWLDKGADGFRVDMADSL
FT                   VKFDGEDKQETIKVWQKIFARFRNDYPEAAFVSEWGKPIQALKAGFDMDFYLDWRNNGY
FT                   NILARNTDDPLGRSEDLSFFKQVSGTSPQEFIDQYWPQYEQIRDLGYFSLISCNHDTPR
FT                   LAPRLNDAERRLFFMFLLTMPGVPFIYYGDEIGMRYLDIPTKEGGYQRTGTRTPMQWDA
FT                   AKKNYGFSSAQTEELYLPQDTAADAPDAASQMLDPAALRPFIQKLIGLRSQHPELHADS
FT                   DFSFLWAHDNSRILAYRRESSDGKRCAVALNAGDTADSITLESPATIIVSSGDARVEDN
FT                   TVHLGPSSGVVVELA"
FT   gene            48054..48344
FT                   /locus_tag="CPFRC_00245"
FT                   /old_locus_tag="cpfrc_00050"
FT   CDS_pept        48054..48344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00245"
FT                   /old_locus_tag="cpfrc_00050"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27843"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240910.1"
FT                   /protein_id="ADK27843.1"
FT                   /translation="MSCTTHAEHTHTHGPECGHVAVPHGDHVDYVHDGHLHREHEGHWD
FT                   ECETTEHHVHENHDHQHGPECGHVAVPHGDHVDYIHDGHRHAFHEGHWDDH"
FT   gene            complement(48501..49775)
FT                   /locus_tag="CPFRC_00250"
FT                   /old_locus_tag="cpfrc_00051"
FT   CDS_pept        complement(48501..49775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00250"
FT                   /old_locus_tag="cpfrc_00051"
FT                   /product="MFS transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00051"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27844"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523734.1"
FT                   /protein_id="ADK27844.1"
FT                   /translation="MGEEIITCPRFFPGDGKKLGSIYALAVTYFFVATCGAMTSLAISL
FT                   HFASRESGEALVSAVLISGACAQVFLSPLLTPFFDRFRPLTVAQTAAFIECVALVLLCF
FT                   FPEPAFLIAGNVVVATLSGLSIPAYFVIAEECAPSHNQAHVFSLLDTARLSGSFAGPAL
FT                   GGLLLDFGTLSTALAYEAAAVAGSFLVLCILGFRLRKNFAQINSTNTGRKPLKIFRSIL
FT                   EAPALLLTQPHTRQALTSIWAAIIFTSIYNVALVFYATETLQASGLIYAIVAQGFIAGR
FT                   IFGARISARLTETNALPTLVKAGAAMGLCIAIPGFVPSLLVCIPFFALAGVCNALQVAA
FT                   LRIVIVGSVRPAIKSKALSTMGTVNNSAMLVGYIVGAPVITSIGPSLALVVAGLGTMLF
FT                   TVLPPTWRALRIATRGKTVTSSPSC"
FT   gene            complement(50411..50620)
FT                   /locus_tag="CPFRC_00255"
FT   CDS_pept        complement(50411..50620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00255"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300367.1"
FT                   /protein_id="QGW57306.1"
FT                   /translation="MLATNVTTQQHANIKAEPHAHTLDRSDTKFFDKLPPQLETELAGV
FT                   SPPGAATRRNPREDAPVGTHKIRR"
FT   gene            complement(50998..51642)
FT                   /locus_tag="CPFRC_00260"
FT                   /old_locus_tag="cpfrc_00052"
FT   CDS_pept        complement(50998..51642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00260"
FT                   /old_locus_tag="cpfrc_00052"
FT                   /product="anti-sigma factor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00052"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27845"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654914.1"
FT                   /protein_id="ADK27845.1"
FT                   /translation="MTPTGHSEPFDDFPHDVEALLAQAPAPIIPSAQLRDNILDAIADI
FT                   PQEEPEATHAPPIDVPAEPIADVIPLSGRRKFTRGFLAVAASVAIIAGGFAFWPQADPH
FT                   AEMHSILAASDVRQANTHAMGASLDIVVSSSMNEGGALVDGAPKLSEGMGAQVWAVMAD
FT                   GSTKSAGVIGPEDHDGVWMPLPGETSKVMITEEPLKGSSQPQGTVLAVVDV"
FT   gene            complement(51639..52226)
FT                   /locus_tag="CPFRC_00265"
FT                   /old_locus_tag="cpfrc_00053"
FT   CDS_pept        complement(51639..52226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00265"
FT                   /old_locus_tag="cpfrc_00053"
FT                   /product="sigma-70 family RNA polymerase sigma factor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00053"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27846"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240913.1"
FT                   /protein_id="ADK27846.1"
FT                   /translation="MISTLSVVELPVMDPDNLLVASAHGDQRAFAALYDLLAPQMLGLA
FT                   AQIIHDRAQAEEVIQEVFIELWRSAKSYDPAKGGARSWALRLTRLRAIDRLRSDVATKQ
FT                   RDNKDFLEQTTTWHAAEEEAVESLESQRVRKLVDAIGEPHRTAVMLAYFSGLTHPEIAQ
FT                   ATGVPLGTAKTRVRDGLKKLRSAMSLMQGGAQ"
FT   gene            complement(52286..52579)
FT                   /locus_tag="CPFRC_00270"
FT                   /old_locus_tag="cpfrc_00054"
FT   CDS_pept        complement(52286..52579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00270"
FT                   /old_locus_tag="cpfrc_00054"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00054"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27847"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240914.1"
FT                   /protein_id="ADK27847.1"
FT                   /translation="MKNTTIRKALIIGAFSAAALGLTACGDDPAPASQTSTSESSQPSD
FT                   AMSKDAMTKEDAMTKDAMTKDAMDRMEHREGMDGKDHMDRMEHTEPSDAMKH"
FT   gene            52937..54574
FT                   /locus_tag="CPFRC_00275"
FT                   /old_locus_tag="cpfrc_00055"
FT   CDS_pept        52937..54574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00275"
FT                   /old_locus_tag="cpfrc_00055"
FT                   /product="redoxin domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27848"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240915.1"
FT                   /protein_id="ADK27848.1"
FT                   /translation="MLELILIGLIGGIVTGISPCILPVLPVVLAVSVDRKPTHVISGLA
FT                   LSFATITLVGTLILGALGLPKDVLRWGGIILLVLVGVGMIVPKLGEWIEAPFNRIPRPT
FT                   SLQLKARNKGGFAIGLALGAVYVPCAGPILAAITVAGATGDIGLSTVILTVAFAIGASL
FT                   PLLIFALAGNKMGERIDAVRKHRGIVGAIILALALALALNVPEKLQRSLPDWTAGVQER
FT                   LSDNEAVQNALSNGNGNLDSCRRADKGSLQDCGSAPEFEGLTGWFNTDKPVGTHDGKVT
FT                   LVDFWAYACINCQRAGEHITKLYDTYKDAGLEVVGVHAPEYGFEHEAANVRAAAKREGI
FT                   NYPVAQDNDFATWKKFNNRYWPARYLIDTKGNVRHIHEGEGAYAETEQLVRQLLKQANP
FT                   DVQLPDPIETGGGTDSKLTEQRNPETYLGAERARFFNNNNYGLGERDFTYKEPRKGQYS
FT                   LSGKWDVKNDHIVPVKDAKLSINVHAAKVQLVVSGQGKVKATFPDGSDKTFDVSDGTID
FT                   VYDADKPLDGIISLEIEPSVTAYSLTFG"
FT   gene            54780..55406
FT                   /locus_tag="CPFRC_00280"
FT                   /old_locus_tag="cpfrc_00056"
FT   CDS_pept        54780..55406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00280"
FT                   /old_locus_tag="cpfrc_00056"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00056"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27849"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240916.1"
FT                   /protein_id="ADK27849.1"
FT                   /translation="MGFLPYEAFEGEVAPVASASDAEIIAGVKAIVKAEGPVLGSRLFV
FT                   AYCRASNQKLGRRIRERLMFALEQALNSGDIVADIPFTRSNAEAMVLRPRSRPAVVVRS
FT                   LGPRSLEQVPLAELQTVMCGIEAENPKIGKGDLYKQTLIFYDRWGKLSNKVRLILDPAY
FT                   DAGGLGGEGSRPAISRPYASGRTPGYPGQRRGRYRTTVRKAMRDW"
FT   gene            complement(55408..56070)
FT                   /locus_tag="CPFRC_00285"
FT                   /old_locus_tag="cpfrc_00057"
FT   CDS_pept        complement(55408..56070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00285"
FT                   /old_locus_tag="cpfrc_00057"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00057"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27850"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366260.1"
FT                   /protein_id="ADK27850.1"
FT                   /translation="MSWFSDLFALLTTASQWWGPTGYLARIGEHIGISLTAVAIAAAFA
FT                   IPVGVAIGHTGRGSAIVGAISGAARALPTLGLLTIFGLALGIGLEAPLIALVILAIPSL
FT                   LAGAYAGVASTDHDTVDAARAMGYTEWQIIKNVELPLGAAVLVGGIRSATLQITATATL
FT                   AAYTSDVGLGRFIFHGLKARDYIEMLAGSVLVIVLALILDLVLSMFQRTTGAHSATA"
FT   gene            complement(56067..56705)
FT                   /locus_tag="CPFRC_00290"
FT                   /old_locus_tag="cpfrc_00058"
FT   CDS_pept        complement(56067..56705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00290"
FT                   /old_locus_tag="cpfrc_00058"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00058"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27851"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654919.1"
FT                   /protein_id="ADK27851.1"
FT                   /translation="MRWLRHAWPYVLDMAAAHLFLSIPAILISIAVSIPIGMFAARNPR
FT                   VGNLVVSAASLAYTIPALPMLILVPFIVGVPLRSDTNVIIALCIYGVALLARTATDAFR
FT                   SIPEDVRMSASAQGMSAPQVALKVDLPLAIPVLISGIRVLGVSTIGLVTIGALIGVSSL
FT                   GTLFTDGFQRNITAEVLTGIGAVVILAVLFDVLCLILQRVLAPWSVIKK"
FT   gene            complement(56702..57589)
FT                   /locus_tag="CPFRC_00295"
FT                   /old_locus_tag="cpfrc_00059"
FT   CDS_pept        complement(56702..57589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00295"
FT                   /old_locus_tag="cpfrc_00059"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00059"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27852"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400895.1"
FT                   /protein_id="ADK27852.1"
FT                   /translation="MIEFIDVSKSYANPRKEKGDKKNKMPAGTASEKQTPTENAVNNFN
FT                   LVIPENQTTVFVGSSGCGKTTLLRMINRMVEPTSGEVHVRGRNVADVDPVELRRSIGYV
FT                   IQSGGLLPHRKVLDNVTTVPLLNREPKEEAIRRARLALETVELDPSFENRYPGELSGGQ
FT                   QQRVGVARALASDPDILLMDEPFGAVDPIVRRALQQQLIELQARLHKTVVVVTHDVDEA
FT                   FLLGDNIVVLEKGGKIAQVGTPTEIFAQPANDFVAQFMGTHRSDRDLHTTVIGGSRVVV
FT                   DKQGRPVGRLGADS"
FT   gene            complement(57946..58113)
FT                   /locus_tag="CPFRC_00300"
FT                   /old_locus_tag="cpfrc_00060"
FT   CDS_pept        complement(57946..58113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00300"
FT                   /old_locus_tag="cpfrc_00060"
FT                   /product="antitoxin"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27853"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240920.1"
FT                   /protein_id="ADK27853.1"
FT                   /translation="MDILNKAKELLDQNADKVKDAVEKVGDLVDEKTDGKFADKVDQVQ
FT                   EAVKKKLDEK"
FT   gene            complement(58190..59527)
FT                   /locus_tag="CPFRC_00305"
FT                   /old_locus_tag="cpfrc_00061"
FT   CDS_pept        complement(58190..59527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00305"
FT                   /old_locus_tag="cpfrc_00061"
FT                   /product="M20/M25/M40 family metallo-hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00061"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27854"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366263.1"
FT                   /protein_id="ADK27854.1"
FT                   /translation="MLGHMTLYSDTLSLLTRMVQNACVNDLTPDSGQEVRNADTLEEFF
FT                   AGEAVTIDRYESHPGRVTIVVTVPGNDPTAEPLTLLGHTDVVPVDEKKWTKPPFEALIE
FT                   DGKMYGRGTVDMLFITATMAAVTREVARKKSNHGTLYFVGIADEEARGGLGAQWLREHH
FT                   PDAFSWKNCVSETGGSHLPGADGSDSVIVYIGEKGAAQRRLHVHGDAGHGSAPFQKDSA
FT                   IAKIGEVARRIASIQPSVRSDDTWHGFVRAFRFDPDTERKLLDGHPDSYKSLGELAAFG
FT                   HAISHLTIAQTVLRAGQAINVLPSHAWLEMDIRTLPGQSDEYVDQLLNQALADLAPEVT
FT                   IEHLISEEATISPTDSPLYNAMRDTLLEFFPESTVVPMIAPGGSDLRFARRAGGVGYGF
FT                   AVHAKQRTLGHAHAQLHSHDEFLYLEDLELTVAGYHRLVTRFLEHS"
FT   gene            59731..60726
FT                   /gene="bioB"
FT                   /locus_tag="CPFRC_00310"
FT                   /old_locus_tag="cpfrc_00062"
FT   CDS_pept        59731..60726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="CPFRC_00310"
FT                   /old_locus_tag="cpfrc_00062"
FT                   /product="biotin synthase BioB"
FT                   /EC_number="2.8.1.6"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00062"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27855"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240922.1"
FT                   /protein_id="ADK27855.1"
FT                   /translation="MTDILELARTKVLEEGNGLNKDEVLQVLTLEEDRIPELLALAHEV
FT                   RLKWCGEEVEVEGIISLKTGGCPEDCHFCSQSGLFESPVRSAWLDIAGLVEAAKQTQKS
FT                   GATEFCIVAAVKGPDERLMSQLEEAVAAIKSEVDIEVAASIGILTQEQVDRLKAAGVHR
FT                   YNHNLETARSYFPNVVTTHSWESRRETLRMIGEAGMEVCSGGIIGMGETLEQRAEFACD
FT                   LAELNPTEVPMNFLDPRPGTPFADLDVMETPDALRAIGAFRLALPKTILRFAGGRELTL
FT                   GDLGTEQGLLGGINAVIVGNYLTTLGRPMEDDLDMLGKLRLPIKALNASV"
FT   gene            60732..60986
FT                   /locus_tag="CPFRC_00315"
FT                   /old_locus_tag="cpfrc_00063"
FT   CDS_pept        60732..60986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00315"
FT                   /old_locus_tag="cpfrc_00063"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00063"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27856"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910497.1"
FT                   /protein_id="ADK27856.1"
FT                   /translation="MKTTSTELIQVMLANEPPLFHPNTGQEIAAGETIRLSPSARAGLE
FT                   APRFCQICGRRMVVQVRPDGWEATCSRHGTVDSVYLGRR"
FT   gene            complement(61009..61440)
FT                   /locus_tag="CPFRC_00320"
FT                   /old_locus_tag="cpfrc_00064"
FT   CDS_pept        complement(61009..61440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00320"
FT                   /old_locus_tag="cpfrc_00064"
FT                   /product="metallopeptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00064"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27857"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654922.1"
FT                   /protein_id="ADK27857.1"
FT                   /translation="MTFKSFEQYATAKGLNCRVTPEPQNSDYQSGITEIAGTTWHIRTA
FT                   RTTPTKKGAFVAFWTRDKAGKTTPFSTQNAQGGLLVFVEQGTHRGVFTFTAEHLERLGI
FT                   TAGCSAGKRGFRVYPSWCTDLNPQATAAQRAQAPAFSCY"
FT   gene            61540..62949
FT                   /gene="amn"
FT                   /locus_tag="CPFRC_00325"
FT                   /old_locus_tag="cpfrc_00065"
FT   CDS_pept        61540..62949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amn"
FT                   /locus_tag="CPFRC_00325"
FT                   /old_locus_tag="cpfrc_00065"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27858"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240925.1"
FT                   /protein_id="ADK27858.1"
FT                   /translation="MKKGVGADVVQQLEEIYAASISLAKEILETGEYGRYCDVVYPKLI
FT                   VKILSWHPVDRTEPFGYVDAAGCYSAVLSKPELIHDYLCEQLERLCANYECVITVEPST
FT                   VRIPPEYIDGIEGVTEARRAGDVAAEIPRPTLDDVDDAIIDGEWDAFHGEEKPLFYFTP
FT                   QRFDIACARIQHYTGISPASVQKYILFTNYSMHAREFVNFGLCELSREGSRYSALVLPD
FT                   GHKITRDQAEHIDRESLSLESRFQMPRYDLVAEDGMGITMINIGVGPSNAKTITDCLAV
FT                   LRPEAWVMIGHCAGLDGRMRIGDLILGNAYQRDDHLLDDHIPLDLPIPAVPEVQRALEA
FT                   SVREVYGEDLSLMRTGTVLSTDDRNWEWHTPQKLWKLLRGSTAAACDMESATLAANGYR
FT                   YRIPYGTLLSVSDLPLHAVPKLPAAAQTFYANSKQAHVMCAVHAMELLALTPEKLRTRK
FT                   LRRTIGEVPFR"
FT   gene            63041..64450
FT                   /locus_tag="CPFRC_00330"
FT                   /old_locus_tag="cpfrc_00066"
FT   CDS_pept        63041..64450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00330"
FT                   /old_locus_tag="cpfrc_00066"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00066"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27859"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799854.1"
FT                   /protein_id="ADK27859.1"
FT                   /translation="MAILCSTALALGACGSMGKAGGPSNALSIEQTTQIDSADGIDASK
FT                   LLFSSSQAVVIAGDSVGQKWEGAKAAVKRGAPLLVRTADNASAIDSEIKRLGAQDVIKI
FT                   DEPQAPDPEISEANIADKISQLTPESPLFNGGASILVSGHTTAADVATARASGANVEYL
FT                   SSGDARESSALSADPDAHVVALGPSFANKERFNRQVEMISHGEVPGGGHLIFPSHRVVA
FT                   LYGHPSGGALGVLGEQPAEEAVNRVNDLVGKYQAIAPEESMIPAFEIIATVASSSAGPD
FT                   GNYSNEGNVDELRPWVEAIGDAGGIAILDLQPGSASFLEQAQQFEELLKLPHVGLAIDP
FT                   EWRLKPGEKPMERVGSVGAGEVNQTAAWLRDLVKDNELPQKVFVVHQFQHQMVQNRETL
FT                   DTTAPELSWVLHADGHGTAGDKFATWDMVRKNLQPEFYLAWKNFIDEDQPMFTPEQTFK
FT                   IEPRPWFVSYQ"
FT   gene            64789..65925
FT                   /locus_tag="CPFRC_00335"
FT                   /old_locus_tag="cpfrc_00067"
FT   CDS_pept        64789..65925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00335"
FT                   /old_locus_tag="cpfrc_00067"
FT                   /product="hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00067"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27860"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240927.1"
FT                   /protein_id="ADK27860.1"
FT                   /translation="MMKTRRLKTALCTVLASSTFAVASVQAIPLPFPLGASSGIDVSGH
FT                   QHPNSSSINWKDVKSHGQSFAFVKATEGLGWTNDFYASDITQAAAQGLKVGSYHYARPG
FT                   ADARQQARHYANVISHTPNHSLPPVLDLEVAEGKTPQELVNWTRDFVQELEKQTGRVPM
FT                   IYTYRYFWIEQMANTTEFSQYPLWLAAYQAQVPGTVGGWDQIDFWQRSSSGRINGIVGD
FT                   VDMNLFNGDDGELAAFAAGNLHAAGNKFASINLPELADLGKNAGGVVAVILALSAGAAA
FT                   APQLIQAAEAAGLSSEGAQDLTTVLQALAKAGKLPVDQLNKMASGNYTVGDLIILLDNA
FT                   AHIAGLDEGQSSKAAMRADELNIDANQVAQVLRSLAAR"
FT   gene            complement(65980..67065)
FT                   /locus_tag="CPFRC_00340"
FT                   /old_locus_tag="cpfrc_00068"
FT   CDS_pept        complement(65980..67065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00340"
FT                   /old_locus_tag="cpfrc_00068"
FT                   /product="inositol-3-phosphate synthase"
FT                   /EC_number="5.5.1.4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00068"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27861"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240928.1"
FT                   /protein_id="ADK27861.1"
FT                   /translation="MSNNRTIRVAIAGVGNCASSLIQGVEYYKDADPNTNVPGLMHVQF
FT                   GDYHVGDIEFVAAFDVDKEKVGLDLSHAINASENCTIKICDVPEQGVTIQRGPTLDGLG
FT                   KYYRQTITESDADPVDVTQTLKDVRADVLVSYLPVGSEEADKFYAQCAIDAKVAFVNAL
FT                   PVFIASDPEWAEKFEKAGVPIVGDDIKSQVGATITHRVLAKLFEDRGVHLDRTMQLNVG
FT                   GNMDFKNMLERERLESKKISKTQAVTSNLDQHIEAHDVHIGPSDYVGWLDDRKWAYVRL
FT                   EGTAFGDVPLNLEYNLEVWDSPNSAGIIIDAIRAAKIAQDRRLGGPVFAASSYLMKSPP
FT                   KQLRDEHARAELESFIAGDPS"
FT   gene            complement(67294..68031)
FT                   /locus_tag="CPFRC_00345"
FT                   /old_locus_tag="cpfrc_00069"
FT   CDS_pept        complement(67294..68031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00345"
FT                   /old_locus_tag="cpfrc_00069"
FT                   /product="VIT family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00069"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27862"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240929.1"
FT                   /protein_id="ADK27862.1"
FT                   /translation="MTLPDHNTTQPAAQKEQSNRLNSRLNWLRAGVLGANDGIVSVSAL
FT                   ILGVIATDVSHGAILASGVAATIAGAISMALGEFVSVSAQRDSEHMVMERERLELLHTP
FT                   DEERQEIAKILSGYGMTEETALQAATEIGRNDPFPAHLRIEYGIDAQDLTSPWHAAFSS
FT                   AAAFTVGAILPLLMVVIAPQENSAIGIIAVSSITIIALAITGYLSAAIAGTSRMRSVLR
FT                   LVIGGTIGLVLTYGAGALFGGVL"
FT   gene            complement(68351..69157)
FT                   /locus_tag="CPFRC_00350"
FT                   /old_locus_tag="cpfrc_00070"
FT   CDS_pept        complement(68351..69157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00350"
FT                   /old_locus_tag="cpfrc_00070"
FT                   /product="alpha/beta fold hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27863"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366272.1"
FT                   /protein_id="ADK27863.2"
FT                   /translation="MAVIDASLPLSARLPARGLFEDDWRARPTPHNPYPVILIHGTGVT
FT                   KGDWMELGTDLRKKGYAVFAPDFGMRSTAAVAESADQVGAYIHAVLKVTGAKQVILVGH
FT                   SQGGILARYWMHHLGGARYVSHLICLAVPNHGTSHGGVISPLTRTARGTVVVDSIITNF
FT                   FGASGFEMLAESDLIQELNANGDTLPGIYYSCITTKSDTIIQPAESCFLAGPLVRNIYV
FT                   QAVSKRAIVLHEDVPHDRRVRRIVLSELERVERLTTKKHVRTEHNA"
FT   gene            69250..69837
FT                   /locus_tag="CPFRC_00355"
FT                   /old_locus_tag="cpfrc_00071"
FT   CDS_pept        69250..69837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00355"
FT                   /old_locus_tag="cpfrc_00071"
FT                   /product="dehydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27864"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240931.1"
FT                   /protein_id="ADK27864.1"
FT                   /translation="MSLTVAEAIANRRATRKYTEQEVSDVVLDAVVSQALQAPSAFNAQ
FT                   RADLVVVRDQAIKDKIFEASGQKQLRDAPVVLITVARADVPEDLDEVLGAERATFVRNV
FT                   LADADAAHLRETALKDAMLVAGFALIAAQGEGLATSPTTGWDEAKILAAIGLADRSDRA
FT                   VGLVIGMGYPAEFPAHPGRAESRRVDNGYARG"
FT   gene            69875..70432
FT                   /locus_tag="CPFRC_00360"
FT                   /old_locus_tag="cpfrc_00072"
FT   CDS_pept        69875..70432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00360"
FT                   /old_locus_tag="cpfrc_00072"
FT                   /product="gamma carbonic anhydrase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00072"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27865"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240932.1"
FT                   /protein_id="ADK27865.1"
FT                   /translation="MNPGPIILPFNGKTPRVHETAFIAPNATLIGDVEIAAHASVFYGC
FT                   VLRADINMIRVGARTNIQDNSVLHVDGDAPCILGEDVTVGHMALVHGSTVGSGALVGMH
FT                   SALLSHSVVGQGSLIAAGAVVLEGQEIPAGVLAAGVPAKVRRELSSEQSAGFISHAGRY
FT                   VHTASMHRELGAGLSLDQVRFS"
FT   gene            complement(70425..71444)
FT                   /locus_tag="CPFRC_00365"
FT                   /old_locus_tag="cpfrc_00073"
FT   CDS_pept        complement(70425..71444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00365"
FT                   /old_locus_tag="cpfrc_00073"
FT                   /product="ROK family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00073"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27866"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523741.1"
FT                   /protein_id="ADK27866.1"
FT                   /translation="MHTRSHLRNIPSFTQPSAPAASCLHLIRHFQPVTRSKLVHGSGKS
FT                   QPTVTRAVAALMEVKLVRERPDLSIPNGPGRPTIPIELSASPWVQIGLAVGTKTTYVGA
FT                   CSTRGAVIQEKILDITPSQMSADQYAETLSTTIREIAELSELPLANVGIATSGYVNDLG
FT                   LVTAKNLGWEGVDLAGRIYNRISVPVAITSAITAIAGAEQQAQNPDVPANSLIFYADDS
FT                   IGAALQNPQEVMVLPLDENIHGASSLGAAAVALVEQARPKVLVLAGSAFENSEDALAVG
FT                   QALRKSPHGTKDKLEIRVIPTHLDNARAAARAIAMDRLIEDPLGLAKRLITKRRRAAS"
FT   gene            72090..73568
FT                   /locus_tag="CPFRC_00370"
FT                   /old_locus_tag="cpfrc_00074"
FT   CDS_pept        72090..73568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00370"
FT                   /old_locus_tag="cpfrc_00074"
FT                   /product="PepSY domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00074"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27867"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400900.1"
FT                   /protein_id="ADK27867.1"
FT                   /translation="MVTTDQALSAGSAAAKVAESGTGRAGEKSGKSRHLPRHLRRLHFF
FT                   AGIVCAPLIFIASLTGLAYAFAPTLENAVYSSNTTVEVPADAKQLPMEKIVDIATQRHP
FT                   DQPISGIRVGEKDQAVRVLFKHPTKSASFSDAVFVNPYNGEITGDMVQYGNAGALPLRD
FT                   WLSHGHRDLWLGDIGRFYSEFAASWLGVLAVSGVYLWWKRQRSGTGRIAAMLKVSGRGR
FT                   TRNLRWHGALGTALALGMIFFTFTGLTWSSVAGTNIGKVRTELNWTTPKVTTSLDGSAA
FT                   PAVKDPHAGHDHAGHDHGSHSATSPSAKLSLAEQATHVAATAAAELRSGVTLRPPSEAG
FT                   QAWSVMENRQAYRKDNNSIAVNGDTGEVTARLAFVDWPFAAQATAWMIQLHMGTMLGLP
FT                   NQIVLGLLAVGIIILVVRGYMLWFQRRPQGQLVADAPTRARGAERRFGLAGILAVVGMI
FT                   AYGFFAPVFGVTCLAFVVLSVLWDAVRSRRRKAS"
FT   gene            73639..74709
FT                   /locus_tag="CPFRC_00375"
FT                   /old_locus_tag="cpfrc_00075"
FT   CDS_pept        73639..74709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00375"
FT                   /old_locus_tag="cpfrc_00075"
FT                   /product="TIGR00730 family Rossman fold protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27868"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522956.1"
FT                   /protein_id="ADK27868.1"
FT                   /translation="MSFSPQEPLISGLTVRAMTSDDKDIRATALLKNLNRFEQRFDVQD
FT                   FASEPLRNYLDFDPTRGDIGLLLADDAGETVGVMWAAFIRGFGFINARVPELTLYLAEE
FT                   WHGKGVGQWMLDQAEEYGRVHGWPGVAVNVEKESPARRLYARCDYVTQDGGSAAGSVML
FT                   KTLSPKIRSVAVYCGSAHGARPDYTAAARALGTALAERGITMVYAGGKLGLMGETADAA
FT                   IAAGGEVHGVMPQNLVDLEQAHPRLTRLDITESIAERKTRMEDLADAFVVLPGGMGTME
FT                   EMFEVLVRQQLGPYCGPVALFNVEEYWEPLVNAFQAMSEEGFIAQRYIEALVIAGNTDE
FT                   LFEGFSNWVNPGLKWN"
FT   gene            74824..76494
FT                   /locus_tag="CPFRC_00380"
FT                   /old_locus_tag="cpfrc_00076"
FT   CDS_pept        74824..76494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00380"
FT                   /old_locus_tag="cpfrc_00076"
FT                   /product="DUF885 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00076"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27869"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240936.1"
FT                   /protein_id="ADK27869.1"
FT                   /translation="MTHGNADVRPPSLLDASCEAFVHDLAVLSPTEATAWGIEGHAGEL
FT                   QDFSPAYWEAVADRNREMLADVDALDDGTDDCDDEDDFDEVDIVTAAVLRDRVCLDLSL
FT                   HHNDEFLGQLNNIASPIQTIRDTFLLMPQDTEEQREAIASRLSQVGKALAGYRESLTLA
FT                   ASHGKVSAIRQIEAAIGQCRELTQPGSMLDKLGVDPHSDAVVSAKKSFGSMAEWLGDQL
FT                   APHAPHHDAVGRERYERFSHLFVGDVVDLDDAYEWGLDRLQEIVAEQQNIAEKLYGSGT
FT                   SVAAAMKKLDTESRYTITGTDALREWMQEQADKTIADLNGVHFDIPQPVQSLEACIDPA
FT                   GTGGIFYTPPSDDFSRPGRMWWSVPAGQNTFHTWQELTTVFHESVPGHHLQCGQAVCER
FT                   ENLNLWRRIACWNSGHGEGWALYAEQLMADLGYHDDLGTRMGMLDAQRLRAARVVLDIG
FT                   VHLGKRTPEGSSVWDASYAKFFLRENSAMDERNLAFELDRYLGWPGQAPSYALGQRLWQ
FT                   QLRDRALDQGQTLKQFHTRALSYGSIPMSILGTQVLKAS"
FT   gene            76546..76962
FT                   /locus_tag="CPFRC_00385"
FT                   /old_locus_tag="cpfrc_00077"
FT   CDS_pept        76546..76962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00385"
FT                   /old_locus_tag="cpfrc_00077"
FT                   /product="MarR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00077"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27870"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558543.1"
FT                   /protein_id="ADK27870.1"
FT                   /translation="MAKDHALDELICFQLYTASRLMQRIYRPYFDDWGITYPQYLVLVC
FT                   LWERDGRSIGQLADPLNLDSGTLSPLLQRMEDNGFVRRKHVTDDFRRLRIFLTAKGKRL
FT                   KPLADKMQEELVETLRLDYQDLAAVHDLVNKISP"
FT   gene            76971..77327
FT                   /locus_tag="CPFRC_00390"
FT                   /old_locus_tag="cpfrc_00078"
FT   CDS_pept        76971..77327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00390"
FT                   /old_locus_tag="cpfrc_00078"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00078"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27871"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654931.1"
FT                   /protein_id="ADK27871.1"
FT                   /translation="MEKDGSKKSSRKSWSYVMIMIFLLMIILVPPLLHLFTSGGIILTA
FT                   LLLLALTFGFIDARTFRFTASFPLLIGAAYFIAMQMYFNAGTWIYLPIMVVLAFIGGAF
FT                   GDPRGMRSFGEDEG"
FT   gene            77327..78163
FT                   /locus_tag="CPFRC_00395"
FT                   /old_locus_tag="cpfrc_00079"
FT   CDS_pept        77327..78163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00395"
FT                   /old_locus_tag="cpfrc_00079"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00079"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27872"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799861.1"
FT                   /protein_id="ADK27872.1"
FT                   /translation="MEIWSFEHPDLGVISVERGYDAEFREINPDWPEEPSEKEIRHVDS
FT                   NAGFKERIEALVHNPAVRLQIKVNGEIRRQLTDVPSGRIALSKSIGDSLTTSVMAKVNR
FT                   KKPHLYVHSNMFNEILSIEYREGNQVVEFTPPAGTRGHKRQQAMQESSIKRLLFPMMAG
FT                   LGKSGWAIGVIILGPIVSRVVKKLLELLPEWDFIDLPELPSINLPVPRFPHITLPVVQF
FT                   PDWELPHFELPWWVMFLLEYKKVWVPLMIAIFVGIVAVRNHKKSEEQKQQWESDQT"
FT   gene            complement(78169..79251)
FT                   /locus_tag="CPFRC_00400"
FT                   /old_locus_tag="cpfrc_00080"
FT   CDS_pept        complement(78169..79251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00400"
FT                   /old_locus_tag="cpfrc_00080"
FT                   /product="AbrB family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27873"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654933.1"
FT                   /protein_id="ADK27873.1"
FT                   /translation="MRRFITDRDLALRWSVVAPISLALGFLFAFLHVPAAWILAAIATS
FT                   GASALITGKELPMNRQLFNFARGFIGILAALPLLSTELFQLGRFVLPGIAVTIVTLMIG
FT                   VSGGLLLTHKEPEISQETGVLSMLAGGASIMPLLAKDLGADYRYVALSQYLRLLTVSVS
FT                   LPLITHLFPHSSTSTALPAAAQSQPWWALTIVIVIALVGHRVGKLLRLPAASILGPMVL
FT                   LVVTGFFIPHEVSLAPPEPVRYFAFLSIGWICGGSLSLGALKAFASQLPSTILFVVVLI
FT                   AGCALTAWPLMSVLHISYFEAYLATSPGALETVLALSSEGGAGSVVVATQVIRLISVIA
FT                   LAGWIPAFLQLLRRGKPKAS"
FT   gene            complement(79312..79908)
FT                   /locus_tag="CPFRC_00405"
FT                   /old_locus_tag="cpfrc_00081"
FT   CDS_pept        complement(79312..79908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00405"
FT                   /old_locus_tag="cpfrc_00081"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27874"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522959.1"
FT                   /protein_id="ADK27874.2"
FT                   /translation="MKKLFTVALSAVVLFGVGSCANNKPPQPTATVADASSTSPTTQTT
FT                   QQPMPAPSSSSTPAIPQKDSTSAKTPPPAATPIPAGGYLLALDKEVTLACVIDYQSGVL
FT                   ADCSPTTHAITWKATSGNHPQANRLKAVFPPLKLSATGDGTAIDGSAFKRLDAGKKYSV
FT                   DAAIIDLTAPGSVTIREHQGPGVRITRDSFEKVSA"
FT   gene            79981..80793
FT                   /locus_tag="CPFRC_00410"
FT                   /old_locus_tag="cpfrc_00082"
FT   CDS_pept        79981..80793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00410"
FT                   /old_locus_tag="cpfrc_00082"
FT                   /product="TSUP family transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00082"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27875"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240942.1"
FT                   /protein_id="ADK27875.1"
FT                   /translation="MELAAINTPEVAVDIGVGGWGILIAGAGIAGWIDAMIGGGGLVLI
FT                   PLIMAVAPGLAPVVAIATNKFVAVSGTASAAVTMTRKVGVDSSLVLRLVPIAALCSAGG
FT                   ALLAAWISKDVMRPVVIGLMLLAGIFVAFKPEFGQGGHAKSASARRRALAVLATGGIAL
FT                   YDGIFGPGTGMFLIMAFTALLSQDFLRSAALTKVVNTATNLGALVVFIAAGHVLWSLGI
FT                   VLAVANIAGAQLGAKTVLAGGTKILRLALLTLVIVMSIYLTAQQVYGA"
FT   gene            80924..81739
FT                   /locus_tag="CPFRC_00415"
FT                   /old_locus_tag="cpfrc_00083"
FT   CDS_pept        80924..81739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00415"
FT                   /old_locus_tag="cpfrc_00083"
FT                   /product="PTS sugar transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00083"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27876"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366285.1"
FT                   /protein_id="ADK27876.1"
FT                   /translation="MPKLNELLADESIELHGKAETWSDAIAKSGALLEKTGAITDEYTR
FT                   AMIENVEANGPYIVVAPGFAFAHARPSSAVKKTAISWLHLDQPVSFGHSKNDPVHLVVA
FT                   LAAQGDTVHTAAMKDLAQLLGDKQRKNALDQVKTVEELRAVLEDDLTVNSAVKPAAAVA
FT                   STADYSAKTQATAPKGKILTVCGNGLGTSLFLKNTVEQVLDYWKWSPYFSVEATDTISA
FT                   KGRAHEADFILTSGEIAATLGDLGVPVYVIQNFTSPVEIDSALRQLFDV"
FT   gene            81751..83292
FT                   /locus_tag="CPFRC_00420"
FT                   /old_locus_tag="cpfrc_00084"
FT   CDS_pept        81751..83292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00420"
FT                   /old_locus_tag="cpfrc_00084"
FT                   /product="PTS ascorbate transporter subunit IIC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00084"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27877"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799864.1"
FT                   /protein_id="ADK27877.1"
FT                   /translation="MNVLLSIAEFLVNEILAVPAFLIGIITAVGLGAMGRGAGKVLGGA
FT                   LKATLGFLLIGAGAGLVSDSLAPLGVMIQGATGAHGVVPTNEAIVGIAQEHYGSQVAWL
FT                   MILGYAVSLVLARFTPLRYVFLTGHHVLFMATLLTIVMATAGFSSWVVITAGAILLGIL
FT                   MVSLPAIAHPWTRRITGDDSVAIGHFGTAGYVAAGAMGKLVGGKGKKISPSTEELKLPE
FT                   GLRFLRDSMVATALSMALMYVVLAVLFIFRAGKNEAFTAFTGGATGVGNYLMQSVTQGL
FT                   QFGVAVAVILFGVRTILGELVPAFQGIAEKVVPRAIPALDCPIVFPYAQNAVLIGFISS
FT                   FVGGLIGLAVLSAWLNPVFGVALILPGLVPHFFTGGAAGVYGNATGGRRGALCGAFVNG
FT                   LLITFLPAFLLGVLGSFGEANTTFGDADFGWFGILIGEAAHGGQTVGLILIVFIGIAIL
FT                   ALGLWSQKTLVQGNWDPAPLRSGGLASVDTECQNVAVYSRIAPPQGAPIPPPPLG"
FT   gene            complement(83308..85764)
FT                   /gene="hrpB"
FT                   /locus_tag="CPFRC_00425"
FT                   /old_locus_tag="cpfrc_00085"
FT   CDS_pept        complement(83308..85764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="CPFRC_00425"
FT                   /old_locus_tag="cpfrc_00085"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27878"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400903.1"
FT                   /protein_id="ADK27878.2"
FT                   /translation="MTFFDLDSIGSGLPVMDSVPAIESALLAAGSVIVQAPPGTGKTTV
FT                   IPPLISNILNKNRSSQCNQGKVIVVVPRRVAVRAAAQRLIFLDGLHKNSGSVGFSMRGE
FT                   SRRGKLIEFVTPGVLLRRLLSDPELPGVSAVIVDEVHERQLDTDLVLGMLIELRELRPD
FT                   LFLAVMSATVDAHDFSRLVGAAPIVTVNAVTHPVNIDYRPAPGRSDFSQDYIHHLASVT
FT                   AHAVSQSEYSALVFVPGVREVSALCAALEATTHVKVLPLHGQLSSTEQEAALSPAEQRI
FT                   VVSTSIAESSLTVPGVRIVVDTGLSRIPKRDAGRGMSGLVTVSTSQSSADQRAGRAGRE
FT                   GPGHVLRCYSAQEFSRFSPHIPPEISSADLTQAALFLASWGAPRGEGFPLLTAPPAVAM
FT                   EQAVETLTRLGALDSSGYCTELGRTLATLPADPRLGKSLLECGTSAIPTVAALSTNIRG
FT                   DVSKEIQNLAGQRHYELEKTRLEKLISHRHGEPSSRNHSYQEKSLHSEPVSPGEAIGRA
FT                   FPENIARADGESYLLAKGTRAFLRNIPSLSGSPWLAISEVALSQGPHNHAVIHTAAAID
FT                   KATALEIIGVSEDTTATFAEGKLRGTRVTRAGAIVLSSTPCALEGDSARKALKEIIQSR
FT                   GLNLFNFSEKALTLKNRLRHLHNCYGDPWPNLDSVTVQEWLAPEIDYLLSGTPIAKVDM
FT                   YPALQRLLPWPEATHLEELAPSTLNVPSGRNASIDYSGERPKISIKLQECFGLQNSPII
FT                   CGQPLQFQLLSPAGRPLAVTDDLHSFWGGPYHHVRSEMRGRYPKHPWPEDPTTALATGK
FT                   TKKALS"
FT   gene            85934..86677
FT                   /locus_tag="CPFRC_00430"
FT                   /old_locus_tag="cpfrc_00086"
FT   CDS_pept        85934..86677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00430"
FT                   /old_locus_tag="cpfrc_00086"
FT                   /product="alpha-ketoglutarate-dependent dioxygenase AlkB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00086"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27879"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522080.1"
FT                   /protein_id="ADK27879.2"
FT                   /translation="MFMRVILKTRFDIATTFGWVPTLFDSYPVPRSPQLIRPGIVHLPG
FT                   FLSFAEQRVMVEKARAVACRLAHTPLAMHQQQWKSGTMSAHLMSLGKHWEYSSHQYVSE
FT                   WQGQEVPDIPNNFLTQAHEAFEQAVCLDSDLAPWASDYRIDAALVNYYPPGSGMGMHQD
FT                   VFEESSAPVVSLSIGATAVFRAGNSENRNKPWQDVLLLSGDALVFGGPSRKIFHGIKHI
FT                   DDATVPDNCGLEKGRINITFRQVEL"
FT   gene            86750..87412
FT                   /locus_tag="CPFRC_00435"
FT                   /old_locus_tag="cpfrc_00087"
FT   CDS_pept        86750..87412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00435"
FT                   /old_locus_tag="cpfrc_00087"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00087"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27880"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522666.1"
FT                   /protein_id="ADK27880.1"
FT                   /translation="MDTSNVLKSTPLSTDLVLAEGLVVGEDGRVRPEWAAKDPLLRKYY
FT                   DYEWGRPVHTESGLLERLSLEAFQSGLSWATVLRKRDAFRAAFYDFDADTVARFGEEDI
FT                   VRLLGCSEIIRNRRKIEAVITNARATIALRASGGLDAFIWDFAPKEHQPPATLADTPTV
FT                   SNASKALAKALKKAGFTFIGPTTCYALSQAIGMIDDRPAGASKLLDDIADLNKGVMA"
FT   gene            87409..88110
FT                   /locus_tag="CPFRC_00440"
FT                   /old_locus_tag="cpfrc_00088"
FT   CDS_pept        87409..88110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00440"
FT                   /old_locus_tag="cpfrc_00088"
FT                   /product="SDR family NAD(P)-dependent oxidoreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00088"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27881"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240948.1"
FT                   /protein_id="ADK27881.1"
FT                   /translation="MTKTAIVTGGSSGIGEATARALASDGWYVIVAARRMDRLRRIASE
FT                   IGGEAIQLDVTSDESVAHFASCIQQCHLLVNNAGGALGLDPIAEASIADWQWMYETNVL
FT                   GTLRVTRSLLDVLHDGAQIINISSIAGIAPYAGGAGYNAAKFGVTAINKVMRIEFAQRN
FT                   LRVTEINPGRVKTDFSLIRFHGDQAKADAVYADKLNLTAKDIAESIRWVASVPEHMNID
FT                   RMVITPRDQIV"
FT   gene            88210..88530
FT                   /locus_tag="CPFRC_00445"
FT                   /old_locus_tag="cpfrc_00089"
FT   CDS_pept        88210..88530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00445"
FT                   /old_locus_tag="cpfrc_00089"
FT                   /product="heavy metal-binding domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00089"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27882"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_009234437.1"
FT                   /protein_id="ADK27882.1"
FT                   /translation="MIVTTTSVVSGREISEYVRVVAGETIVGINVFKDITAGFRNLVGG
FT                   RSQAYEGEVKNAREQALAEMVQRAIELGAEGVVGVDIDYQTLGSDNGMMMVSATGTAVR
FT                   FA"
FT   gene            88569..88859
FT                   /locus_tag="CPFRC_00450"
FT                   /old_locus_tag="cpfrc_00090"
FT   CDS_pept        88569..88859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00450"
FT                   /old_locus_tag="cpfrc_00090"
FT                   /product="RNA-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27883"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910540.1"
FT                   /protein_id="ADK27883.1"
FT                   /translation="MQAQDVTIRDQEIKLGQFIKLASLVETGGIAKEVIANGEVTVNGA
FT                   VDTRRGKKLRDGDVVCVGTLCARVKTTAEEDDYFDEKTADDDFDPEVWRNI"
FT   gene            88859..89683
FT                   /locus_tag="CPFRC_00455"
FT                   /old_locus_tag="cpfrc_00091"
FT   CDS_pept        88859..89683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00455"
FT                   /old_locus_tag="cpfrc_00091"
FT                   /product="VOC family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27884"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240951.1"
FT                   /protein_id="ADK27884.1"
FT                   /translation="MPAFQAASGMPYWIDLTSSDLRKSTYFYTQVLGWEIEEFGQDYYL
FT                   ARVQGLPVAGFIKRPEDQQQADTWVTYFLTDNIHADCEGVEKLGGRVLAAPMEVRLGLM
FT                   SIVVDNSGALFGLIQPAGEEAFIAAGEPGTPVWHELTCTTGYAKAVKFYPSLFNWTTAT
FT                   VDSDHNFEYTTAETDGGAFAGIFNAEGQFPPQVPSFWQTYLGVSNMDEAVRKTKEFGGE
FT                   VIREPFASEFGLMSIISDSTGATVTICEVEEAVEEGRESDPLEGIDLSQFGI"
FT   gene            89688..89977
FT                   /pseudo
FT                   /locus_tag="CPFRC_00460"
FT                   /old_locus_tag="cpfrc_00092"
FT   CDS_pept        89688..89977
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00460"
FT                   /old_locus_tag="cpfrc_00092"
FT                   /product="cysteine methyltransferase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00092"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27885"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522081.1"
FT   gene            89983..90267
FT                   /locus_tag="CPFRC_00465"
FT   CDS_pept        89983..90267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00465"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400905.1"
FT                   /protein_id="QGW57370.1"
FT                   /translation="MFYNGGDYIRGEVVFAQDISKAIDRIADDIDSLRKLLTSPEEINF
FT                   SEMADSFVKLEQAFSFKAYSDAFVAYCAHINNAGTLVGSKNPSIFLLMV"
FT   gene            90330..91325
FT                   /locus_tag="CPFRC_00470"
FT                   /old_locus_tag="cpfrc_00093"
FT   CDS_pept        90330..91325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00470"
FT                   /old_locus_tag="cpfrc_00093"
FT                   /product="DUF222 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00093"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27886"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400906.1"
FT                   /protein_id="ADK27886.1"
FT                   /translation="MGEDIRENAARTKIEKIKIIDRELRSLKKNTELETYQLRAEFIAK
FT                   AQGMGAEALGQYTRNRVKELNRKADPDPYAALKRRKITISKPDKDGGVYVSGYLPPATG
FT                   VLLKSLLSPARRKGVASSVAPEEDKRTWAQRRVDVFHQCLAQSSSLIAKQNGGVGTVIV
FT                   STTIEELEKADCSTRFYTNTDIELSPLDLLMLGLREDLFACLMDKQGIPLQLGRSKRTA
FT                   SIYQRLALVAREAVCSHPNCEQPASNCDVHHLIAWFDGGRTDLENLTLLCRHHHTSNND
FT                   RRDFRFGVGHYQRDAGVVKFYRPGVPPEENQAPARRKSAGYRIRMAEKSA"
FT   gene            complement(91322..92851)
FT                   /gene="glpK"
FT                   /locus_tag="CPFRC_00475"
FT                   /old_locus_tag="cpfrc_00094"
FT   CDS_pept        complement(91322..92851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="CPFRC_00475"
FT                   /old_locus_tag="cpfrc_00094"
FT                   /product="glycerol kinase GlpK"
FT                   /EC_number="2.7.1.30"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00094"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27887"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799871.1"
FT                   /protein_id="ADK27887.1"
FT                   /translation="MQYVAAIDQGTTSTRCIIFDHDGNQVSVGQYEHEQIFPQKGWVEH
FT                   DAIEIWDNTRRAVGTALADSDLSAKDIAALGITNQRETTVVWDKNTGEPVYNAIVWQDT
FT                   RTTSICKELAGDEGADRWYRKTGLLINSYPAGPKIKWILDNVDGARERAEAGELLFGTI
FT                   DTWLLWNLTGGADGDDGAPALHATDVTNASRTLLMDIEKLEWDKELCKAMDIPMEMLPE
FT                   IRPSVGDFHQVRERGSLSGVPIRSMLGDQQAAMFGQGCFRPGEAKNTYGTGLFLLLNTG
FT                   TTPKWSENGLLTTVCFQIEGQKPVYALEGSVAVGGSLVQWLRDNLMLVPNAPMIENMAR
FT                   SVEDNGGVYIVPAFSGLFAPYWRQDARGVIVGLTRFVNRNHLARAVLEATAYQTRDVAD
FT                   AMVADSDVKFTELRVDGGMTYNELLMQFQADILGVPVTRPKNVETTATGAAFAAGYSVG
FT                   YWENLDFLTQQKGDLHVWKPTMDQEKVDELYHDWKRAVKRSLNWEENVDEF"
FT   gene            complement(92861..93586)
FT                   /locus_tag="CPFRC_00480"
FT                   /old_locus_tag="cpfrc_00095"
FT   CDS_pept        complement(92861..93586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00480"
FT                   /old_locus_tag="cpfrc_00095"
FT                   /product="aquaporin family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27888"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240955.1"
FT                   /protein_id="ADK27888.1"
FT                   /translation="MTGVEYLYWEFLGTTILLLMGNGVCALVTLRTSAGRNAGWLTIAF
FT                   GWGLAVFAGASIANPSGGHLNPAVTLMLAVKGSVAWNLVPWYFAGQMLGGIFGAFLCWA
FT                   AFKQLFDANNYDEAGNPGGNKNTGGIFFTNPAHPNNFWNAVTEFIATFVLLAFIALGPS
FT                   GDVGPLKYFAVAFIVVSIGLSLGSPTAYAINPARDLGPRIAYAFILPIKDKGSANWSYA
FT                   WVPIVAPMLAAVATGLLAL"
FT   gene            complement(93643..94503)
FT                   /locus_tag="CPFRC_00485"
FT                   /old_locus_tag="cpfrc_00096"
FT   CDS_pept        complement(93643..94503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00485"
FT                   /old_locus_tag="cpfrc_00096"
FT                   /product="alpha/beta hydrolase fold domain-containing
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00096"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27889"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240956.1"
FT                   /protein_id="ADK27889.1"
FT                   /translation="MGRMDERKEFEVGGKDRKLSPEEQLEQLSTYIAAHYERPAMNPPW
FT                   SDSPTDPLVLDTYDARLADRITHASMLMLGSALDHTTPGVAFSDGVTTEDVPNGQIIRP
FT                   AHPTGVWGISLHPGGWWKGSGTALENAWRPEVAAVANLSGITFLDLDYPLLPDHTVSDA
FT                   IASVRRAAQWVRSMNPPRLVAWGYSSGAALAALTSDLWDAQALTFPHLTLDYLPTHLCD
FT                   AEFPQVFPPTFLQVATQDSVADRYPWAEAQSQVKEYVSEHRVATPEVMRERVKDVADFL
FT                   VISNT"
FT   gene            complement(94516..96387)
FT                   /locus_tag="CPFRC_00490"
FT                   /old_locus_tag="cpfrc_00097"
FT   CDS_pept        complement(94516..96387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00490"
FT                   /old_locus_tag="cpfrc_00097"
FT                   /product="peptidase M13"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00097"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27890"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240957.1"
FT                   /protein_id="ADK27890.1"
FT                   /translation="MTSQQPLMKDLYRFVNGEWLDTHVIPEDRGVDGTFHSLRDQAEVD
FT                   VHELVKSSSSRAGKLYASFMDVPGIEAAGVAAIDEDLDRLKVETTNELATALGELDRLG
FT                   VGGPVSFWVAKDSDGSDSVAYIVQSGLGLPDEAYYREHPDMLESYKAHVTTMLGFLDPQ
FT                   RLGGLPAEEASERIVALETDIARGHWDVVSTRDALKTFNPTEFSELPENVATLLRAARL
FT                   PESRVIVMMPSYLDHINTLLSERIDDWKLLTTWHILHARAGVLTPEISRADFAFFGTTL
FT                   SGATQQRDRWKRAVGLAESFVGEEIGEVFVKEHFPASSKKDMATLVDYLIAAYRERIEH
FT                   LQWMTPVTRKRALEKLDKFNAKIGYPDTWRDYGDLEFSDAGQDLLRNVRTGSAYAHDYE
FT                   LSKLGKPADRSEWVTTPQTVNAFYNPVVNDITFPAAILRAPFYSPTADAAENFGAIGAV
FT                   IGHEIGHGFDDQGSQYDGDGNLHSWWTEEDREAFTQLTSKLVEQFDGLVPSVLKESTGV
FT                   NGKFTLGENIGDLGGLGIAVVAYQRYLADHGEDTTGLQRLFLSWARIWRTAIRPELAEQ
FT                   YLAIDPHSPAEFRCNVIAGNIAEFYQTFNVPEDSPMWIAPEKRVTIW"
FT   gene            96436..96978
FT                   /locus_tag="CPFRC_00495"
FT                   /old_locus_tag="cpfrc_00098"
FT   CDS_pept        96436..96978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00495"
FT                   /old_locus_tag="cpfrc_00098"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00098"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27891"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400909.1"
FT                   /protein_id="ADK27891.2"
FT                   /translation="MSYFQFRPAMSAKSWWLVAVVVTLLLVLPAALNAVVPSIDFKLKN
FT                   VILGKKDSFELPVVLDDGAHLQCKEEMSDLFQPQWDCEGTRINSMVVDGSTDQDHTLRR
FT                   MMRLNAKVPLPKDAKIFREGNIRIIEGASQVGLSLAVQGEDEQKTLFVLVTGPDTDNAV
FT                   QLIAKNFQNYAVKGATA"
FT   gene            96975..97877
FT                   /locus_tag="CPFRC_00500"
FT                   /old_locus_tag="cpfrc_00099"
FT   CDS_pept        96975..97877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00500"
FT                   /old_locus_tag="cpfrc_00099"
FT                   /product="PrsW family intramembrane metalloprotease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00099"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27892"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240959.1"
FT                   /protein_id="ADK27892.1"
FT                   /translation="MNTSLVGPIKSATHPASISWVMWAIIGISAPVSLFYLGAYVLLSP
FT                   SGSAVGLLCGVAYLIVGTLIFRVSPMWPKAGWKWYVTSLCWGACSSFALVMASSQPIID
FT                   LTEKLGWKMVSASFGGAYPEEISKALGVLLILFTFSKISRPWHGFVTGGMVGLGFEIFE
FT                   NLMYGVIEGMSDANSDVPGALSSWGLRTLAGPGLHVFFTAIAGYGIGLAVFTYGWDRFR
FT                   RLQVAGAALLVAFTFHFCWNLTWEGDLGTIINVIVVSLCLYPLVIYLWIRCHRDATADF
FT                   GMIRMNSPLTLVSQVRNDE"
FT   gene            97870..98745
FT                   /locus_tag="CPFRC_00505"
FT                   /old_locus_tag="cpfrc_00100"
FT   CDS_pept        97870..98745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00505"
FT                   /old_locus_tag="cpfrc_00100"
FT                   /product="glycine/betaine ABC transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27893"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522084.1"
FT                   /protein_id="ADK27893.1"
FT                   /translation="MNKRIAVLGVAMCLTACGSIESVDGGRTDSDAIVIGSQTYYSNEV
FT                   IAEIYAQALEKAGHKVDRQFQIGQREVYMSEVENGSIDVFPEYSGPLLQYWKPDTTARL
FT                   PEAVYAELQSALPSSLQVLNQAEASDQDSYVVTKQYSEEHGIKSIQDLAKVKNITLGAN
FT                   SEAEDRPNGPKGLKSVYGVDAAFTPIEDSGGPLTVKALKDGDIQLAIIYSADPSIAANN
FT                   LVSLEDPKGQFLASRVVPLANKKLDADAAAVLNKVNAQLTTQDLIQLNTRSVTEQLPSA
FT                   LIAKEWLKAH"
FT   gene            complement(98753..102037)
FT                   /locus_tag="CPFRC_00510"
FT                   /old_locus_tag="cpfrc_00101"
FT   CDS_pept        complement(98753..102037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00510"
FT                   /old_locus_tag="cpfrc_00101"
FT                   /product="arabinosyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27894"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558547.1"
FT                   /protein_id="ADK27894.1"
FT                   /translation="MDKHDVDSDFVSSSVSQKVKTLKLLAVLSGVLGFILFLLTPFMPV
FT                   NQVQSSLSWPQNGNLNSVNAPLMSYSPQELNAVIPISASEKLRPGQSLIVGTLPEDSED
FT                   AAARGLFVRSSDGGIQITSRGELVFELTADELKKLPADAKVSVSSTKDATTASVGEYSG
FT                   SIDEDKRPQITGLYSELDSQAADSLSSALKVDVEINSRFTTSPTAAKYTTMWLGGAMTV
FT                   IALVCLGLLDLQDNKKVRFLQHGAWRPRGLDAIVVAILGFWYFIGANTSDDGFILTMGR
FT                   IAAHADYMANYYRWFGVPESPFGAPYYDLLGLMSHVSTSSIWMRLPSLIAALIVWFALS
FT                   REVLPRLGEKIAGRRVSQWTMAFVFLAFWLAYNNGLRPEPIIAAGTLLTWLSFEVAIKT
FT                   ERLLPAAVGTLLAAFTLACGPTGLMAVACLLAGLSYLIRIIYRRIPLLGGKPAFNIAAM
FT                   VAPFAAAGTAVLVAVFGDQTLMNVFESIHVRSETGPSLSWYNEFARYQVLMQQTVDGSF
FT                   ARRIGVFFTFISIALVLTSILRNGKVPGSNKGPVFRLLLAMVGTLFFMMFTPTKWTHHF
FT                   GVWAGIAAALAGVGAVALSHMALRAPRSRTLLTGGILFVFAFALSGTNGWWYTSSYSVP
FT                   WWDKTIQIHEIEASTIMLVISLVVLGIGVLQSFKKDVAEERGEAPVDFRKQRFEGLAAA
FT                   PIAILSILAVAFSMASLGKGFLSQYPAYSVGLGNLRAAAGNTCNLANDVLVEANTNESF
FT                   LQPLHSSLGESLTFGKNRAFDPNHISSEAYTEENKSSSSTAGTANSTDTTETTTEGKEH
FT                   RAAVGVNGSTAQLPFNLDYTRVPVLGSWTSGEQHYAEAISDWYKLPERSESAPVIAVSA
FT                   AGSIEHLDLDGIKKEGQKLIIEYGTASNGKVDMLGEKQMLDIGPDLKWRNLRLPLSELP
FT                   EEANVIRIHATDGNLSPDEWLAFTPPRVPTLETLNDVYTSETPGLLDWAVPLQFPCQRT
FT                   FNHYAGVAEIPKFRISADAEGRASGASFQDYFGGGVTGIAEAVNYSYQLPSYSKNDWQR
FT                   DWGSIEVYHPRPNSQGKEPDLAQITTETVTRSGLWYPGPMNINTDH"
FT   gene            complement(102030..104105)
FT                   /locus_tag="CPFRC_00515"
FT                   /old_locus_tag="cpfrc_00102"
FT   CDS_pept        complement(102030..104105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00515"
FT                   /old_locus_tag="cpfrc_00102"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00102"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27895"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910552.1"
FT                   /protein_id="ADK27895.1"
FT                   /translation="MINRARNADSQPPKDDSEAPHASAAASDPFPVMLKHPDKDNLRDK
FT                   SYDFDYTPDIQDGPHTLFGIVAAILGGGLFTFISWYILKQVNLPAFGPSLVTRALATFC
FT                   TLLVVVAVTALMIWWVHYEKTNQERPRWFTWLTYALTYLSPAGLVVASLGIPLSPTKLY
FT                   LDGLTVDQVFRTQYMTRLTDSWQLTDMNYIDLPAYYPGAWFWFGGRLGALLGLPGWEVF
FT                   QPYSLISLSMAGCLLVPIWQRLVGSLPVATGIALVTTTIALVMCAEEPYACIIAMGIPA
FT                   AVIIGRRALSGRKSAMLAIIFYLGVSASMYTLYTAIIALSLIAITGVISALMLRSWKPI
FT                   GRIVTIGVSSMAIAAIAWGPYFVFILSGNHTSGATASHFLPVEGTEIPLPMFAASIVGI
FT                   LCMLGLIYLLARAADPDINSLGVAVVVAYIWVIASMAVTLTGSTLLGFRLDPVVTVLLA
FT                   TAGVLAIADFRLVGIHRLYPVQFSASTSRQITMVIAIVIALGGIKYAQDIPAKHSHSID
FT                   HAYSSTDGNGERADRYPADATQYYAEIDKILRGNGSLPRETVVLTDEMNFMAYYPYHGF
FT                   QAFTSHYANPLGEFNERNKTIEQWAMDSWQQLKDPKAFDRALHATPWRAPDAFVFRADS
FT                   TEESSSGWNFDLAEDIYPNNPNVRFRGVKINPEVFTGKDSPWKVDQVGPFVVVTRG"
FT   gene            complement(104253..105014)
FT                   /locus_tag="CPFRC_00520"
FT                   /old_locus_tag="cpfrc_00103"
FT   CDS_pept        complement(104253..105014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00520"
FT                   /old_locus_tag="cpfrc_00103"
FT                   /product="decaprenylphospho-beta-D-erythro-pentofuranosid-2-ulose
FT                   2-reductase"
FT                   /EC_number="1.1.1.333"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00103"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27896"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005323212.1"
FT                   /protein_id="ADK27896.1"
FT                   /translation="MLNAVGKAQNILLLGGTSEIGLAIVNEFLTHGPAHVTLAARKDSP
FT                   RIDAAVKDIESAGASAVEVIDFDATAFDTHADVIDQAFLLGDVDVAIVAFGTLGDQEEL
FT                   WQDQSKAVASAETNYTAPVSVGVLLAEKFKAQGHGTIVALSSVAGQRVRRSNFVYGASK
FT                   AGMDGFYVNLGEALRDYGVNVLVVRPGQVRTKMSADAGEAPLTVDREDVAKATVQAVLS
FT                   GKSSIFVHPLFEYVSLVFKFIPQAIFRKLPF"
FT   gene            complement(105030..106496)
FT                   /locus_tag="CPFRC_00525"
FT                   /old_locus_tag="cpfrc_00104"
FT   CDS_pept        complement(105030..106496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00525"
FT                   /old_locus_tag="cpfrc_00104"
FT                   /product="FAD-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00104"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27897"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_006061521.1"
FT                   /protein_id="ADK27897.1"
FT                   /translation="MTSAKGTSSTAASSGVSGALHTEAMKLTGWGRTAPTTAEVLATPD
FT                   LETIVKAVRQVAEQNDSKPDYLRRGVIPRGMGRSYGDPAQNAGGLVIDMQPLNKIHSID
FT                   PETAIVDVDGGVTLDQLMKAALPYGLWVPVLPGTRQVTIGGAIGPDIHGKNHHSAGSFG
FT                   DHVTSMELLVADGRILHLEPEGSADDPDGSLFWATVGGMGLTGIIVRAKIRMTKTETAY
FT                   FIADGDLTANLDETVEFHSDGSESNFTYSSAWFDAISPEPKLGRAAISRGSLATLAQLE
FT                   ELSPKLAKDPLKFNAPQLVTVPDIFPSFTMNKLSMIAIGELWWLKSGTYRNKVQNLTQF
FT                   YQPLDLIGEWNRGYGSKGFLQYQFVVPREAVEPFKDIVRDIQRSGHYSALNVFKLFGEG
FT                   NRAPLSYPMPGWNVCVDFPIKPGLGKFLDELDRRVMEFGGRLYLAKESRTSAENFHSMY
FT                   PEMEGWLKTRNAIDPTGVFASDMSRRLELH"
FT   gene            complement(106580..106804)
FT                   /locus_tag="CPFRC_00530"
FT                   /old_locus_tag="cpfrc_00105"
FT   CDS_pept        complement(106580..106804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00530"
FT                   /old_locus_tag="cpfrc_00105"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27898"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240965.1"
FT                   /protein_id="ADK27898.1"
FT                   /translation="MFGFLKKKTVETHIAAERTNTPMDSRMTLLMAEEIPMLDSASRVR
FT                   IYQILEEYDGPQITSQEELPQEIRDMMDL"
FT   gene            106849..107310
FT                   /locus_tag="CPFRC_00535"
FT                   /old_locus_tag="cpfrc_00106"
FT   CDS_pept        106849..107310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00535"
FT                   /old_locus_tag="cpfrc_00106"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00106"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27899"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366302.1"
FT                   /protein_id="ADK27899.1"
FT                   /translation="MKDTTVERNLNPLDDTMTGRISQAAAIGLITALPDYVHTKALRWV
FT                   INTVILGSLLGVALYANTHDDDPDNDPDVIAARVREQLESSDAKEFGPLVTWGAFAVLL
FT                   LIFLGINKLDRTISKKVVEFLRRRGVSKPHTLLGVVGAALVFVSSGDQR"
FT   gene            107307..107837
FT                   /locus_tag="CPFRC_00540"
FT                   /old_locus_tag="cpfrc_00107"
FT   CDS_pept        107307..107837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00540"
FT                   /old_locus_tag="cpfrc_00107"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00107"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27900"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522969.1"
FT                   /protein_id="ADK27900.1"
FT                   /translation="MISIIDVRGAAPDHTVVLWHVHTDPSYPTGLMSGAWVLGPGEATP
FT                   VDKLPSLLTGTTALPLNAEARELVPGDITCVSLRDVADAVRTGLDEIKKEAARAKSENE
FT                   KLVAPRFEALTDISPEDFLDAYRGEPQARDAWMMASAVAGWMQQWLDIESVRRSRAYLK
FT                   EAFGSEPRPLPIG"
FT   gene            107858..108745
FT                   /locus_tag="CPFRC_00545"
FT                   /old_locus_tag="cpfrc_00108"
FT   CDS_pept        107858..108745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00545"
FT                   /old_locus_tag="cpfrc_00108"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00108"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27901"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366304.1"
FT                   /protein_id="ADK27901.1"
FT                   /translation="MIQRSGVIWISEARLRRGKAVARRRRIRAGKIIVLQLKVIDAAGI
FT                   LHRVLGVRDTLKLAGVAEIIKTCFGFDAASPQSFYRCGEQVSMNDCLHAHTAAIRAGQL
FT                   EYNWGLWRVSLSILDTYSREASAPEALCLGGSGDLYEPDAPVDTARINMAISGGKRAQE
FT                   TLAHVHEEVVSIIQRTQETGLIPLLQALGLGEEPNYAASGLQALPVEQSRQAREAWWSF
FT                   VIGMACMGGKDLRSRVAGRLMRKLGWQEDLTDERIRELCGASISKLEELGGCGAHALSA
FT                   VERIDIYRELLRKR"
FT   gene            108757..109215
FT                   /locus_tag="CPFRC_00550"
FT                   /old_locus_tag="cpfrc_00109"
FT   CDS_pept        108757..109215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00550"
FT                   /old_locus_tag="cpfrc_00109"
FT                   /product="GtrA family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00109"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27902"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240969.1"
FT                   /protein_id="ADK27902.1"
FT                   /translation="MANSNTGAHDQAAPNVTVTTSSASVASQGIKFIISGGISAVVDLG
FT                   LTYLCQIVFGFSAAGGRTIGFIFGTITAYLINRRWTFQAEASTKRFLQVAVLYTITYFV
FT                   NVGGHSLLFSLLTHYGVSEQIALVIAFVISQGTATVINFFVQRIFIFK"
FT   gene            complement(109219..110121)
FT                   /locus_tag="CPFRC_00555"
FT                   /old_locus_tag="cpfrc_00110"
FT   CDS_pept        complement(109219..110121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00555"
FT                   /old_locus_tag="cpfrc_00110"
FT                   /product="glycosyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27903"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525187.1"
FT                   /protein_id="ADK27903.2"
FT                   /translation="MPIASTGRIAAVIVTHNRVELLQNSLKIVAQQTHPVDHIIVVDNG
FT                   DDPAVESLVTAIAGERAVYLGSKHNLGGAGGFALGFLTALRLGADAVWCADDDGRPEDE
FT                   NVLATLLHVAKKHHLDEVSPVVCNAEEPDQLAFPLRRGTTWRRFRSELGNEDFLAGIAS
FT                   LFNGALISADAMQRIGVPDLRLFIRGDEVEYHRRLVRSGLKFGTCLTAAYLHPDGSDEF
FT                   KPILGGRMHTQYPDNEGKRFFTYRNRGYLMNQPGMRRLLPQEYARFGWFFLIQRKDPKG
FT                   FLQWLKLHHMGRSERFERP"
FT   gene            110375..111345
FT                   /pseudo
FT                   /locus_tag="CPFRC_00560"
FT                   /old_locus_tag="cpfrc_00112"
FT   CDS_pept        110375..111345
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00560"
FT                   /old_locus_tag="cpfrc_00112"
FT                   /product="zinc ABC transporter solute-binding protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00112"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27905"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366307.1"
FT   gene            111424..112149
FT                   /locus_tag="CPFRC_00565"
FT                   /old_locus_tag="cpfrc_00113"
FT   CDS_pept        111424..112149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00565"
FT                   /old_locus_tag="cpfrc_00113"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00113"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27906"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654957.1"
FT                   /protein_id="ADK27906.1"
FT                   /translation="MANLVGSALTMTGISVSYGPTVALENASIEVPVGSVMGFIGPNGA
FT                   GKSTLIKSAIDLVDHDGEVAFFGKPLAQVRDRVAYMPQSAAVDWDYPITVEQVVGMGLY
FT                   PRLGWFKRFTGEHREEVRHALERVGIADLAKRHISELSGGQRRRVFVARILVQNPDIFL
FT                   LDEPFAGVDAASERVIRDVLHGLCEDGKSVVIVHHDLSTVTELCDHVTVINRQIVATGT
FT                   VEEAFTRETVNAAFGLGLL"
FT   gene            112146..112790
FT                   /locus_tag="CPFRC_00570"
FT                   /old_locus_tag="cpfrc_00114"
FT   CDS_pept        112146..112790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00570"
FT                   /old_locus_tag="cpfrc_00114"
FT                   /product="iron ABC transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00114"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27907"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240974.1"
FT                   /protein_id="ADK27907.1"
FT                   /translation="MSIIDFLAEFSYRRVVWGTLLIGLCSGAMGTFLYLRRQSMMSDVI
FT                   GHSATPGVMGAFLFFATTPWLSESQLLADWGIDARSMPVITIGAMVTGLASAIVANAVA
FT                   DSTRIGIDSTMAVMLSLLVVVAIVIGVKAVGLILMIAFAVFPPAAARQWTRTVAQMVVV
FT                   SGLIGAIAAIVGSYISISAGKVPTGPVIVLVLAAFVIVALVASPRRAAVIR"
FT   gene            112787..113665
FT                   /locus_tag="CPFRC_00575"
FT                   /old_locus_tag="cpfrc_00115"
FT   CDS_pept        112787..113665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00575"
FT                   /old_locus_tag="cpfrc_00115"
FT                   /product="metal ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27908"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799883.1"
FT                   /protein_id="ADK27908.1"
FT                   /translation="MSFAVSVSVLALVVSLTAAIPGIVLVLRRQAMLSDALSHAVLPGI
FT                   AVAALWTAASPDDPLLLVGATLSGVAVIALTEWIRDRKKVTEDSATGLVFPAFFAIGVI
FT                   IISMRFNNSTISKHTVLVGDLNIAALNHWVAWGIDFGPKSAWTIGVVGLVALGVVILAR
FT                   RPLMISTFDPTFAAAVGIRTRLLNYLVMVLVSLTIVVVFDAAGAVLAVALMIVPAAAAL
FT                   MVTRSETAMVVVTLIIAAASSQVGFWVAYRIDAATSPTMAFVDGLICLALWIGVRVLRK
FT                   RKEVHVRADVV"
FT   gene            113785..114777
FT                   /locus_tag="CPFRC_00580"
FT                   /old_locus_tag="cpfrc_00116"
FT   CDS_pept        113785..114777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00580"
FT                   /old_locus_tag="cpfrc_00116"
FT                   /product="zinc ABC transporter substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00116"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27909"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240976.1"
FT                   /protein_id="ADK27909.1"
FT                   /translation="MNRSFFRNTCAAIAVVGLLSASACAADNKETAPVKNSSSPKIFAT
FT                   TGYIGDAVKNVAPDADLTVMVGPGGDPHTYQPSTSDVKAMQEADVVFWSGLGMEANMID
FT                   QLKGLGDKQIALAEQIPENMLLPWEEDGDHESHSHEGHEHEGHSHGAWDPHVWNSTDNW
FT                   KLVVDQIVKKMSAADPDKADTYKTNGAEYNKKIDETKAYVQERINTIPADQRTLVSGHD
FT                   AFRYFGKQFGLEIKATDFVTSDAQRSASELNELAEFIVEHKVPVIFQDASANPQAVKSL
FT                   EENVAAKGGKVTVSSAELYSDSLGATAPADTYTGALRYNADTIAAAYKG"
FT   gene            114824..115558
FT                   /locus_tag="CPFRC_00585"
FT                   /old_locus_tag="cpfrc_00117"
FT   CDS_pept        114824..115558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00585"
FT                   /old_locus_tag="cpfrc_00117"
FT                   /product="phosphatase PAP2 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00117"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27910"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799885.1"
FT                   /protein_id="ADK27910.1"
FT                   /translation="MYPPFSQAGSTSLEVEKTMEVPSSHAKVSAQRWWTAIIGVLAVAI
FT                   IGLGVRSLTSDLFITQAMNNQRKGAIESLVDAVYYGLEPAYSLVLTLVISALVGIACKQ
FT                   VRIGLQCAVAIAITWVPVVFVKMLIERPRPSSDLLAHPIPVTPGDWSFPSGHTTYVTAL
FT                   AMMLMLTVGARLPLILRALLVLCAVLVIAGVVLTMGVHYLTDVVAAVIWSTTMAPLVWN
FT                   LVDNAGRRLWFSRFENAGRPSV"
FT   gene            complement(115605..116399)
FT                   /locus_tag="CPFRC_00590"
FT                   /old_locus_tag="cpfrc_00118"
FT   CDS_pept        complement(115605..116399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00590"
FT                   /old_locus_tag="cpfrc_00118"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00118"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27911"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558549.1"
FT                   /protein_id="ADK27911.1"
FT                   /translation="MVSIDTYNACVDFPIFDAKSRSMKKAFLGAAGGAIGRNKDNTVVV
FT                   EALRDVNLHLKEGDRIGLVGHNGAGKSTLLRLLSGIYEPTRGSAHVRGRVAPVFDLGVG
FT                   MDPEISGFENIVIRGLFLGQTRKQMKQKMDEIAEFTELGDYLAMPLRTYSTGMRIRLAL
FT                   GVVTSIEPEILLLDEGIGAVDAAFMAKARERLSDLVQRSGILVFASHSNDFLVQLCDSA
FT                   LWIDHGTVRQAGAVDDIVEAYEGKGAADHVRRLQKRIREESK"
FT   gene            complement(116415..117320)
FT                   /locus_tag="CPFRC_00595"
FT                   /old_locus_tag="cpfrc_00119"
FT   CDS_pept        complement(116415..117320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00595"
FT                   /old_locus_tag="cpfrc_00119"
FT                   /product="ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00119"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27912"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366314.1"
FT                   /protein_id="ADK27912.1"
FT                   /translation="MQEQTKVNNPESLESMIARITHADHVDPKPSRSKTLAAAWSDLVR
FT                   GFKQHELWLQLGWQDIKQRYRRSVLGPLWITIATGVMALALGLLYSVLFKIPVAEFLPH
FT                   VTVGLIMWNFISGCIKEGAEVFITNEGLIKQLPSALSVHVYRLVWKQTLFLFHNMVIWF
FT                   ILMLVFPRPLGWDILLGIPAIALLVVNGVWVSMFFGIIATRYRDFSPLLEALTQLLFYV
FT                   TPIVWTTQTLYAQGGAVSERAKLAMLNPLYHYMEVVRAPLIGAPINPLNWYVVIGCTVV
FT                   GTFLAMLAMKQWRFRVSYWV"
FT   gene            117462..118655
FT                   /locus_tag="CPFRC_00600"
FT                   /old_locus_tag="cpfrc_00120"
FT   CDS_pept        117462..118655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00600"
FT                   /old_locus_tag="cpfrc_00120"
FT                   /product="aminotransferase class V-fold PLP-dependent
FT                   enzyme"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27913"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240980.1"
FT                   /protein_id="ADK27913.1"
FT                   /translation="MVFDVARVRGAYTSVSGTWTYLNAQEQPQIPERVSSAVSRGFRSA
FT                   PLAAEIERGAGSHALLQRAGRFIADDHFYSARMAIADMTGTSADAVLLGPSRDVLFARL
FT                   SRALRPLLRRGSSAVFSRTDSCGLDLDAEIRWAEPDLGTGEVPAWQFSKLVDGSTRVVA
FT                   LSAASRQVGTINPILEIAEYVHDSSRAWVLVDATPLAGHRPITREALGADIISVDCEAF
FT                   GGPQVAALAFRDTTMFPRIDMEVFDTPVAAGLAAGVSAAVDHLADLDEDARGTRRYRLA
FT                   QGVESAANYLGWLGTYLVDSIESLPNTHVFGVTGEAAAGSDVDRIPHSTFCINGVPADM
FT                   IQQRLINNGLVATVAEADPLLTAMGVGDTKGAISVGLGPYNTVADVDQLIRVVASLA"
FT   gene            complement(118652..119611)
FT                   /locus_tag="CPFRC_00605"
FT                   /old_locus_tag="cpfrc_00121"
FT   CDS_pept        complement(118652..119611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00605"
FT                   /old_locus_tag="cpfrc_00121"
FT                   /product="zinc-binding dehydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00121"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27914"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366316.1"
FT                   /protein_id="ADK27914.1"
FT                   /translation="MKAIIIDENKQLSYQDVADPQLESGCALIRVKASGVNRADLLQAA
FT                   GHYPPPPGESKILGLECAGVVEDPGDTSWKKGDKVACLLAGGGYAELAVVPEGQLMPIP
FT                   AGYSFAQAAAIVEVACTVWSNIGMLTGLKPEHTILIHGGAGGIGTFAIQMAKHIGATVA
FT                   VTAGSTEKLEVCRELGADILINYREQDFAEILKNKCDRILDIMGAKYLDQNVRALAMDG
FT                   HQVTIGMQGGVKGELNIGRLLSKRGTISATALRARDRADKARIVADTVKNIWPLLESGR
FT                   ISHRIHATLPLSQAQKAHELLDSGEVSGTLVLLADAPS"
FT   gene            119692..119779
FT                   /locus_tag="CPFRC_00610"
FT                   /old_locus_tag="cpfrc_t005"
FT   tRNA            119692..119779
FT                   /locus_tag="CPFRC_00610"
FT                   /old_locus_tag="cpfrc_t005"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:119726..119728,aa:Ser,seq:tga)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            complement(119826..120857)
FT                   /gene="hisC"
FT                   /locus_tag="CPFRC_00615"
FT                   /old_locus_tag="cpfrc_00122"
FT   CDS_pept        complement(119826..120857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="CPFRC_00615"
FT                   /old_locus_tag="cpfrc_00122"
FT                   /product="histidinol-phosphate transaminase"
FT                   /EC_number="2.6.1.9"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00122"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27915"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240982.1"
FT                   /protein_id="ADK27915.1"
FT                   /translation="MIREDLAQIPTYVPGHHADHTLKLSSNEVAFGPLPGAAEAMAKAI
FT                   TTVNRYPDMGAEEIRERLAEHLGLDAQQVAVGCGSSALCQQLVQISAGPGDEVIFPWRS
FT                   FEAYPIFVHVTGATPVAVPLKEGFNDLDAMAAAITENTRLIFVCNPNNPTGTLISQDAF
FT                   LAFMNKVPSNVLVALDEAYIEYVRAEDTPLATEFIHAYPNLIGLRTFSKAFGLAGIRIG
FT                   YAFGSPSLIEALNKVALPFGVNTVAQAGAIASLENLDELMERTEEVVLNRDRVAEHVGA
FT                   GHSQTNFVWIPADSRPESPTDIAEQLHNHDVIVRAFPEGVRITVTNSEETDRLLAAWDA
FT                   SFS"
FT   gene            120964..121052
FT                   /locus_tag="CPFRC_00620"
FT                   /old_locus_tag="cpfrc_t006"
FT   tRNA            120964..121052
FT                   /locus_tag="CPFRC_00620"
FT                   /old_locus_tag="cpfrc_t006"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:120998..121000,aa:Ser,seq:gct)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            121100..121172
FT                   /locus_tag="CPFRC_00625"
FT                   /old_locus_tag="cpfrc_t007"
FT   tRNA            121100..121172
FT                   /locus_tag="CPFRC_00625"
FT                   /old_locus_tag="cpfrc_t007"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:121133..121135,aa:Arg,seq:acg)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            121612..123186
FT                   /locus_tag="CPFRC_00630"
FT                   /old_locus_tag="cpfrc_00123"
FT   CDS_pept        121612..123186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00630"
FT                   /old_locus_tag="cpfrc_00123"
FT                   /product="DASS family sodium-coupled anion symporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00123"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27916"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525196.1"
FT                   /protein_id="ADK27916.1"
FT                   /translation="MSTPITHESSEHALAEDAEVRDQSERRRQIIGLFVGLVLAALVYL
FT                   IFPESSVDVVSSADSKGSYTHGALRITAAVAVLMGAWWMTEAIPLAATALVPLVAFPLL
FT                   QVIEFSKISAPYASPTIFLFMGGFILALGMQRWNLHRRLALSVVLLVGTKPKQLVAGFM
FT                   LATGFLSMWVSNTATAVVMLPIGVSVLQLTAESVGGMRAQKKFATSLMLAIAYSASIGS
FT                   LGTIIGTPPNALLVAYMAESHDIHIGFGTWMLVGVPLALVYMVIAWFILVTVFKPEVDT
FT                   IPGGRALIKEELHKMGAMKFGEAATAVIFASAALAWVFVPLVIKWMGWKVSIADAVIGL
FT                   VASMLLFLIPADRKTGTRLMDWKTANELPWDVLLLFGGGLALSKMFSESGLSLWIGETA
FT                   KGLGVLPLILLIGAIAALVLILTEFTSNTATAATFLPIMAGVAVGIGLNANGDQNILLL
FT                   TIPVALSATCAFMLPVATPPNAIAYSSGFVKIGDMVKGGVWLNLIGIILVTLVTYFLAI
FT                   PVFDIVL"
FT   gene            123437..124285
FT                   /locus_tag="CPFRC_00635"
FT                   /old_locus_tag="cpfrc_00124"
FT   CDS_pept        123437..124285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00635"
FT                   /old_locus_tag="cpfrc_00124"
FT                   /product="PRD domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00124"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27917"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799889.1"
FT                   /protein_id="ADK27917.1"
FT                   /translation="MPELIIRRVLSNNAVLAAENCSEAGERILVGKGIGFSKKPGDYVE
FT                   HGGGSREYVELSEQHRALLEGLSSIDGATFHVISASIDVASDVLGKLHPSVYLILAEHL
FT                   SFAVQRVGRGETIRNSLVVEIKAVVPEEFSAAELVVNYLNTHLDSIVLPIDEAAFIALH
FT                   LHAARTGGTVKQPLAVANAIGQVTAKAHRLLRTPAEAGNDALSMELALAYQRLQRKQLR
FT                   HNVLLASVEKLLPHEYAVAAELLTDLSGEPQLPLSARGEAAFLAVFLHGWTQENVNKEK
FT                   G"
FT   gene            124289..125869
FT                   /locus_tag="CPFRC_00640"
FT                   /old_locus_tag="cpfrc_00125"
FT   CDS_pept        124289..125869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00640"
FT                   /old_locus_tag="cpfrc_00125"
FT                   /product="PTS N-acetylglucosamine transporter subunit
FT                   IIABC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27918"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240985.1"
FT                   /protein_id="ADK27918.1"
FT                   /translation="MGSVMNALQRLGKALMGAVAVLPVAAILMGIGYWIDPVGWGADNT
FT                   VAAIFIQSGLAILDNLGWIFAIALAFGLAKDSNGAAALSGFVGFATITQLIGPKAVASY
FT                   KGIGDPTALEGDAALEWASQGWGAIGGKNVLFGILIGVLAAWVYNKFHATKLPDFLAFF
FT                   SGRRLVPILTSFFSIILSGIMYFVWPIIYSVLFNFGELIQGMGPAGAGIYGFINRLLIP
FT                   TGLHHAVNSIFWFDVIGINDIGKFLGGGKTIEAAQAATDAASCPGNWVDGSCQVVGIIG
FT                   QYQAGFFPVMMFGLPGAALAIYLRAESKRKKVVGSLMLAGALAAFFTGVTEPLEFSFMF
FT                   LAPVLYVVHALLTGLSLFIASVFHWTAGFGFSAGFIDMFLSAQNPLANQWWMLLVLGVI
FT                   YFALYFGIFYTLIGVLHLKTPGREEEDETEVESTADASTSDMAAQIIDGLGGPSNIDVV
FT                   DYCATRLRVTVQDSARVDEPAIKRAGVIGVMRPGAKNVQVVIGPQVQFVYDEVAAQLSG
FT                   KVSLKGEQG"
FT   gene            125872..126327
FT                   /locus_tag="CPFRC_00645"
FT                   /old_locus_tag="cpfrc_00126"
FT   CDS_pept        125872..126327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00645"
FT                   /old_locus_tag="cpfrc_00126"
FT                   /product="PTS glucose transporter subunit IIA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00126"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27919"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240986.1"
FT                   /protein_id="ADK27919.1"
FT                   /translation="MFGFAKKKVVVIPPIHGPLLPLSSVNDAVFSSGMMGEGFAVEPDG
FT                   FGEVVAPVSGKLVTVFKTGHAFAIKTPEGLEVLVHIGLDTVEMGGRGFAAHKASGENVV
FT                   QGEKLITVDFDAVRAAGYDPVTLVVFTNKKCVDHVELNAGKATVFLN"
FT   gene            126487..127290
FT                   /locus_tag="CPFRC_00650"
FT                   /old_locus_tag="cpfrc_00127"
FT   CDS_pept        126487..127290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00650"
FT                   /old_locus_tag="cpfrc_00127"
FT                   /product="VOC family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00127"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27920"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240987.1"
FT                   /protein_id="ADK27920.1"
FT                   /translation="MSLILHGDPTWIDLSTHDLEGSQAFYKELFGWEFNSQGEECGGYN
FT                   IILSEGQPVGGAMDSHMGPEGPSETPMAPTAWTIYLKVDDINAALAAAQETGGQVLLPS
FT                   MQVGTLGFMAIVSDPAGGVVGLWQALDFPGITREPVKGQPAWFEVMSKDFDAAAPFYQK
FT                   VAGWKLSYIGEDGQPADSAQDGIRYAANAPGEAATAGICEAKDFLPEEVPSHWRVYFSV
FT                   ADVDATVSKLQELGGQLIDGPVDTPFGRIATVADPQGASFQLSSR"
FT   gene            127517..129835
FT                   /locus_tag="CPFRC_00655"
FT                   /old_locus_tag="cpfrc_00128"
FT   CDS_pept        127517..129835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00655"
FT                   /old_locus_tag="cpfrc_00128"
FT                   /product="nitric-oxide reductase large subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00128"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27921"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799890.1"
FT                   /protein_id="ADK27921.2"
FT                   /translation="MIGGSRVALLEAPQRMSSRDKRWWSALAAVIIASFVVLLWMGQQI
FT                   NVHKPPIPERVETAQGKVLVTKDQIINGQQVWQSIGGQQIGSVWGHGAYVAPDWTADWL
FT                   HREATQILDKWAQKEGASDYAALGVEKQAALKARLKSELRTNGYQDGRIVLSDDRVAAF
FT                   EANKKYYAELFANGHENYAIPKDSIKDEAAAQDMAAFFWWTSWAASTNSPGSEETYTQN
FT                   WPHEQLIDNVPPTSNILWSIISFILLLAGIGGLVWYQGWKGEENETPDVTPEKDPLLGF
FT                   KPTPSQRATLKYFFIVGLLFVLQIACGIIAAHYGVEGGALFGIPIDKILPYAVVRTWHT
FT                   QLGIFWIATAWFATGLYVGPAVGGKEPKFQRLGVNILFGALLVVVLGSMAGEWASIMGK
FT                   LGYGNPINFWLGTQGYEYVDLGRVFQIGLFIGLALWFILMWRALAPAVRKAKTVPGKIM
FT                   PTPEAPLAAGTQRSLTAMLLMSCLAIAGFYGAAFGVNHETHLSIAEYWRWWVVHLWVEG
FT                   FFEVFATTVIAFLFARIGLVRPAAATTSVIVSTTIFLAGGIIGTAHHLYFSGAPAHVMA
FT                   LGAVFSALEVVPLALIGVEAFRNLNLLKLQPWVAGYKWAIYFFVSVSFWNMLGAGVFGF
FT                   LINPPISLFYVQGLNLTPLHGHTALFGVYGMLGIGLMLFCVRSLMPNANWDDRWLKWGF
FT                   WGMNGGLLAMSLLSLLPLGLAQAWASMDVGLWYARSDSFLYTPVLTFIRWLRVPGDIIF
FT                   AVGALAIGVFMVRLVARKK"
FT   gene            129915..129987
FT                   /locus_tag="CPFRC_00660"
FT                   /old_locus_tag="cpfrc_t008"
FT   tRNA            129915..129987
FT                   /locus_tag="CPFRC_00660"
FT                   /old_locus_tag="cpfrc_t008"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:129948..129950,aa:Arg,seq:acg)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            complement(130153..130839)
FT                   /locus_tag="CPFRC_00665"
FT                   /old_locus_tag="cpfrc_00129"
FT   CDS_pept        complement(130153..130839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00665"
FT                   /old_locus_tag="cpfrc_00129"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00129"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27922"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366323.1"
FT                   /protein_id="ADK27922.1"
FT                   /translation="MHFKTRMSLFCTATTAATSLAVASLQPAAAVEQPSNTIVSTIMLP
FT                   TKATVTKTFTVSSTKGTARADYSSNSITVQPGDTISVKIHSQGGYTEFSELTEFVPSVG
FT                   RLHTESITFKEGDSGPHPLKVAGWNATSQADRVTFRTNDGKPKAITLDTTLEYTYTVGV
FT                   RATGDPSTRFQLSSSDSNTVFTSASGPKIHVKKTLPSWLSGAFPGAIFDSLTNLLSPIL
FT                   RALNIL"
FT   gene            complement(131046..132440)
FT                   /locus_tag="CPFRC_00670"
FT                   /old_locus_tag="cpfrc_00130"
FT   CDS_pept        complement(131046..132440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00670"
FT                   /old_locus_tag="cpfrc_00130"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27923"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522086.1"
FT                   /protein_id="ADK27923.2"
FT                   /translation="MRSELVTHLPIAVDSSSSQPLPVQITSHIRSLVSQKIIAPGDHIP
FT                   SSRSLAAQLGVSRGTVLAAYEQLSAEGYLLAAHGSGTMINPHLAAPQPPPPPIGHTLRP
FT                   PSPPPLLNLEPGIPDTATLADSSWRASWRAACSTPPATSDPLGLPRLRAEISEHLRRMR
FT                   GLIADPEHIVVTAGAREGLSLLLTASQRRLTIGVESPGYPSLRRIPHALGHRTSNVTTD
FT                   KQGLNPDSLHKGLDAVLVTPSHQYPHGGSLSATRRTALSAWASDTDSLIIEDDFDSELR
FT                   YVGMPLPALTAINPEHAVLLGTFSSVIAPQVATGYIVAPPHMISVLRNLRTALGQPVSM
FT                   ITQDAIARYLATGALRRRTQRLRRIYRRRREMVSTQLGHLSSSELHPIDGGLHAVLSCQ
FT                   RPEAEIITDCANRGIHVVGLSNYWGGTDGNITPGANHDNGIVFGFGCHDDNTLREALDI
FT                   LAEIVQ"
FT   gene            132530..133429
FT                   /gene="pdxS"
FT                   /locus_tag="CPFRC_00675"
FT                   /old_locus_tag="cpfrc_00132"
FT   CDS_pept        132530..133429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxS"
FT                   /locus_tag="CPFRC_00675"
FT                   /old_locus_tag="cpfrc_00132"
FT                   /product="pyridoxal 5'-phosphate synthase lyase subunit
FT                   PdxS"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00132"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27925"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_003850286.1"
FT                   /protein_id="ADK27925.2"
FT                   /translation="MTETQTSTATHRVKRGLADMLKGGVIMDVVTPEQARIAEDAGASA
FT                   VMALERVPADIRSQGGVARMSDPDLIEGIVNAVSIPVMAKARIGHFVEAQILESLGVDF
FT                   IDESEVLSPADYTNHIDKWNFKVPFVCGATNLGEALRRVTEGAAMIRSKGEAGTGDVSE
FT                   AVKHLRTIRGDINRLRSMDADELYVAAKELQAPYELVKEVAETGKLPVVMFVAGGVATP
FT                   ADAALVMQMGAEGVFVGSGIFKSGNPAARAAAIVKATTLYDDPAALAEVSRGLGEAMVG
FT                   GINVADVPAPHRLAERGW"
FT   gene            133423..133989
FT                   /gene="pdxT"
FT                   /locus_tag="CPFRC_00680"
FT                   /old_locus_tag="cpfrc_00133"
FT   CDS_pept        133423..133989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="CPFRC_00680"
FT                   /old_locus_tag="cpfrc_00133"
FT                   /product="pyridoxal 5'-phosphate synthase glutaminase
FT                   subunit PdxT"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00133"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27926"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366326.1"
FT                   /protein_id="ADK27926.1"
FT                   /translation="MVIGVLALQGGFAEHIAVLSRCGAKTRRVRVAQDLEGLKGLVIPG
FT                   GESSVIDKLARALGLAEPLAQSIGAGLPVFATCAGLIYLGQVENPAPGQRSLGCLDAVV
FT                   RRNAFGRQTDSFDTRIRVFDRIEADVSFIRAPEIISWGSDVEVTARVGGRVVGVKQGLI
FT                   HAYAFHPESAGETRLHEEWLREIGR"
FT   gene            complement(134016..135029)
FT                   /locus_tag="CPFRC_00685"
FT                   /old_locus_tag="cpfrc_00134"
FT   CDS_pept        complement(134016..135029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00685"
FT                   /old_locus_tag="cpfrc_00134"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00134"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27927"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835781.1"
FT                   /protein_id="ADK27927.2"
FT                   /translation="MTINEVSRPVCILGLGLIGGSLLRALKETGLPAFGFNRSPSAARA
FT                   AEKEGYDVHSDLIETLQRAELENALIVLATPMPAIDSLLEAIQKHAPSCGFTDVVSVKG
FT                   EVYELVCARGLTHKYVGGHPMAGTANSGWEASYPELFRRAPWVVTFDHACDGAGPEWIQ
FT                   LWTDVVNMASSVGAEVIPSRVSSHDAAVARISHLPHVFAETLAIVGDNGGALALSLAAG
FT                   SFRDSTRVAGSAPSLVRAMCETNAEALLTALDEALVLLNDARAHLAEKRPSIEELVDVG
FT                   YRSRIRFEARSGANAPEHVGPISISHRPVFRLQPGVRDWVSQLIQAEGLGARIEVF"
FT   gene            135067..135519
FT                   /locus_tag="CPFRC_00690"
FT   CDS_pept        135067..135519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00690"
FT                   /product="tRNA adenosine deaminase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300394.1"
FT                   /protein_id="QGW57307.1"
FT                   /translation="MKSDFAVTVARVDAAWQVRVFKDDFSSLQTSINAVRSLRAEGAAF
FT                   AMLSVDDDYFVLVRPTPQSVRLLISDATAAVEDDFASEILDELDADLPDADDAPYAEGD
FT                   FDILADLGVGEQIMSVITDETDWWASEQLQRIAEELGCDEELDDAL"
FT   gene            135537..135992
FT                   /locus_tag="CPFRC_00695"
FT                   /old_locus_tag="cpfrc_00135"
FT   CDS_pept        135537..135992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00695"
FT                   /old_locus_tag="cpfrc_00135"
FT                   /product="nucleoside deaminase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27928"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525211.1"
FT                   /protein_id="ADK27928.2"
FT                   /translation="MLIDAQSLMRQAIIQAQATPPGDIPVGAVIFGPDGEVLGRGVNRR
FT                   EADRDPLGHAEIMAIREAVANHDDGWRLTDCTLAVTLEPCTMCAGALVGARIGRIFFGA
FT                   YEPKTGACGSAFDVVRDPAVLHVPEVRGGILQDECAALVTHFFEGLR"
FT   gene            136021..136111
FT                   /locus_tag="CPFRC_00700"
FT                   /old_locus_tag="cpfrc_t009"
FT   tRNA            136021..136111
FT                   /locus_tag="CPFRC_00700"
FT                   /old_locus_tag="cpfrc_t009"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:136055..136057,aa:Ser,seq:cga)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            136465..138852
FT                   /locus_tag="CPFRC_00705"
FT                   /old_locus_tag="cpfrc_00136"
FT   CDS_pept        136465..138852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00705"
FT                   /old_locus_tag="cpfrc_00136"
FT                   /product="MMPL family transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00136"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27929"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366330.1"
FT                   /protein_id="ADK27929.1"
FT                   /translation="MAKLLYRIGKWSFRAKWLVISIWLVVLAAVGGSAVAFQAGFNDLF
FT                   TINNTPAKKATELYLKNFPELKNPLQGTGVNIVFKAPDGERLEEPQNKKAVDDVLAYLN
FT                   EHLQGIVDTQRYGNPVTLNPLLQQGVIDQMVANGVPEETARKDADNLSLISADGAVGYT
FT                   TFSLDVPLPANVTKEQRAAINAALDVGRSEGLTVEAGGAGFGDPIVITSTSEVIGVAVA
FT                   AIILMVTFGALVAAGLPLLTAIIGVGIGSLSIMLATAWVSLNNVTPVLAVMIGLAVGID
FT                   YSLFIIFRYRHELLTRTREEAAGMAVGTAGSAVVFAGLTVIIALVALAVANIPFLAYMG
FT                   FAAAFTVFISVLIALTLVPALLGLLGDKVFKGKIRWRKKTRVAPKRTMGRRWAEFVHKV
FT                   PGVVIAVTVIGLGALTLPALQLHLSLPSDTQSELDTTQRKQADIMAEAFGPGINSPFLV
FT                   VVDAHHANPESVALDPLIRAQNPTDEESRGKAAANASYQYIVQKYSVNANVKHVQIVGL
FT                   SQDGLAAQLLLTPKTSPEDDATKELINSLLTQQREVESATGVESGITGLVPVQQDVTNR
FT                   LSGVMPLYLAIVVGLAIILLMVIFRSFWVPIVAGLGFLLSVGAAFGVTVLFWQQGLWGF
FT                   VSTPGPIIAFMPIFLIGVCFGLAMDYQVFLVSAMREHYTHSGGTASPGSRYNAMEESVV
FT                   EGFASSARVVTAAALIMIAVFVAFIGQPLPFIKIFGFALGAGVLFDAFLIRMAFVPAAM
FT                   FLMGRSTWHIPRWLDKVLPHLDVEGAALEREHSVQQGTRKDA"
FT   gene            138901..140142
FT                   /gene="tgt"
FT                   /locus_tag="CPFRC_00710"
FT                   /old_locus_tag="cpfrc_00137"
FT   CDS_pept        138901..140142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="CPFRC_00710"
FT                   /old_locus_tag="cpfrc_00137"
FT                   /product="tRNA guanosine(34) transglycosylase Tgt"
FT                   /EC_number="2.4.2.29"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00137"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27930"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013240997.1"
FT                   /protein_id="ADK27930.1"
FT                   /translation="MDTTFELKTELYDEPGRHGRTGVIHTPHGDIATPAFIPVATKATV
FT                   KTLTPPQIRSTGAQAILSNAYHLYLQPGHDVVDEAGGVAAFENWNGPTYTDSGGFQVMS
FT                   LGVGFKKVLAMDVKGYEEADIRAKKRERMAKVDEDGVDFRSVLNGSRHRFTPEVSMQIQ
FT                   HGLGADIMFAFDELTTLIDTRDYQVNSVARTHRWAERCLIEHDRLTNERVGKPLQSLWG
FT                   VVQGAQYEDLRRKAIRGLLELNDQAEAAGRRGFGGFGIGGALEKENLGTIVGWVCDEIP
FT                   KEKPRHLLGISEPDDLFTAIEAGADTFDCVAPTRLGRRGGVYTLDGRMNLTNAKFKRDF
FT                   TPIDAEFGGPTVEYTRAYINHLLKAKEFLAGTLCTMHNVAFMVQLVDNIRASIDNGTYE
FT                   EYKAEFMGRYYARR"
FT   gene            140129..140995
FT                   /locus_tag="CPFRC_00715"
FT                   /old_locus_tag="cpfrc_00138"
FT   CDS_pept        140129..140995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00715"
FT                   /old_locus_tag="cpfrc_00138"
FT                   /product="tRNA glutamyl-Q(34) synthetase GluQRS"
FT                   /EC_number="6.1.1.-"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00138"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27931"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835785.1"
FT                   /protein_id="ADK27931.1"
FT                   /translation="MPAGRYAPSPSGDLHFGNLRTAVLAWLFARSSGRRFLIRIEDVDT
FT                   QRSSLASAQRQLEDLASLGLDWDEEPTYQHDHYDRYLAALGCLPHYECYCSRKDIQEAS
FT                   RAPHSIPGQYPGTCRNLSPEVREERRQELAAQGRVPALRLRANAASWRIHDYYGGNIVG
FT                   DVDDMILRRGGQQPDWAYNLAVVVDDAAQGVDQVVRGDDLLSSAPRQAYLAHLLGHSSP
FT                   QYIHVPLVLNAQGKRLAKRDGAVTFREMTDILPHVADSLGLKGQTLPELLEQFDPDALP
FT                   REPYVFR"
FT   gene            141227..142615
FT                   /locus_tag="CPFRC_00720"
FT                   /old_locus_tag="cpfrc_00139"
FT   CDS_pept        141227..142615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00720"
FT                   /old_locus_tag="cpfrc_00139"
FT                   /product="GntP family permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00139"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27932"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523756.1"
FT                   /protein_id="ADK27932.1"
FT                   /translation="MENWVPTLSAGPLLGIAAAAIALILILVIVFRLHAFLTLIVVSAL
FT                   TALASGIPLDGIVSTMTKGFGSTLASVALLVGLGAMLGRLVETSGGAKSLAEALVARCG
FT                   ERRAPFALGVASLVMGFPIFFDAGLIVMLPVIFAVARRLKGPVLAYGIPAAGAFSVMHI
FT                   YLPPHPGPISAAEFYSADIGLVMLLGLLIAIPTWLVSGLWWGKKMGAKYPLPVPDILAG
FT                   GPQAADPKNPASPKLVVALLLLPMLLIFGNTGMSMAVAAGWVEKTSVAVRVLQFLGNTP
FT                   IALLISTLIALYFLGLRRGEPKEQLEKLLDGALGPICSVVLITGAGGMFGGVLRTSGIG
FT                   SALADSMSDLGLPVIVGCWLVAAILRLAQGSATVALTTAAALMAPAVAAGGFNEFQIAL
FT                   MVLASAAGSVFAGHVNDSGFWLVGRLMGMDVSTTLRTWTMNQALVGAVGFVIVLGFYGV
FT                   SLAF"
FT   gene            complement(142599..143090)
FT                   /locus_tag="CPFRC_00725"
FT                   /old_locus_tag="cpfrc_00140"
FT   CDS_pept        complement(142599..143090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00725"
FT                   /old_locus_tag="cpfrc_00140"
FT                   /product="gluconate kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27933"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525215.1"
FT                   /protein_id="ADK27933.1"
FT                   /translation="MRIIVMGVSGSGKTTVGTMLAYKLEIPYFDGDDLHPQENINKMAQ
FT                   GCPLNDADRWPWLARVGEWLAHQPEGGVIGCSALKRSYRDLLRAHCPDAVFVHVHGSRE
FT                   VLLARMNRRKGHFMPSSLLDSQFATLEPLENDEVGRVFDVTDSPNQIAASASEWIKTRG
FT                   "
FT   gene            complement(143087..144076)
FT                   /locus_tag="CPFRC_00730"
FT                   /old_locus_tag="cpfrc_00141"
FT   CDS_pept        complement(143087..144076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00730"
FT                   /old_locus_tag="cpfrc_00141"
FT                   /product="alcohol dehydrogenase catalytic domain-containing
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27934"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241001.1"
FT                   /protein_id="ADK27934.1"
FT                   /translation="MAKEHMHAALISGAKQLEVTTLPCPTPSPGEVLVTVSYVGICGSD
FT                   LHYYQDGAVGAFEVRQPLVPGHEMSGTLSDGTPVTIHPATFGTCMEGIEDHPHLWPHGA
FT                   YLGSASTWPHTQGAMQEQLLVREDQIRRLPEGVPLRRASLAEPLSVGLHAITVAGSVEG
FT                   KHVLVSGAGPIGQLAALAAVNKGAATVTISDVVDGPLERAHESLTCVNTTRTQLHDESF
FT                   DVVLECAGVPAATTDALRVVRRRGTVVQVGMLPNQPVGINMAPLVSKEVLLRGTFRFLD
FT                   EVNQAIEMLKDPMFDSVITHEFPLSDVVTAFNIAADSQVSGKVVVKIP"
FT   gene            complement(144079..144828)
FT                   /locus_tag="CPFRC_00735"
FT                   /old_locus_tag="cpfrc_00142"
FT   CDS_pept        complement(144079..144828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00735"
FT                   /old_locus_tag="cpfrc_00142"
FT                   /product="SDR family oxidoreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00142"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27935"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799899.1"
FT                   /protein_id="ADK27935.1"
FT                   /translation="MTTFDVTGKLALVTGSTRGLGRTLAAGLISAGAHVIVHGSDKQRA
FT                   ATVAEELGAYGAIGCPLTDSQATNVAISEMLQEYGTPDILVNNAGIQRRNPIEQFEDSD
FT                   WDDIIGVNLSGVFHVTKPIAAAMKSAGRGKIIMIGSVQSRLGRATIAPYCATKGGVAMF
FT                   AQGLAAELSPHNIQVNTLSPGYFDTDMNAALVADPEFTDWVSKRTPAGRWGDPQELVGP
FT                   LLFLASNASSFVTGQNLAVDGGMTAVV"
FT   gene            complement(144931..145019)
FT                   /locus_tag="CPFRC_00740"
FT                   /old_locus_tag="cpfrc_t010"
FT   tRNA            complement(144931..145019)
FT                   /locus_tag="CPFRC_00740"
FT                   /old_locus_tag="cpfrc_t010"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:144983..144985,aa:Ser,seq:gga)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            145172..145268
FT                   /gene="ffs"
FT                   /locus_tag="CPFRC_00745"
FT   ncRNA           145172..145268
FT                   /gene="ffs"
FT                   /locus_tag="CPFRC_00745"
FT                   /product="signal recognition particle sRNA small type"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: cmsearch."
FT                   /inference="COORDINATES:nucleotide motif:Rfam:12.0:RF00169"
FT                   /inference="COORDINATES:profile:INFERNAL:1.1.1"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            145522..146799
FT                   /locus_tag="CPFRC_00750"
FT                   /old_locus_tag="cpfrc_00143"
FT   CDS_pept        145522..146799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00750"
FT                   /old_locus_tag="cpfrc_00143"
FT                   /product="aminotransferase class I/II-fold pyridoxal
FT                   phosphate-dependent enzyme"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00143"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27936"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366336.1"
FT                   /protein_id="ADK27936.1"
FT                   /translation="MSLLDFDAERLAQFHEDISAKYEALKAENLKLDLTRGKPSSEQLD
FT                   FSNALLSLPGENFRAKDGTDCRNYGGATGIADIRELWAEVLGLPAENLVAGDGSSLNIM
FT                   FDLISYAYAFGTNDSERPWKDEETVKWLCPVPGYDRHFTITEHFGFEMISVPMTDQGPD
FT                   LDVVRELVQDPQVKGMWTVPVFANPTGITFSEETCRALAELATAAPDFRIIWDNAYAVH
FT                   TLTDEFPVVHNVLDFAERAGKPNRFWFMSSTSKITHAGSGVSFLASSKENLDWYGAHAD
FT                   VRGIGPNKINQLAHAQFFGNAEGVRAHMRKHAGSLAPKFKRVLEILDSRLSEYQVAEWS
FT                   KPVGGYFISVDVVDGTASRVVDLAKQAGIALTGAGSSFPLHQDPRNRNIRLAPSLPPVA
FT                   ELEIAMDGFATCVLLAAVEKVLAERV"
FT   gene            146881..147450
FT                   /locus_tag="CPFRC_00755"
FT                   /old_locus_tag="cpfrc_00144"
FT   CDS_pept        146881..147450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00755"
FT                   /old_locus_tag="cpfrc_00144"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00144"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27937"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366337.1"
FT                   /protein_id="ADK27937.1"
FT                   /translation="MILEETAVWIDGIIPGDMTIHLPETSYGEAFHIGTVEVGNQQVLA
FT                   TTLDFNGVDTGLTLGDGSGQVDVRSEIFTVGQFQTEVGVQVLRRLAIFLDNVGGSIPAQ
FT                   PGQLLPALGSMTDALDRCTVKHGLFVAPYMWGGQVPQYSEPSQLTALLQLIMLTQHEFD
FT                   YATTYGIPELQRALGNEGVDLTDWTR"
FT   gene            147464..150013
FT                   /locus_tag="CPFRC_00760"
FT                   /old_locus_tag="cpfrc_00145"
FT   CDS_pept        147464..150013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00760"
FT                   /old_locus_tag="cpfrc_00145"
FT                   /product="DNA polymerase III subunit gamma and tau"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27938"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522986.1"
FT                   /protein_id="ADK27938.1"
FT                   /translation="MALYRKYRPASFAEVVGQEQVTQPLSVALDSGRINHAYLFSGPRG
FT                   CGKTSSARIMARSLNCVEGPTSTPCGKCNSCISLAPNGPGNLDVTELDAASNNSVDDMR
FT                   ELRDRAMYAPAESRYRIFIIDEAHMVTTQGANALLKIVEEPPEHLIFIFATTEPEKVIG
FT                   TIRSRTHHYPFRLLTPQSMRGLLENTVASEGALVEDSVYPMVIRAGGGSPRDTLSVLDQ
FT                   LLAGTGPQGLNYETARLLLGATDDALIDAAVTALSSHDKAALFTTIDAAVEAGLDPRRF
FT                   ATDLLDRLRDLMVLQSVPDAFELGLVDAPTDRAEVLRAQAADFNQGEVAQLAALVNDGL
FT                   RSLKGATSPRLLLEILCAKMLLPSAPTGVALTPPPGNAQPSGLPTGGQAAGPAAIPAKY
FT                   ERKSIRMAREAAQRKAAQEEAAQREALQHEAPQAKAEPAAPSDKQASLKKQEVPKEQVA
FT                   EKPLPAPEPSGSTTPPSDEAERVAEGASISNDDAFAADVRARWEALRKMVHKKSAVAGI
FT                   LLAESRVLGMREGALILGHNTGPLAQRLNDAKNNDIIVEVIRAELGREVAVNCVVGTDP
FT                   AAAGFSEPKPEKAWNPEPAVSEPVTPESSVDDQEKQPNIVQPDPQPPAVEQPSEPVHDA
FT                   PSGAASTWGDPAPLGGETRRAPRTEPPTQGTKADGWGTPAPLGGQAEAENDAPKKPEQS
FT                   APVQPASVQRAPQRPVPKSVSEAPSTQKPKSRWQEAVARNAQATEERAKRPEFSDGVPL
FT                   PPEPDDFGAPDPAEWSPPEEPYGYAADEGFPEPAKHTPPPSPTEPTTTVETSNVSDQDE
FT                   EEEMVREAASGSVTRDHRDALTVAMDLLAEQLGARQL"
FT   gene            150117..150437
FT                   /locus_tag="CPFRC_00765"
FT                   /old_locus_tag="cpfrc_00146"
FT   CDS_pept        150117..150437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00765"
FT                   /old_locus_tag="cpfrc_00146"
FT                   /product="YbaB/EbfC family nucleoid-associated protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00146"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27939"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_003850338.1"
FT                   /protein_id="ADK27939.2"
FT                   /translation="MTQPDMSQLLAQAQQMQAQLQEAQREILASTVTGTAGNGLVSIDI
FT                   QGNGMVSSVTIDPKVVDPEDVETLQDLIVGAFAEAHQKLSELADQKMGPLSQGFDGLGG
FT                   MF"
FT   gene            150549..151205
FT                   /gene="recR"
FT                   /locus_tag="CPFRC_00770"
FT                   /old_locus_tag="cpfrc_00147"
FT   CDS_pept        150549..151205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="CPFRC_00770"
FT                   /old_locus_tag="cpfrc_00147"
FT                   /product="recombination protein RecR"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00147"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27940"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599497.1"
FT                   /protein_id="ADK27940.1"
FT                   /translation="MFEGPLQDLIDELSRLPGVGPKSAQRIAFHLLHVEPADIARLQDA
FT                   LGAVRDGVTFCRICCNISRESVCRICADSGRDRGTICVVEEPKDIQVIERTGEYNGRYH
FT                   VLGGALDPLANIGPRELNISTLLQRIGGVLPDRELADSTPDAPLYDSSPTVTEVILATD
FT                   PNTEGEATASYLARLLRDFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLTI"
FT   gene            complement(151221..152558)
FT                   /locus_tag="CPFRC_00775"
FT                   /old_locus_tag="cpfrc_00148"
FT   CDS_pept        complement(151221..152558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00775"
FT                   /old_locus_tag="cpfrc_00148"
FT                   /product="GntP family transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00148"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27941"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366339.1"
FT                   /protein_id="ADK27941.1"
FT                   /translation="MTGVSLLLLGIAAVAVLLVLVIWAKVPAFVALIGVSIATAIASGI
FT                   PLADSVSTVTNGVGKTLGSVAVVVGLGAMLGRIIEVSGGAEAVARYFTDKLGRHRVTAA
FT                   VTIAAFILGIPVFFDVGFIILAPIVFGFAAVAKINPLKIGLPVAGAILTVHVTLPPHPG
FT                   PVAVAGIFSSDPGLMLTLGLPIAALTCVIGYYAAKVLKLDSIDRGPSPVELSDAAPNHQ
FT                   APSPFAVLGLILLPIVLIMVGATGAMYTEKGTVVHSLVSFIGSSPVALLVAVVVAWLSI
FT                   GKQQSWNREHSSGVLDSALPAVAIIIFVTGAGGGFANVLVESGIGKVLSDMLVAAHMPL
FT                   ILMAFLLSLALRASQGSVTVAMLTTAGLLTQPIAEAGLSSVRTTLVMIAIGFGAMCLSH
FT                   INDSGFWIVTKYLGLSVKQGLRTWTLLSTAFGVAGFALTSLVYAVV"
FT   gene            complement(152558..153466)
FT                   /locus_tag="CPFRC_00780"
FT                   /old_locus_tag="cpfrc_00149"
FT   CDS_pept        complement(152558..153466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00780"
FT                   /old_locus_tag="cpfrc_00149"
FT                   /product="NAD-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00149"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27942"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910601.1"
FT                   /protein_id="ADK27942.1"
FT                   /translation="MSLIVTVVGLGAMGLPMATNLVQNFTVRGVDIAQSRLELGKAAGL
FT                   ETFHSAHQAATGADVVLLAVRNEEQLIQALFGQGNIAAALKPGAVVLLTSTVGITAVEK
FT                   AAEQLDSLGIDVVDAPISGGPGRAGSGELLVTVGAKPEVVDRIRPVLEAMSSHLVIVGD
FT                   RPGKGQALKTVNQLLCGVHIAAAGEALALADRLGLDPKAALDALMGGAAASFMLGDRGP
FT                   RMLEAYSEEGPEVRSRLDIFVKDMGIVTDAAKSAGIGVPLAAAAEQQYLAGLARGKGAQ
FT                   DDSTIIQVVAPTQVNKTRSKQ"
FT   gene            complement(153477..154918)
FT                   /pseudo
FT                   /locus_tag="CPFRC_00785"
FT                   /old_locus_tag="cpfrc_00151"
FT   CDS_pept        complement(153477..154918)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00785"
FT                   /old_locus_tag="cpfrc_00151"
FT                   /product="hypothetical protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27944"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522987.1"
FT   gene            complement(155061..155765)
FT                   /locus_tag="CPFRC_00790"
FT                   /old_locus_tag="cpfrc_00152"
FT   CDS_pept        complement(155061..155765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00790"
FT                   /old_locus_tag="cpfrc_00152"
FT                   /product="FCD domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00152"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27945"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366342.1"
FT                   /protein_id="ADK27945.1"
FT                   /translation="MRTDLVTQGIEKIMDAIAEGVFRPGDALPPETNLAAYLEVSRPTM
FT                   REVVRTLADRGVVEVVHGRGTFVTPINQWNYVRSRMDVISRSLDPKTIGIYLTEVRRMI
FT                   EVGSSGLAAARATQEDIEKMTQALAAYDEATERGDVTATTDADVAFHTALLEATGNPFV
FT                   SALMIPLAGALAESRQKTNAVDEVRKRASKHHHAILDAIKARDEQAAKDAMRAHMTQTF
FT                   DDISTFLPGSMH"
FT   gene            155877..156707
FT                   /locus_tag="CPFRC_00795"
FT                   /old_locus_tag="cpfrc_00153"
FT   CDS_pept        155877..156707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00795"
FT                   /old_locus_tag="cpfrc_00153"
FT                   /product="2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00153"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27946"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366343.1"
FT                   /protein_id="ADK27946.1"
FT                   /translation="MRLATIRTQGTTTAARIEGTDLAVAIPGFYDVGELLQKSDWQELA
FT                   RSASGTPVRFSQQDLHAVIPSPKKIICVGLNYSNHIKEMGRTLPEVPTLFVKFSDALTG
FT                   PFDDIPIPPWANSALDWEGELAVVISRHARRVKASEAEEYIAGYAVMNDYSARDYQYAT
FT                   LQWHQGKSLEKTAGFGPWLTTRDSFDLSGELKTYLNEEKVQSAAISDLVFKPADLIQYI
FT                   THLYPLDPGDVIVTGTPGGVGHARDPRRYIGDGDVVTVEIEGLGRIANKTIFEK"
FT   gene            156847..157083
FT                   /locus_tag="CPFRC_00800"
FT   CDS_pept        156847..157083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00800"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366344.1"
FT                   /protein_id="QGW57308.1"
FT                   /translation="MYFEAACFAFQQRGFHILVHACIFIHIIGVTHKREILLIGLDTYE
FT                   LGMSGRQCNYVMPPITGSLVGRVSAIKTVMLAS"
FT   gene            complement(157310..158062)
FT                   /locus_tag="CPFRC_00805"
FT                   /old_locus_tag="cpfrc_00155"
FT   CDS_pept        complement(157310..158062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00805"
FT                   /old_locus_tag="cpfrc_00155"
FT                   /product="glutamine amidotransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27948"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241015.1"
FT                   /protein_id="ADK27948.1"
FT                   /translation="MTDLSIGLILPDVLSTYGDDGNALVLRQRARMRGFTAEIHTVKLG
FT                   QPVPESLDVYCIGGGEDTAQILAAEHLIADGGLTRAANAGRPILGICAGLQVLGSSFRA
FT                   SGKMVDGVGLVDATTASLAKRTIGELQTEPTRKGITAELTEPLTGFENHMGATILGADA
FT                   QPLGKVTRGVGNTDEHGISQASATSEQLIAEGAVQGNVICTYMHGPVLARNSQLADLLL
FT                   ARAMGIALDELAPLELPIVNQLRKERLA"
FT   gene            complement(158062..159357)
FT                   /locus_tag="CPFRC_00810"
FT                   /old_locus_tag="cpfrc_00156"
FT   CDS_pept        complement(158062..159357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00810"
FT                   /old_locus_tag="cpfrc_00156"
FT                   /product="DUF1727 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00156"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27949"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558553.1"
FT                   /protein_id="ADK27949.1"
FT                   /translation="MSLNLRTRLAIGTAHLATTASRVTGRGSGGMIGGLIAEKIDPNIM
FT                   ASLGDDRPVALVTGTNGKSTTTRMLASAIRAQHTVATNEGGDNMDAGIISALMAGQKAS
FT                   HVILEVDELHVPAVADRLKPSCLILLNLTRDQLDRVGEINKIERALRDCVTKHPEMTVI
FT                   ANCDDVLVTSIAYDAKNVVWVSAGAGWQGDSVSCPRTGGHVVHDGADWYAVKPLPNGEQ
FT                   FRRPTPHWSITAEGIVSPADIGSSTGSDAPMTQEVSPLNLALPGNANRGNATQAVAAAV
FT                   ECFQVPLNQAVRSVESVDDVAGRYSTITLGQHQIHLLLAKNPAGWQEALSMVDRTAEGL
FT                   VIAVNGQVADGEDLSWLWDVKFEELDKLSVKASGERGTDLSVRLTYASVEHELIKNPLQ
FT                   AIKACPAGRVEVLANYTAFRDLKKAIAAVKES"
FT   gene            complement(159369..160415)
FT                   /locus_tag="CPFRC_00815"
FT                   /old_locus_tag="cpfrc_00157"
FT   CDS_pept        complement(159369..160415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00815"
FT                   /old_locus_tag="cpfrc_00157"
FT                   /product="DNA polymerase III subunit epsilon"
FT                   /note="3'-5' exonuclease of DNA polymerase III; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00157"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27950"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241017.1"
FT                   /protein_id="ADK27950.1"
FT                   /translation="MTNKQVDGTNADRAAEIERAPYVALSIQTSGIHPSTSRLITVDAV
FT                   TFTEDGEETDHFHAVINPGDNPGPFHLHGLSREEIAQGKKFSHILKPLGKLIDGRTLIL
FT                   HNTPYTWGFLVSESRRTMSAAARANRNRYRHRNRRRQRVGHIPRPRMIVDTLATARRQG
FT                   VVFEDIRIRAVAHSLGLDSPSPVASLERAERPEQHVSREETLLIARMYFVEKACGVISS
FT                   YTPEQLRSDKFGLQRSDIRVDAMEVPRQYENPGVYSPEGGFVQGMEVVIAPEITMDPDV
FT                   IIEAILRSGLAYNEKLTRKSSVVVCNKQEDLVGKAMHGQRKGIPLITDEEFLRVVVDVK
FT                   PGKASEDD"
FT   gene            complement(160444..161212)
FT                   /pseudo
FT                   /locus_tag="CPFRC_00820"
FT                   /old_locus_tag="cpfrc_00158"
FT   CDS_pept        complement(160444..161212)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00820"
FT                   /old_locus_tag="cpfrc_00158"
FT                   /product="NADPH-dependent oxidoreductase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00158"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27951"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558554.1"
FT   gene            complement(161252..163069)
FT                   /gene="leuA"
FT                   /locus_tag="CPFRC_00825"
FT                   /old_locus_tag="cpfrc_00160"
FT   CDS_pept        complement(161252..163069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="CPFRC_00825"
FT                   /old_locus_tag="cpfrc_00160"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27953"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014309886.1"
FT                   /protein_id="ADK27953.1"
FT                   /translation="MGPTDAFISAPADIHTPSGSFAAGQATWNKQRSSDLPVHRYLPFA
FT                   AKVEKIDLPDRTWPSATIDTAPQWCAVDLRDGNQALIDPMSPERKRRMFNLLVAMGYKE
FT                   IEVGFPSASQTDFDFVREIIEKNMVPEDVTIQVLVQAREHLIRRTFEACEGAKNVIVHF
FT                   YNSTSILQRDVVFRKDKKAIKKLATDAAELIKSIAAEYPNTNWRWEYSPESFTGTELAY
FT                   TKEVIDAVVEVMDPTPMRPIIINLPSTVEMTTPNTYADSIEWMHRHLRRRDSIILSLHP
FT                   HNDRGTGVAAAELGYLAGADRIEGCLFGNGERTGNVCLVTLGLNMLTQGVDPQIDFSDI
FT                   EQIRRTVEYCNQLRVPERHPYGGDLVFTAFSGSHQDAVNKGLDAMASRVRPGATHVDVS
FT                   WEDLRAETWDVPYLPIDPKDVGRNYEAVIRVNSQSGKGGVAYIMKTDHGIALPRPMQIE
FT                   FSSVVQRVTDARGGEVDSQHMWDIFTHEYLNRTAPIQQISMRVDAAQNETDSAHIAATL
FT                   KFQGKETIVEGRGNGPIAAYANALESLGIDVEVQEYEQHARTAGDDAESAAYILAEVNG
FT                   QRYWGVGIAGSITYASLKAITSAVNRALS"
FT   gene            163296..164234
FT                   /locus_tag="CPFRC_00830"
FT                   /old_locus_tag="cpfrc_00161"
FT   CDS_pept        163296..164234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00830"
FT                   /old_locus_tag="cpfrc_00161"
FT                   /product="RNA polymerase subunit sigma-70"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27954"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241021.1"
FT                   /protein_id="ADK27954.1"
FT                   /translation="MIDARDAQAIDAAKLYYASGLGQAEVAQRLGISRPTVSKLLSYAR
FT                   EKGFVTITLNDPREQGDEIAQRLKERFSLEHVRVVRPVSPDKEELLRELGNAGASLLED
FT                   LVCDGMSVGISWGNTLNNVSEHLRSLPRHDVSVVQLKGGHSLSERSTNDLSTLTRFARA
FT                   FNAEMNLLPLPVILDSREAKDLVVRDRHISCMLSAGANADVVVFTVGSVQRESLLLNLG
FT                   YLSEEEINRLLTHAVGDICSRFYTETGEIADPAIDARTVGISIKDLSSRPTRVLVAGGV
FT                   DKAKAIRVALEMGTTTHLVTDFGAAQAVLGE"
FT   gene            164526..165242
FT                   /gene="deoD"
FT                   /locus_tag="CPFRC_00835"
FT                   /old_locus_tag="cpfrc_00162"
FT   CDS_pept        164526..165242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="CPFRC_00835"
FT                   /old_locus_tag="cpfrc_00162"
FT                   /product="purine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00162"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27955"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241022.1"
FT                   /protein_id="ADK27955.1"
FT                   /translation="MAEKSTPHINPRGVDIADTVLLPGDPRRAKFIAETYLDDVVQFNE
FT                   VRNMLGYTGTYKGTPVSVMGSGMGMPSIGIYSWELINIFGARNVIRVGSIGSLQEDINL
FT                   YDIIVASSASTDSNFLEQYNLPGTYAPTASWKLLKAIVDEADKAGQKVHVGNILSSDIF
FT                   YNADETASARWARMGVMGVEMESAALYSIAAYAGAHALGLFTVSDNIPKGESTTSEERE
FT                   KAFTSMMEIALPLAGI"
FT   gene            165255..166634
FT                   /locus_tag="CPFRC_00840"
FT                   /old_locus_tag="cpfrc_00163"
FT   CDS_pept        165255..166634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00840"
FT                   /old_locus_tag="cpfrc_00163"
FT                   /product="MFS transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00163"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27956"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241023.1"
FT                   /protein_id="ADK27956.1"
FT                   /translation="MPHIKKVDSRNDTQHTGIVNPKAAVPVLLFSFVFCLIVDNGFKTM
FT                   TGPMAAGLGIDPNTASLQASLAGVIIGIGAVVYAALADTISIRKLMLVGIALIAVGSLI
FT                   GFVFSGSWPMVLCGRIIQTAGLAAAETLYVIYVTKHLSEGDQKTYLGFSTAAFQGGLLI
FT                   GALTSGFISTYVSWTAMFLVPLILILAVPFIQKMVPEDETVEGTFDALGLFLVSVFAAS
FT                   LTMYMQKFNPFWLIPTVAGIAGFVAHVKKNKRALVSPEFFSNGRYVWAIVLVFVIYSTQ
FT                   LGFIFLLPFAASDVHGLSQDKAALLMVPGYVCAILVGVFSGAIGKVLSSRQTIYAALTM
FT                   IFLSLVIAALGLRLHIAVLICAIILFASGFALMYAPLVNTALINITAAKSGIAIGFYNL
FT                   TINITIPLGIAYTAKLMDLRFGYSTILWVLAVIALLGAAIYVLADRRMSGAERARGVYV
FT                   A"
FT   gene            166694..167359
FT                   /locus_tag="CPFRC_00845"
FT                   /old_locus_tag="cpfrc_00164"
FT   CDS_pept        166694..167359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00845"
FT                   /old_locus_tag="cpfrc_00164"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00164"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27957"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525229.1"
FT                   /protein_id="ADK27957.1"
FT                   /translation="MSSQLTRSQVAAMIDHTLLNPEAIEADVKELVKEAAKLGTYSICI
FT                   SPSLLPVEVPENVHVATVVGFPSGAVKPEVKANEASRAVHDGAEEIDMVINLALAKEGR
FT                   FEDLQAEIAAVRAAVPAPNVLKVILETAALDDAQIVRACEASEKAGADFVKTSTGFHPA
FT                   GGASVHAVEIMNRTVGGRLGIKASGGIRDAETAKAMIAAGATRLGLSASAAVLDGFDE"
FT   gene            167382..169046
FT                   /locus_tag="CPFRC_00850"
FT                   /old_locus_tag="cpfrc_00165"
FT   CDS_pept        167382..169046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00850"
FT                   /old_locus_tag="cpfrc_00165"
FT                   /product="phospho-sugar mutase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27958"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654987.1"
FT                   /protein_id="ADK27958.1"
FT                   /translation="MTNTVIDRARVWAEHDPNQESREQIEAWIASYDESSLARAFAGPL
FT                   HFGTAGLRAQVGPGESQLNEATILRTTAGLMAWLLEKLGQESVPRVVIGCDARHGSSEF
FT                   YDVAAEVVSAAGGEALVLPKQNPTPLTAYTVKALGADAGIMITASHNPPADNGYKVYLG
FT                   GRIATGDAEGVQLIAPADAEIAVAIASAPFADQIARNRDNIREIDTRERYIERAVGLAG
FT                   AEISAETRGNVRIALTAMHGVGAALGKEILEKAGFEVSLVPEQAEPDADFPTVSFPNPE
FT                   EKGALDLAKAHANAIEADVIIAYDPDADRCAVATKDDNAEGGWRQLSGDETGALLGEYL
FT                   GATATGSYANSVVSGRLLAQVAKAHGLKHAQTLTGFKWIARTPNLAFGYEEAIGYCCDP
FT                   EAVADKDGISASVVVASLVAKLKSEGRTLDCALDDLAKTHGLYMTAPLTFRVEDLSIIA
FT                   EGMKALRTTPPTELAGSKVIEVVDLAEGTLGFGPTDGMMFLTEDDDRVICRPSGTEPKL
FT                   KCYLEVVRPVGEAGVDRQGARDRLAMIAEDVRKVLNM"
FT   gene            169627..171183
FT                   /locus_tag="CPFRC_00855"
FT                   /old_locus_tag="cpfrc_00166"
FT   CDS_pept        169627..171183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00855"
FT                   /old_locus_tag="cpfrc_00166"
FT                   /product="VaFE repeat-containing surface-anchored protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00166"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27959"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241026.1"
FT                   /protein_id="ADK27959.1"
FT                   /translation="MRSKPFKKVVALLTGIDIAFSANTSVQAEEVGPDYLGYLDEAAAV
FT                   KEPFGDGRYQNHSTVPPLVVKATDGGEEELAYCFNITKPYPVFKDSFPSDTSDVFNRGI
FT                   GLRYKGNYGVSLQSFASRWRGEGADAGVLKAVYNGHSHNAAGLKESLGLTEEEFRYATQ
FT                   LAVWYWTDSDSGSKYLIGAGPNSNKIGQAVKILTGQDKSSVQLKEVDPNLVTLVIYKPY
FT                   SLEGEFASYQNLLSVKFVSPKTGDSVNPEDPTKPEPKEPEKPKEPEAPQKEIEPKTPEE
FT                   PTLKTSATDQSDNDKLISATGGKVVDKVTYTGLKEGEKYLVEGELMDKETSESTGIKAE
FT                   ATFTASGANGTVDVIFDIDAAQSGKTLVAFEKLYKAEDKGTVVASHEDINDKAQTVVVE
FT                   KDVPVENEDLFTPEVPDDSSFNWKYLIPFAFIPVVGALIWGSSQGSSSAAAQTNPAYAA
FT                   PVAPAPATVTTTPAPKPAPAAATPVKKQLAATGANVLWTLLVALVLVAAGVFLVRMRRN
FT                   N"
FT   gene            171793..173964
FT                   /locus_tag="CPFRC_00860"
FT                   /old_locus_tag="cpfrc_00167"
FT   CDS_pept        171793..173964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00860"
FT                   /old_locus_tag="cpfrc_00167"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00167"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27960"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241027.1"
FT                   /protein_id="ADK27960.1"
FT                   /translation="MNEVSPFNQPATKRLGRIVSAVVTATSVTFSGFLVPTASAEAASA
FT                   YSDNIGRNEIGPEPLEKLKPEIVGGEQSVSVGDSVTYKYTVKTGFPQDPNNVTAQRWVR
FT                   LVITQDPKVPFTEEPAAGKFGIPAGAVVTKTGVNEWTVVLGAEYEAWQHDATQAAESHN
FT                   NGLFKVNNNMHALWNADAALRASAWNPPAELTIAIPAKVNNADTAPSTGSLTVTSGRLA
FT                   DVALKDDLATATFVSNDGQGSCTWDSVYETKLLKEDIGYWVENVVISSNPESVNDYRLL
FT                   PMAYQDTGRYRPTLTSGKVFVGDKLIGEVKPVTTGDRNASGYPIGELVITENVPPFTSK
FT                   EWLNPKETVRVNYRFTNPCGSKVTAESVKNPSGLVPATDPSATGPGLRLEPDYTYVQAS
FT                   GVYVGLIRPPEDASATAQFVFNQDVVSLGDYVWFDRNADGKQGDATTEPGVAGVQVSLL
FT                   DENGKAFNKPGTSEPYTVITDESGKYLFEKLPKGKYKVQFDASKVPADKLPAGVPSFSD
FT                   FTTKNADNGQNNGTDSDVTPGSLISTTDVVDLQQDRTDIDAGLIAKTRFSVSKVLDGTD
FT                   AGNHIGTTARELQDGKLIVDHKITVKNETPGMPGKAPQVLDQPLSVPGFEVESLTVDGK
FT                   PAQKEEKGYLVSAEKDFTADQERQEYSVKVTYRRTADNAATGALTKAEAEAIGECSDQS
FT                   DTTKGIVNKVYLGNENNEADTDAEKEKNN"
FT   gene            174025..175128
FT                   /locus_tag="CPFRC_00865"
FT                   /old_locus_tag="cpfrc_00168"
FT   CDS_pept        174025..175128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00865"
FT                   /old_locus_tag="cpfrc_00168"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00168"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27961"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241028.1"
FT                   /protein_id="ADK27961.1"
FT                   /translation="MWVDSNNDGIQDADEKGLAGVELQIVDSEGKPVKDINGEEVKNVT
FT                   TAADGKYSFDNLPTLEKGKHYTVKVVAVPTGYEPTKTGQGTEDNDSSKDSAETYKDLSE
FT                   NGAKDDSLDFGFVETKPEAPGSVSVGDFVWVDANENGIQDEDEEGLDGVTLKIVGPDGA
FT                   PVTDVNGNPVKDVTTRADGKYTFSDLPVLEDGQKYTVKLVEVPEGYDPTKTGQGTTETD
FT                   SSTDQAETVLDLTKPGAEDNSLDFGFIKIQELEIPDPFNEEDSSFNWKYLIPLALIPVI
FT                   GALAWGSSQGSSSPSAPAAPAPGAPKESGSATSPATAAPQSPATTAPKAPMKKQLAATG
FT                   ASVLYTLLIALLLVVAGVFLVRLRRRD"
FT   gene            175385..176476
FT                   /locus_tag="CPFRC_00870"
FT                   /old_locus_tag="cpfrc_00169"
FT   CDS_pept        175385..176476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00870"
FT                   /old_locus_tag="cpfrc_00169"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00169"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27962"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522991.1"
FT                   /protein_id="ADK27962.1"
FT                   /translation="MVIWQDWVAAAVLFIVSALVRLTFLLWMRGDASLESLISKWDGRI
FT                   YLAIAKYGYFSDVGGAPDPEVYQTRLAFFPGYPGLIAAVHSVTRLNYVTSALVISYAAG
FT                   IVMTAGVMAMAARMGANRRLRLCAAMLVLGAPMSTTFTMVYTESVFLACAVWALVAMTD
FT                   KRWLLAGAFTFCAGFFRLTAVDLVAAFAVVVAVYAARNWRAWAAVAVSMLPLVSYLFYA
FT                   SSYTRDIGGYFGLQTKGWHSTFDFGRATVIWVSTQLREGNNVGYLLSIASIVGAMGAVI
FT                   VSFRRLPLSYWLFGAAVTANVVLSDGIMHSRPRLLLPAVVLLIPVIFQFSQRRYALPAV
FT                   ATCWLLFGAWFSAYMIAVFEWAI"
FT   gene            complement(176477..177322)
FT                   /locus_tag="CPFRC_00875"
FT                   /old_locus_tag="cpfrc_00170"
FT   CDS_pept        complement(176477..177322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00875"
FT                   /old_locus_tag="cpfrc_00170"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27963"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014654989.1"
FT                   /protein_id="ADK27963.1"
FT                   /translation="MYSTLLAMGFALASALTIAWGTVVRHRIAEEAPAEGSPFLQAIRR
FT                   PAWWLGIFTALSGYGLQIAALGFGTLLVVQPILVLSLMFTLPLSAHYDGRRMAFDEITW
FT                   AGLLTVSVAVLVLLGNPSAGDPQPPLGHWLPALGIGFLVLFALERYAQKQIRNEKALLL
FT                   GIVTGGIYGYVAVLSKATVDVLTHGGFFALATTWQGYSLAAGAILGTVVQQYAFNAGAL
FT                   KNSLPAMTVTEPIVAFALGYAVLGEQFQVAGSNWLWMALALVAMILSTFALSRRGVGSA
FT                   "
FT   gene            177627..178892
FT                   /locus_tag="CPFRC_00880"
FT                   /old_locus_tag="cpfrc_00171"
FT   CDS_pept        177627..178892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00880"
FT                   /old_locus_tag="cpfrc_00171"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27964"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835808.1"
FT                   /protein_id="ADK27964.2"
FT                   /translation="MALVVQKYGGSSLESAERIRRVAERIVATKKQGNDVVVVCSAMGD
FT                   TTDELLDLAAQVNPVPPAREMDMLLTAGERISNALVAMAIESFGAKAQSFTGSQAGVIT
FT                   TERHGNARIVDVTPGRVREALNEGKICLVAGFQGVNRESKDVTTLGRGGSDTTAVALAA
FT                   ALNADVCEIYSDVDGVYTADPRIVSNACKLDQLCFEEMLELAANGSKILVLRSVEYARA
FT                   FGVPLRVRSSYSNDPGTLVAGSMEDIPVEEAVLSGVATDNSEAKITVLGIPDSPGAASV
FT                   VFRALADAEINIDTVLQNISSLEDNRTDITFTCPRADGPHAMELLHNLQSKNDWQNVLY
FT                   DDQIGKVSLVGAGMKSHPGVTAEFCEALRDQGINIELITTSEIRISVLIRETDLPAAAR
FT                   ALHEKFELGGDEEARVYAGTGR"
FT   gene            179176..182478
FT                   /locus_tag="CPFRC_00885"
FT                   /old_locus_tag="cpfrc_00172"
FT   CDS_pept        179176..182478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00885"
FT                   /old_locus_tag="cpfrc_00172"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00172"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27965"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400926.1"
FT                   /protein_id="ADK27965.2"
FT                   /translation="MLITCLNRMNPSIRKVFRCLVKNKVESKNVQLALRERSLIRILIA
FT                   LVMVGVVCAGLMVSPSVPSADAAECKGEISNIQWKDTTHIKDGVFVGSYGDGADIQFDW
FT                   KVDPGAKSGDQFTLKLPNELMRLGIKDLTLTAPTGEEVAKGTWDATTKTWTFTLTDYAN
FT                   THGDISGTAFFTVQWDRRHTTANTTYPLNISGCRGNGILNGKTPEEGIGGVGQVSGKVG
FT                   GYDSRTDTVRWNIYVGTATDSDVYSPVVIKDIGNPQLLVRCSDVKVKDRTPFPHTAIRD
FT                   TPLDSSKWTCEESNGGVIVRLVPDQHGRYLMRGQSLLIELETAITDDTSRIITNKATIE
FT                   NAPDGTKEVVAEVDRGDAGGVGQGFQGNVKIEKEAVGDTAPDKSHKFEFDYTCGNTKQP
FT                   ISVASGETSNTFTQKSSSTCTITEKNVPEGVKVKFEVIDEGTGKPAYTVPTNNGITVKF
FT                   NRNSSTTLKIKATNTYPDKPKVKNGKFVIKKTTNGLDAGEKDKVFKFNYTCKAPGADAV
FT                   SEKKIADVTVGQTWESGEYPEGTTCAIEEDLESAKVSNYTLTSEQPKGNVTIKADGGEG
FT                   SPVEFAATNSYSKDLGGFSIQKKIEADPEALPLLKDQEFGFKYTCGADSGEFKLKNGES
FT                   KKVEGIAVGTKCTVEESDAKVPNGFTWSGKIEGTNLDPNDFTIEKDKSLTFTAVNTYQQ
FT                   KQGGFTLSKNVTGDATNLEELQAKTYTFNYTCTAPTGVVFTDKVEVTEGTPKSINNIPA
FT                   GSTCKVTEVAAPAKDTEWTVELSVNEKAVAGDTAEFVVPAEDEPSVSILAKNNYRQHKG
FT                   TFTIEKIVKASEGIVTPNEFVFKWQCGDAEGSETVQVANGKGKVKIDRGFPVGTSCSVE
FT                   ELDANVKGATLATEWKNQKFTITQDNQDVMVSAENIYAHADSKVKIVKKLDGPAKDKAK
FT                   DKTFTFDYSCVLNNETIKGTVNITGEGEAEIPESFPAGTKCTITEKDAHIRGTSWTHRI
FT                   ADDGQITIKNPSNVYEVTAVNAYSKPDFPWFIPLVPIVIIPIIPIFPHPTPAPQPPQKP
FT                   SDQQPAPKTPEEKPQKEKKVLARTGANVWMFIVIAALLVLLGVFLRRRGNKQ"
FT   gene            182733..183764
FT                   /locus_tag="CPFRC_00890"
FT                   /old_locus_tag="cpfrc_00173"
FT   CDS_pept        182733..183764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00890"
FT                   /old_locus_tag="cpfrc_00173"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00173"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27966"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910626.1"
FT                   /protein_id="ADK27966.1"
FT                   /translation="MTTVAVVGATGQVGRVMRSILEERKFPADKVRFFASARSAGTTLQ
FT                   FNGEDIEVEDLAAQTEDSLKGIDVALFSAGGSTSKQYAPLFAAAGATVVDNSSAWRKDP
FT                   DVPLIVSEVNPEDKNNLVKGIIANPNCTTMAIMPVLKALHDVASVTKMHVASYQAVSGS
FT                   GLAGVETLAKQTAEIGDRCVELVHDGSVEAPEELGPYVAPIAYNALPFAGNLVEDGLNE
FT                   TDEEQKLRNESRKILGLPELKVAGTCVRIPVFTGHTMVVHAEFEKAITPDQARAVLADA
FT                   PGVEVVDVPTPLAAAGRDDSLVGRIRQDQTVDNNKGLVFVVSGDNLRKGAALNAIQIAE
FT                   LLV"
FT   gene            complement(183833..184396)
FT                   /locus_tag="CPFRC_00895"
FT                   /old_locus_tag="cpfrc_00174"
FT   CDS_pept        complement(183833..184396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00895"
FT                   /old_locus_tag="cpfrc_00174"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00174"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27967"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910627.1"
FT                   /protein_id="ADK27967.1"
FT                   /translation="MKNSERDDRVTQLALAAGRGDKTALTEFIRETQNDVWRLLAHLGG
FT                   SEIADDLTQETYLRVMGALPRFAARSSARTWLLSLARRVWVDNIRHDMARPRKSSAEVE
FT                   DLDPAVLSTNGETTWSDWIDVRLLIDALPTERREALILTQVLGYSYEEAAKIANVRIGT
FT                   IRSRVARARADVIAAAGRPNAASA"
FT   gene            184539..186077
FT                   /locus_tag="CPFRC_00900"
FT                   /old_locus_tag="cpfrc_00175"
FT   CDS_pept        184539..186077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00900"
FT                   /old_locus_tag="cpfrc_00175"
FT                   /product="catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27968"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522995.1"
FT                   /protein_id="ADK27968.1"
FT                   /translation="MNSPVDPILGAGERTEPVAYTTREGGQPVPSENISITAGPQGANV
FT                   LNDLHLIEKLAHFNRERVPERNPHAKGHGAFGELHITEDVSAYTKAKLFQKGTVTPMAI
FT                   RFSTVAGEQGSPDTWRDVHGFALRFWTQDGNYDIVGNNTPTFFLRDAIKFPDFIHSQKR
FT                   LGRNGLRDADMQWDFWTRTPESAHQVTYLMGDRGTPKTSRHQDGFGSHTFQWINEEGKP
FT                   VWVKYHFKSRQGWDTFTDAEAQEMAGKNADHHREDLYNAIAHGDFPIWDVKVQIMPFED
FT                   AENYRWNPFDLTKTWSQKDYPLVDVGYFVLNRNPKNFFTQIEQLALDPSNLVPGVGLSP
FT                   DRMLMARAFAYADAQRTRIGANYRQLPINQPVVPVNTYEHEGAMAYQFNPADAPVYSPN
FT                   RYSKGAGYLDDGETSSSGITYGQASDLFVNPDPHGTDLTRAAYVKHAEDDDFIQAGILY
FT                   REVFDDGEKERFVDNVTNAMAGISPEVEERVYWYWTQVDANLGAEIKRVFATKK"
FT   gene            186685..187446
FT                   /locus_tag="CPFRC_00905"
FT                   /old_locus_tag="cpfrc_00176"
FT   CDS_pept        186685..187446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00905"
FT                   /old_locus_tag="cpfrc_00176"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00176"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27969"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300409.1"
FT                   /protein_id="ADK27969.2"
FT                   /translation="MLSLHCSVQNSEFIKWELVILEFKEDIFPEHKDKIGGLVQFVNLP
FT                   YESAVEYAWDQLNVNQGTTRKFPSRYDLTVKSGDFVNAIPQGGRVFITVETENPRWIAV
FT                   MGVNELADSAIAFLPRNRAFGGLIFPIVKNSEVVSVSQASDYNSCSFDYSKLDYPWGGY
FT                   FGEGDFYINPARLSIFCENVEGWHFERSSNDERGENDVIFDFEEPEFYSRRLKKERFNP
FT                   DMMLRYLDRLDIRLRDLNFYSGRMTILQRAD"
FT   gene            187449..187655
FT                   /locus_tag="CPFRC_00910"
FT   CDS_pept        187449..187655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00910"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400929.1"
FT                   /protein_id="QGW57309.1"
FT                   /translation="MSIVDMRKTQPLDSQIYYINMSFDQLMGYVREYIDGLDDQFPATL
FT                   FEVGRGDVRNGYIYSAAGNTGMS"
FT   gene            187664..188344
FT                   /locus_tag="CPFRC_00915"
FT   CDS_pept        187664..188344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00915"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300411.1"
FT                   /protein_id="QGW57310.1"
FT                   /translation="MANPDWVAIIDPYIDHTMSYFSEVNRPNYVLLGAGSTMYSSIEKI
FT                   SDADGFGMPQTFSVIACAIFLKDPFFPAHGRLRPTFLSCSWGPHVEAGWLSVEQSRFYD
FT                   DVRRSLWASNELGTQGLTKFAVNLWPEKEKTFGRKTYNHLDLDWNGWGPDPTFRPDPQR
FT                   PVYEWFNHRVVDGWGKNLGLEVFDTKFHVGRQAIFKKCSVKIIHISMHHCCMKIFARLK
FT                   NVRK"
FT   gene            188412..189035
FT                   /locus_tag="CPFRC_00920"
FT                   /old_locus_tag="cpfrc_00177"
FT   CDS_pept        188412..189035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00920"
FT                   /old_locus_tag="cpfrc_00177"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00177"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27970"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525242.1"
FT                   /protein_id="ADK27970.2"
FT                   /translation="MAKWNNGSIGIDVCADQELFVPTAASLSSAPGHVTISDSAAESLE
FT                   DQIVEGDMAEIVEVIDSFAACSVAEAAQSFGLPESGYFEAVRPGSHARYPAAEETDSEL
FT                   ADLAGISVEIGGFSWSAVLFTRWEGCVNVALPWELARMLYFWNKRWGMELVALSEDTEA
FT                   TMLVHVSEPGKNREEIVATLAAAGDELVVIPGSHGSLILKVWWD"
FT   gene            189035..189979
FT                   /locus_tag="CPFRC_00925"
FT                   /old_locus_tag="cpfrc_00178"
FT   CDS_pept        189035..189979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00925"
FT                   /old_locus_tag="cpfrc_00178"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00178"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27971"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799920.1"
FT                   /protein_id="ADK27971.2"
FT                   /translation="MGFFGFGKKKQQQPQTPVIRMALMALGYSTDIAPDGNGGEVNVVT
FT                   LGDLTVYFWNDPSLYHAQIEWPLTFGQEDTMHAVVGAHMLNVNSSTGVFRVDTSKGHTA
FT                   VVCRTWLRAEDGATFDQYLRFVQAALQDVLPEASALYDDMFGTNFEVPEPPEQHPLFAE
FT                   IPAHLDTPKFETPEVTADRIAALYSGTVSENTAHMTVKGREFVAEVHTAETPTGSARVL
FT                   EISSFKDLPASGPNDIAALINATAQFNDSMDLICAVLDEEGQKVASENLGQPAARMVIR
FT                   ARCDATVGLSDSQLKGYVDEAMHTIAGLLKAIN"
FT   gene            complement(190033..191085)
FT                   /locus_tag="CPFRC_00930"
FT                   /old_locus_tag="cpfrc_00179"
FT   CDS_pept        complement(190033..191085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00930"
FT                   /old_locus_tag="cpfrc_00179"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00179"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27972"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522998.1"
FT                   /protein_id="ADK27972.1"
FT                   /translation="MALVHIQNLSVTSRGTQLLNNVSLDADPGELIVILGRSGAGKSTL
FT                   LRALAGLIPATGVVEVDGESLSGLPPHQRPIAMMMDQPSLFPHMTVEDNIRFAGDSGTH
FT                   VAMLSLGIDHLALRYPHQLSTGQQQKVALARALIKQPTLMSFDEPLAHVDTYSSEQLKS
FT                   QILRTHRRLGCTTFYVTHDINEAFSIADRIIFLSRGEIIQDASPQDMREQPACLDIARH
FT                   LGASIFVPTTGAVTYSPFGTATAAVTALGANLMIDAHPDLHSDDAMVVVGYPTSATATP
FT                   TGHQARHLMGATGQVIRNIYMGDHHEVAIETSQGRIVLHCSPDNELAFAAIGDEVLIHC
FT                   DLEKMWVLPA"
FT   gene            complement(191076..192629)
FT                   /locus_tag="CPFRC_00935"
FT                   /old_locus_tag="cpfrc_00180"
FT   CDS_pept        complement(191076..192629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00935"
FT                   /old_locus_tag="cpfrc_00180"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27973"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_003850390.1"
FT                   /protein_id="ADK27973.1"
FT                   /translation="MRTGLWIFSVAVIAAVAVGIPYAMLFSTADMGVVAVHSIALSSSI
FT                   ALCTTILALCIGTLGALAAAQFSRASVVLLDVILLFQLTIPHFVIGADWKTIVGRTGIQ
FT                   LCSQCNFSGLMPLLFTFTMAFTPLVYFGQRTALRSVSPREVDAARVAGLHGWALFRTVY
FT                   QPRLVLFAPALGAFIFSAALSDPVTPNVMAPRASLAATRVWFQSDQAWTALALTLPVAL
FT                   AVVVAGLTYMRLLRGNPALVELLHRTIDTPGQPHHAVGAQVRAPQMVLRLLGAVAGLFV
FT                   VVAAYRGFVHGSETPMGNAVVNTVGLAFLVLLCSLLLSAVALGARRSCGLRWGRLGHRS
FT                   IDAVFALLALLPGAAIGCGLRITAHHPGVHGPWASLSLVLLACLPTSLAMTYFLMVYIG
FT                   PLMSRSEYMVSLLQGVSPLRAVASIVLPRSTNVVILGFLMVFSNASVLAMPLLWVGSPD
FT                   TPLLMLRLFTLLDAANYPAALYISMTVSLFIVSLAGAIVVSINGVGLGAFARKQVTPWR
FT                   "
FT   gene            complement(192649..193650)
FT                   /locus_tag="CPFRC_00940"
FT                   /old_locus_tag="cpfrc_00181"
FT   CDS_pept        complement(192649..193650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00940"
FT                   /old_locus_tag="cpfrc_00181"
FT                   /product="extracellular solute-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27974"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523769.1"
FT                   /protein_id="ADK27974.1"
FT                   /translation="MLSRWLRLLAVCVVAIVSAVTVYRTLFPTKTAVTIMCSNDVTVCE
FT                   QWKHDIAHELGLKVRYVSLPTQEALKRLQTGSHEFDVWVGGPSENYRLAARLGLLQAAD
FT                   LPAADAIPAQFKDPQNRWFGVYASVLSVCSDRDALDRLGVPVPRSWADVMRPELRGWVS
FT                   APSPVSSGTGYAMLLSMQAAGLSQEQIARIVDNVDRFTRSGNAPSDVVAHGEAAVAISY
FT                   EPYCQNKTTRLGRDMEISYPAEGTSFEIASGGVVVQRHTKSAAYEVMNWLLSPSGQTSA
FT                   LRAGLPQIPTNNLVADNISTRLKDSHGIVAVDPTVADSEREQWMSWFSERRI"
FT   gene            complement(193730..195100)
FT                   /locus_tag="CPFRC_00945"
FT                   /old_locus_tag="cpfrc_00182"
FT   CDS_pept        complement(193730..195100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00945"
FT                   /old_locus_tag="cpfrc_00182"
FT                   /product="MFS transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00182"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27975"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_003850393.1"
FT                   /protein_id="ADK27975.1"
FT                   /translation="MFAWLQAPGPAAPLPAEQADRIYPRMRLQVFMGIFLGYAGFYLIR
FT                   NNISAIAPLLIDESGAIDKPAIGIIGNAVLVSYGLSKFFSAMVSDRSNARYFLPLGLAL
FT                   SALMNLIVAFAPWVSASVGLFATVMFLNGWFQGMGYPPCGRIVVQWFSTSERGWKGSLW
FT                   NTSHNLGAFGLPILVGIGLSITGQNWRAAYWLPALVALLVAVVAFFLIRDNPQSVGLPP
FT                   IDDYRNDPAKVAEDTGEKISTKDLVFKHILHNRIIMLLAIANVFVYALRYGVLHWITTY
FT                   LSEQHHMSIGSGLIGFAAFELAGFIGTVLCGWLSDNMFKGNRSAAISLFTLGAGLSIAA
FT                   YWLAPVGTPFWLMVIFVALIGGFIYGPMGLIGLQALDLSPRNVAGTAAGFTGLFGYLLG
FT                   ATLASTGVGFLVKFAGWNVTFIVFLVFTVLILVIFQVIWREEKKLVHDRALQLEQGV"
FT   gene            complement(195229..195930)
FT                   /locus_tag="CPFRC_00950"
FT                   /old_locus_tag="cpfrc_00183"
FT   CDS_pept        complement(195229..195930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00950"
FT                   /old_locus_tag="cpfrc_00183"
FT                   /product="response regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00183"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27976"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_003850395.1"
FT                   /protein_id="ADK27976.1"
FT                   /translation="MHRRRVLVVDDEPQMVQIISYALELEGWEVLSAASAQKGWQLLGE
FT                   YRCDLVILDVMLPDASGYALCERIRASGDVAATPVIMLTALGDTDNRVEGLEAGADDYV
FT                   AKPFSPKELVLRAQAVVRRSGGIVQQESQEIVVGKVSVNPITHAVAIDGRKVDTTATEG
FT                   KLLQALVSHPNEVVSVKRLLNQVWDTTATQGGRNMVKSTTYRLRKKLENAGLPADSILS
FT                   VRGQGYIFHHK"
FT   gene            complement(195923..196708)
FT                   /locus_tag="CPFRC_00955"
FT                   /old_locus_tag="cpfrc_00184"
FT   CDS_pept        complement(195923..196708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00955"
FT                   /old_locus_tag="cpfrc_00184"
FT                   /product="sensor histidine kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00184"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27977"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241044.1"
FT                   /protein_id="ADK27977.1"
FT                   /translation="MFAALVLTACASACVASLVTAVVIRRRARGHTAAITDEQILAHEI
FT                   RTPLSLIKGAAELLGQETDPRKCERLAATIGANSTRAIEVAESFLLQTKLNSGSLTLQV
FT                   SQCDVRGLVRSTAQELRAMSEVPIVVDDPGDPLMIDGDPQLLRHALWNVLNNAARYAGS
FT                   DSDIVVGVEESSTGVIVTVADYGPGMTARQRQNMFVPFAQFGQEQSQGQGPVGVPSGAG
FT                   LGMAITQKIVQLHRGSVLVDSIADHGTSVLITLPKNYHA"
FT   gene            complement(196830..197138)
FT                   /locus_tag="CPFRC_00960"
FT                   /old_locus_tag="cpfrc_00185"
FT   CDS_pept        complement(196830..197138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00960"
FT                   /old_locus_tag="cpfrc_00185"
FT                   /product="Na+/H+ antiporter subunit G"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27978"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241045.1"
FT                   /protein_id="ADK27978.1"
FT                   /translation="MFYDLTASALILIASFLIITTLIALLRAPDALTRANLMGTATSIA
FT                   LPLILIASLINDIGNGTFWWGNLIRVIITIAGLLIVLAIGSFLMGRALYGVAKEQQD"
FT   gene            complement(197138..197404)
FT                   /locus_tag="CPFRC_00965"
FT                   /old_locus_tag="cpfrc_00186"
FT   CDS_pept        complement(197138..197404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00965"
FT                   /old_locus_tag="cpfrc_00186"
FT                   /product="cation:proton antiporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00186"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27979"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241046.1"
FT                   /protein_id="ADK27979.1"
FT                   /translation="MFLIASSIGMAATTIGIIATIILMIRTKDQLTRAVISDMVFYSMI
FT                   GFYIIWCMANHTQINYEIALLAALVGGILPTMSVARIISKGRR"
FT   gene            complement(197404..197823)
FT                   /locus_tag="CPFRC_00970"
FT                   /old_locus_tag="cpfrc_00187"
FT   CDS_pept        complement(197404..197823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00970"
FT                   /old_locus_tag="cpfrc_00187"
FT                   /product="monovalent cation/H+ antiporter subunit E"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00187"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27980"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525246.1"
FT                   /protein_id="ADK27980.1"
FT                   /translation="MLHAIKYAFWLVGQVLIAGWVLTKDTLTGSKNLDPCVVRYPLRVT
FT                   KDWQITVFAASITATPGTMSITLEEDDSAESSDQRYLLVHAVAGADPRSVLADLAHMEE
FT                   TLAPHVKDLHPDFSAVLDRATWEYPSPKPVFKEDN"
FT   gene            complement(197823..199361)
FT                   /locus_tag="CPFRC_00975"
FT                   /old_locus_tag="cpfrc_00188"
FT   CDS_pept        complement(197823..199361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00975"
FT                   /old_locus_tag="cpfrc_00188"
FT                   /product="monovalent cation/H+ antiporter subunit D family
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00188"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27981"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835829.1"
FT                   /protein_id="ADK27981.1"
FT                   /translation="MDYVLPLFVGIPLALVAVSAIAPWRVLRDILALITPIGTGAAGVW
FT                   LFAYVSEHGTIAHSVGKYVGGVAIPFVGDHFSAIMIITCSVVAFASNWFAIVVGETRSR
FT                   FYSSLSLMLLTGVMGALLTADLFNFFVFIEVMLLPSYGLMAMTGTWARLSAGRTFVLVN
FT                   LATSTLLLIGVAIVYGVVGAVNIAALAGAAAGNGPVTVAMGIVVVAMVIKAGIFPVHTW
FT                   LPRSYPATSSSVMGLFSSMHTKVAVYMLMRIYVVIFDLDTRWVWLIITICILSMIVGAF
FT                   SGLGEGAMRRVLAYQMVNGMPMILVVLAFASHNAKTVIAAGILYALHHMITVGSLILTS
FT                   GSVEETYGTDKMSKLSGIAHRDPWVAAVFAAGAFSVVGFPPFSGLWGKVFLILGIADSA
FT                   SWQAWLVIAIIILASFGAFLSMLRLWREVYWGAPMNPQRIPESLRVPWLRLAPGAFLIV
FT                   ISFGMFLFAGPLVTATNDASESLLDVHSYSTAVLHQGEDAPVGVATNNTLQGGR"
FT   gene            complement(199361..199816)
FT                   /locus_tag="CPFRC_00980"
FT                   /old_locus_tag="cpfrc_00189"
FT   CDS_pept        complement(199361..199816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00980"
FT                   /old_locus_tag="cpfrc_00189"
FT                   /product="cation:proton antiporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00189"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27982"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241049.1"
FT                   /protein_id="ADK27982.1"
FT                   /translation="MILALTIAILAAGGVYLVLQRGMLRIVIGMTLISHAANLLIVAIG
FT                   IPAWRGEPFPSITDLSVAADPVPQAFVLTAIVIAMATTTYMLTLSGLGRSDDTEPEEVA
FT                   DEDSPLQTLGRSTTNAELAEDEAHLVRERARRAHQHHADNDINKEAH"
FT   gene            complement(199817..202807)
FT                   /locus_tag="CPFRC_00985"
FT                   /old_locus_tag="cpfrc_00190"
FT   CDS_pept        complement(199817..202807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00985"
FT                   /old_locus_tag="cpfrc_00190"
FT                   /product="DUF4040 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27983"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241050.1"
FT                   /protein_id="ADK27983.1"
FT                   /translation="MTLLLVLVLAAFTVSCAPVAVRVCERKAGWPLAALLLIAAGLLCK
FT                   ELPAVLDETPIVWTYTWIPDALGHGIDIQLALRADALSVFFALLALVIGSIVFIYSASY
FT                   LPKKTGNTSFYTLMTAFMAAILMLVLADDVFTLFIAWELVSLASFMLIARSGGSGGELG
FT                   SQRTLILTFIGGLTLLVSMAIAATQAGTTNIHEILVSDFWAEKPALTTVLGVLVAVSAF
FT                   TKSAQFPFHFWLPEAMAAATPVSAFLHAAAVVKAGIYVLMRFSAVFHNNQTWNLLLITV
FT                   GMLTAVMAAFFAIQKTDLKKLTAYSTVSHLGWIVATIGVGTPFALAAALVHTLAHALFK
FT                   SSLFMLIGVIDHQTGTRDASRLGSSWRQLPFTFGSVILAASSMAAVPPMLGFVSKEGLL
FT                   AALAEAPLGKAGIVVLLLTAGIGALFTFTYSVRIVADGFIDGDRDMSHVKEAPVSLWLP
FT                   AALPGALSLPLAFALGYLNLPISEAVDVVAEDPHTHLALWHGLSLVFIISLVVFVLGIV
FT                   GVVFRKQIWMALGSRPLFPTSGNDVLRLMHQGSSSLGRAMGAMADSIAPTRHLAYMFLT
FT                   IIIFGAFYVLPGLVGGGVDGIPAPARISTDRWYDAIPLAIVLLGVIALVRTKKRLSGVV
FT                   LIGVVGAGVTLQVFMLGAPDVAMTQFMVEALTVVIMMMVVRQQPSHFHKPRKSQKALGI
FT                   AMATGVGLFAFLSVWVLLSRHERSELALWYLNEAPKISGGDNVVNTILVEFRGFDTLGE
FT                   LSVLGMAAIVIAAVITSMPRYPFAKGTHPAPFSGSDLNSIPLRILLKVLVPVLIVLSVM
FT                   IFWRGHNAPGGGFIAALVASTAMMLSYLSFPRDKHIFPVRTPIYLTGIGILTAIFAGFL
FT                   GLSHGSFLYAIHGHWAGQHWTTSMIFDVGVYLAVLGMVSMAINALGGYLRPGLDYENLN
FT                   YNREDSPLTPLPKVGHLDDFGGEPHLPPSEPERVRLAKQAERASKALREDNDRHLNAAS
FT                   STAEEEK"
FT   gene            202992..204425
FT                   /locus_tag="CPFRC_00990"
FT                   /old_locus_tag="cpfrc_00191"
FT   CDS_pept        202992..204425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00990"
FT                   /old_locus_tag="cpfrc_00191"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27984"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558559.1"
FT                   /protein_id="ADK27984.1"
FT                   /translation="MSRFAVRHLSAAILLAAPLIAGTVYAVSTDYDLASSWSTGEESAG
FT                   APAVHDDAALVDARRAAGEAGAQAGLLKGGTKQLADGTHKLAEGSKQLGAGTTSARDGA
FT                   AKLADGMNQLQAATGQLGNGATEIANGVDHAVGQLFALEAVRGQILGAIDRTIGDIAKS
FT                   KDPKAAEFKPELEEFRNQVDTFQVDKSITDQLTKLRDGSRELANQLHVPGYGFHDGIYS
FT                   ATKGSKELSAGLNELAAGVDEALKGVEQLDQGAQKVDGMAKTNQDRVGAVSRALPVIQA
FT                   GTPEAKEAGITKTLAPMYAFLVAAGVMLAAGTYGRGRAWVVSLVGGIALAALGGSLVAI
FT                   LGSELGAAEAAAAAGICALLVLASGLGTAVLIRAFGATWGYLAALVGIIAQVGVVGWVW
FT                   NSAATAQIGTTAQALVNLMPLNYPTLALSSLGNGTHSPALWVAIVVTAGLAAVGAAALK
FT                   LLGKREPSGAHATPEDIIR"
FT   gene            complement(204422..205828)
FT                   /locus_tag="CPFRC_00995"
FT                   /old_locus_tag="cpfrc_00192"
FT   CDS_pept        complement(204422..205828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_00995"
FT                   /old_locus_tag="cpfrc_00192"
FT                   /product="DUF4185 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00192"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27985"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799932.1"
FT                   /protein_id="ADK27985.1"
FT                   /translation="MRMTRRKALTVATLVTLSSFTSVSTGHAIDFGNIMRLPSALSSAL
FT                   SSGSSGSSAPDAKPAPQRPNRISEGLTVTMLDDLFGRGKSDKVGILSGDLGEMVRLAKD
FT                   GKEFAIIFGDSFTGEGLQGEWKSPIGLVAKLGEDGKIQIVRPLNEGEKAEQLIKYEHKD
FT                   RLTLLPSDVINIDGTIYMQAMWHQGLGNVIKTQIWKSTDQGKTWSSVNEIPASYMNEFG
FT                   SLLSWENGDDGYVYMVSSKFGRAHSVYLTRFRPEQIGDEQQWEHYNPTANTWSKHVDGA
FT                   HLTPILSNSVKAGEMSLRRIEGHWVLSMFNEETWAIEVRISEKLDQSWDKIKPANVVVA
FT                   GTGGWGAKQNENNFTQLYGGYITPFSTLADMNIVVSQWNTSNNSRYNSTQFNVKGLDKF
FT                   FNITPKPADAQPTPRAVTADQTADQSVIEVSEVAPADSDKAATPEQEIIESVAPVEVLP
FT                   LTGALDSQKN"
FT   gene            complement(206223..207050)
FT                   /locus_tag="CPFRC_01000"
FT                   /old_locus_tag="cpfrc_00193"
FT   CDS_pept        complement(206223..207050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01000"
FT                   /old_locus_tag="cpfrc_00193"
FT                   /product="ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00193"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27986"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525252.1"
FT                   /protein_id="ADK27986.1"
FT                   /translation="MIIANDSFRYSLVFLVAQREALLSVRSKSVSIVFAVVALGAIALV
FT                   GFSSKQVVNSGKDFNPHDVSVVVGLFMLVALSMSIMMSSPLLGASMVDEKDNKVVEILL
FT                   SSIRADELYLGKVFGHVIIGLFQLTALWGITAVSSILFGLSDFASFPWSRTFIVLLFMF
FT                   PGYLVFTALFGMAGALVSRNEDYLAAQLPILILFFVTLFVPFLPLIKIGSFESGWLPAV
FT                   SWIPPLSMVATPVREIYIGEPNWVVVISWILLLVLSAFLFFLGALTFKKNILK"
FT   gene            complement(207054..207968)
FT                   /locus_tag="CPFRC_01005"
FT                   /old_locus_tag="cpfrc_00194"
FT   CDS_pept        complement(207054..207968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01005"
FT                   /old_locus_tag="cpfrc_00194"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00194"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27987"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835835.1"
FT                   /protein_id="ADK27987.1"
FT                   /translation="MLKFDNVQKSFGSKQVLKGVNFSVDRGEIVGLLASNGGGKTTSMR
FT                   IALGLMKPDIGEVLVAGQKIAPDSVRGVGYMPEERGLYSDETVVNQLRYFARLHRIPKE
FT                   KMKPRIKELLDKLEVSQFADSKVKELSLGNKQRIQIASALIHSPELLVLDEPFSGLDPL
FT                   AVDRFQYLLREYAASGAAILFSSHQIEIVEKISDRVVIMKDGIVSYDGTASGISSPEDK
FT                   VLVHVSLNLSKGRKIEDITFDNNERIESAQAVIDGVKLILKSGEISVGELMQCGLKPEE
FT                   IREMRYEKNSLLDTLSSIYGKDT"
FT   gene            complement(208702..209181)
FT                   /locus_tag="CPFRC_01010"
FT   CDS_pept        complement(208702..209181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01010"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522095.1"
FT                   /protein_id="QGW57311.1"
FT                   /translation="MGSRLSISFPWYTPAGSLYTCKSAPVRKRTDTLNRCEITPKGLFH
FT                   ADLCALTSSNHQKQTHFCCLTRNIATQSLLETKAKASGLRLTGALHIRPKYPPVSTIQD
FT                   DGKASQKHRNTPANTSHDIPYSNTIVLCMDLPISLHCAAASTKLGAPWSSRNHAG"
FT   gene            complement(209090..210345)
FT                   /pseudo
FT                   /locus_tag="CPFRC_01015"
FT   CDS_pept        complement(209090..210345)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01015"
FT                   /product="IS256 family transposase"
FT                   /note="frameshifted; internal stop; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_006680457.1"
FT   gene            complement(210562..210638)
FT                   /locus_tag="CPFRC_01020"
FT                   /old_locus_tag="cpfrc_t011"
FT   tRNA            complement(210562..210638)
FT                   /locus_tag="CPFRC_01020"
FT                   /old_locus_tag="cpfrc_t011"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:210602..210604,aa:Pro,seq:cgg)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            complement(210695..211633)
FT                   /locus_tag="CPFRC_01025"
FT                   /old_locus_tag="cpfrc_00198"
FT   CDS_pept        complement(210695..211633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01025"
FT                   /old_locus_tag="cpfrc_00198"
FT                   /product="metallophosphoesterase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00198"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27991"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799933.1"
FT                   /protein_id="ADK27991.2"
FT                   /translation="MVVKPTRRYAIRVASLTKTLLTATGVLGLTGFSALAWAYRECSNF
FT                   ELKIVELPILEPGVLRNADEFRILHLSDLHMTPNQVKKQEWVAQLDRLSPDLVINTGDN
FT                   LSDPKGVPGVLRALGPLLRRPGLFVFGTNDYFAPSMVNPFLYLFGKKRKPSEVPLPWKG
FT                   MRAAFIEHGWRDANQARHEFQINHVRIAVGGVDDPHHDLDDYEEIAGPPNPDADLSIAL
FT                   LHAPEPRVLERFERDGYMLSLSGHTHGGQVCLPGSRALVTNCGIDTRRVQGLHTFGKMW
FT                   MHVSNGLGTSKFAPIRLFCRPSATLIRVTER"
FT   gene            211632..212093
FT                   /locus_tag="CPFRC_01030"
FT                   /old_locus_tag="cpfrc_00199"
FT   CDS_pept        211632..212093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01030"
FT                   /old_locus_tag="cpfrc_00199"
FT                   /product="GatB/YqeY domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00199"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27992"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241059.1"
FT                   /protein_id="ADK27992.1"
FT                   /translation="MSELKKKIRADLTTAMKAREKERTGTLRMLLAAIQTEETSGTKHE
FT                   LTDGDVLKVIAREIKKRRESAEVYAGAGRQELADAETQEADILAEYQPAQLDDAQLAAL
FT                   VAQAVEEVAAEHGEATMKQMGQVMKIATAKAAGQADGKRLSTAVRAALA"
FT   gene            complement(212119..214491)
FT                   /locus_tag="CPFRC_01035"
FT                   /old_locus_tag="cpfrc_00200"
FT   CDS_pept        complement(212119..214491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01035"
FT                   /old_locus_tag="cpfrc_00200"
FT                   /product="penicillin-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27993"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655001.1"
FT                   /protein_id="ADK27993.1"
FT                   /translation="MSKWNSLNRIVAAAVAAGAASALALSPIAAITGVAAARTSATMQS
FT                   NLQDLTDGSAPGVSTILDNQGSPIAWLYSQRRYSVPSEAIPQTVKDAVVSIEDRRFYEH
FT                   KGVDLQGNLRAIAANLFAGGVAQGASTLDQQYVKNYLLLVTSNNADEQAAATETSIPRK
FT                   LREMRMASTIDKMLSKDEILTRYLNLVPFGNNSFGIEAAARTYFGISASELSLAQSAMF
FT                   AGMVQSSSYLNPFTNAPAVIERRNTVLDSMVMNGYINQEEADLAKAEPLGVLDAPQGLA
FT                   NGCIAAGDSGFFCDHVLSYLNKKGLSTEQITKGAYTIKTTLDPQTQLAAHNAVTSQVNS
FT                   QSPGVADVMNIIEPGTNSRKILAMTSSRDYGLDLNAGQTVLPQTSSLVGAGAGSIFKIF
FT                   TAAAALKQGYGLDTVLQVPRRYEAKGLGDGGAAGCAPGTYCVENSGSYAPQMSLRDALA
FT                   YSPNTPFVKLIESVGVRDVVDISVALGLRSYSEKGSFDQDNSIADYFKEHNLGSYTLGP
FT                   TAVNALELSNVAASLASDGMWCEPSPIESVTDHNGNEVYIERPACEQALSKEIANALSN
FT                   GLSQDIIKGTGSAAAKAAGFRAPTAAKTGTTESHQSAAFLGFNSNFASAAYIYNDGTTV
FT                   SPLCTSPVSQCGKGTLFGGDEPARTWFTAATATGRAATGALPAYNTKYNRGSSEDLGSS
FT                   YVGRNGDDVKRELSGKGYKVVTEYTAGNGLPKDHVVRTEVPVPLKSDSTIKLVLSDGTP
FT                   PRRTTSPLIPRDEGPSDNNRNPGGDDLANLLQQLLGR"
FT   gene            214684..215031
FT                   /locus_tag="CPFRC_01040"
FT                   /old_locus_tag="cpfrc_00201"
FT   CDS_pept        214684..215031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01040"
FT                   /old_locus_tag="cpfrc_00201"
FT                   /product="WhiB family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27994"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300416.1"
FT                   /protein_id="ADK27994.2"
FT                   /translation="MTTSLMNVRKISPLEEDSLGSLQALDRGDWVMHAHCRHEDPDALF
FT                   VRGAAQRRAAAICSECPVMMRCRADALDNRVEFGVWGGLTERQRRSILRNNPDVKSWRD
FT                   FFARGGELSGV"
FT   gene            215133..215288
FT                   /locus_tag="CPFRC_01045"
FT                   /old_locus_tag="cpfrc_00202"
FT   CDS_pept        215133..215288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01045"
FT                   /old_locus_tag="cpfrc_00202"
FT                   /product="DUF4177 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00202"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27995"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241062.1"
FT                   /protein_id="ADK27995.1"
FT                   /translation="MTKWEYATVPLLTHATKQILDTWGEDGWELVNVVPGPNPENVVAY
FT                   MKREVE"
FT   gene            215288..215746
FT                   /locus_tag="CPFRC_01050"
FT                   /old_locus_tag="cpfrc_00203"
FT   CDS_pept        215288..215746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01050"
FT                   /old_locus_tag="cpfrc_00203"
FT                   /product="RidA family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00203"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27996"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366380.1"
FT                   /protein_id="ADK27996.1"
FT                   /translation="MTASENLKNLGIELPKVAAPVAVYIPATKVGNQVWTSGQLPFIDG
FT                   SLPAVGKVGAEVSAEQAESYARVAALNALAAIDALVGIDKVTRVLKVVGFVASAQDFGG
FT                   QPGVVNGASNLMGEVFGAAGEHVRSAVGVAELPLNSPVEIEVIVEVAE"
FT   gene            215828..216661
FT                   /locus_tag="CPFRC_01055"
FT                   /old_locus_tag="cpfrc_00204"
FT   CDS_pept        215828..216661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01055"
FT                   /old_locus_tag="cpfrc_00204"
FT                   /product="MBL fold metallo-hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00204"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27997"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558562.1"
FT                   /protein_id="ADK27997.2"
FT                   /translation="MAKLMGMEHPAYSQLRPVSPSVSVVLCPNPGYAALEGTNSWVVRA
FT                   EGDARSIVIDPGPEDEGHLNVLNSKANEVGLILLTHRHHDHADGAPRFYQLTGGAPIRA
FT                   QDPAYCKGGAPLVDGEVITVDGVTPQVEVVFTPGHTADSVCFFVWSGEPHASELEGIIT
FT                   GDTIAGRHTTMISETDGDLGDYLSTLALLEDRGKDVRLMPGHGPDGDDVASFAHWYTQR
FT                   RRQRLDQIRAARAELGEDVPIKQLIDAVYDDVDPVLRGAAEQSTRVALRYLAEQE"
FT   gene            complement(216741..217424)
FT                   /locus_tag="CPFRC_01060"
FT                   /old_locus_tag="cpfrc_00205"
FT   CDS_pept        complement(216741..217424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01060"
FT                   /old_locus_tag="cpfrc_00205"
FT                   /product="cyclic nucleotide-binding domain-containing
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27998"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_006770229.1"
FT                   /protein_id="ADK27998.1"
FT                   /translation="MDGVQDILSRAGIFQGVDPVAVGNLIQELESVRFPRGATIFEEGE
FT                   PGDRLYIITSGKVKLARHSLDGRENLLTVMGPSDMFGELSIFDPGPRTSSAVCVTEVHA
FT                   ATMNSEMLRQWISDHPEISEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANR
FT                   FGTQEGGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHL
FT                   AKRAR"
FT   gene            complement(217726..218034)
FT                   /locus_tag="CPFRC_01065"
FT                   /old_locus_tag="cpfrc_00206"
FT   CDS_pept        complement(217726..218034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01065"
FT                   /old_locus_tag="cpfrc_00206"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00206"
FT                   /db_xref="EnsemblGenomes-Tr:ADK27999"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241066.1"
FT                   /protein_id="ADK27999.1"
FT                   /translation="MAPTLFQAYDIAPTLAQNRTAYQRIRDYSDSMSFLLVFFVPLALA
FT                   LFLLWMDRLEIKVLHPHGIPEKNNAAADITDLPRTGTAEEGSDSTDNAKNFLSSEEK"
FT   gene            218033..218839
FT                   /gene="nth"
FT                   /locus_tag="CPFRC_01070"
FT                   /old_locus_tag="cpfrc_00207"
FT   CDS_pept        218033..218839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="CPFRC_01070"
FT                   /old_locus_tag="cpfrc_00207"
FT                   /product="endonuclease III"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00207"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28000"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241067.1"
FT                   /protein_id="ADK28000.1"
FT                   /translation="MSSQYLSELPTSPPAARIKVGRHRATRGQETPLGKKRRARRINRL
FT                   LSIGYPEAHCELDFKTPLELTVATVLSAQCTDVRVNQVTPRLFSRYPTAWDYANANELE
FT                   LQELIRPTGFYKAKAAHLIGLGQKLVTDFGGEIPQSIQDLVSLPGVGRKTANVVRGNAF
FT                   GIPGLTVDTHFGRLVRRMGLSSHTDPLKVEAELAELIEKKEWTMFSHRIIFHGRRVCHS
FT                   RKAACGACFLAAECPSFGLEGPIDPELASALVVGDNREALLELAGA"
FT   gene            218843..219448
FT                   /locus_tag="CPFRC_01075"
FT                   /old_locus_tag="cpfrc_00208"
FT   CDS_pept        218843..219448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01075"
FT                   /old_locus_tag="cpfrc_00208"
FT                   /product="redoxin family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00208"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28001"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366384.1"
FT                   /protein_id="ADK28001.1"
FT                   /translation="MKKTIAASFGVFVVMLVFLLAVVPQLLRGDNSGNQNGSTGAEGTE
FT                   ATAQNVQNRPECPIADLGGVSLPCLGAQHRARPMPAVTVVSLWAWWCEPCRKELPLFDE
FT                   LAAKHPEFSVIGVHADPNAANGAALLNDLGIQMPSLQDNNNNFAASLGLPKVVPITLVF
FT                   DQNGKLISTIPKPFEHYGELESAVLGKLPATVTPTEAS"
FT   gene            219448..220227
FT                   /locus_tag="CPFRC_01080"
FT                   /old_locus_tag="cpfrc_00209"
FT   CDS_pept        219448..220227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01080"
FT                   /old_locus_tag="cpfrc_00209"
FT                   /product="NUDIX domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00209"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28002"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523774.1"
FT                   /protein_id="ADK28002.1"
FT                   /translation="MDSNEKQGSDFPRPDMPGENITLRPERAPIWMRRLVGDVTGGVID
FT                   GRIRRALRPESSPDSTRRAAVLVLLAGAETSAEMPNDASVLLTHRSPRMRAHSGQIAFP
FT                   GGRLDKTDANAVDCALREAWEETGLDRRTVTPLAQLPEVHIRATGYPVLPVLAHWHSVS
FT                   PIGVVSPQEADSVANIPVLALTDPANRFVVQHQDWTGPAFRVNDYVIWGFTGGLLDALI
FT                   AHAGWEQPWDKTTRYDLHKTLSESRNNERLGQLYPRR"
FT   gene            220299..221498
FT                   /locus_tag="CPFRC_01085"
FT                   /old_locus_tag="cpfrc_00210"
FT   CDS_pept        220299..221498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01085"
FT                   /old_locus_tag="cpfrc_00210"
FT                   /product="MarP family serine protease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28003"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241070.1"
FT                   /protein_id="ADK28003.1"
FT                   /translation="MTPGTVVDIIIGLALIFAIFSGWRQGAFASVLSTLGVIAGLICGA
FT                   ALAPVVMEQTESTALRFLLALGTVILLVGIGNLVGGLIGSSLRDRAQWRRTLAIDSMVG
FT                   ALFQAFATLIVAWLGAIPLATSLSGSVSQGIKNSTILGFVDRNIPAAFSTLPSRISAML
FT                   NESGLPPLISPFVEGSQSKNVEAPAIKVADTALVERLRPSVIHVLGESEECSRRLMGSG
FT                   FVIDESHVITNAHVVAGTNKVSLDTVEGVFPAEVVYYNAQLDIAVLKSDKISLPALSWA
FT                   QEPAESGEDAIVMGFPESGPFEAAPARVSDRIKISGADIYSNGRVEREAYTVRGSIRKG
FT                   NSGGPMVDTEGNVLGVVFGASVDSSDIGYVLTAQEVQNMVGDIAALETPVDTQKCVTAR
FT                   "
FT   gene            complement(221491..222408)
FT                   /locus_tag="CPFRC_01090"
FT                   /old_locus_tag="cpfrc_00211"
FT   CDS_pept        complement(221491..222408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01090"
FT                   /old_locus_tag="cpfrc_00211"
FT                   /product="alpha/beta fold hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28004"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799941.1"
FT                   /protein_id="ADK28004.1"
FT                   /translation="MKKHRQPLSPSVVALEGPFHHQMLHTRGLRLHAATAGDPQNPAIV
FT                   LLHDSFGGWFDFRHVIEPLAAAGFHVAALDMRGYGLSDKPPSGYEHRFVTGDIAGSIRT
FT                   LGHNSAHVIGAGSGASIAWLLAANYPDHVDSLLTMGALHPADMRRAIGLRPWLFSHILP
FT                   LTMMFRLPHFLRSWCWSRRDLLIERDLRLTTGLRFHVSERFSQELRLRRKAMSIDSTFL
FT                   PVTKTSRYSVNVPPSKWTLPKVQVPVHMLVDASATSAWLARRAHSRSAAGLSTSTVGGT
FT                   GQRPHLENPEGFVSEVLRFIRSTI"
FT   gene            complement(222498..222998)
FT                   /locus_tag="CPFRC_01095"
FT                   /old_locus_tag="cpfrc_00212"
FT   CDS_pept        complement(222498..222998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01095"
FT                   /old_locus_tag="cpfrc_00212"
FT                   /product="phage holin family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00212"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28005"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655004.1"
FT                   /protein_id="ADK28005.1"
FT                   /translation="MSKDNGFFTDGADQFDAKVNGIPLTDVDATNKGSIGSLVSDATAQ
FT                   MSSLFRAEVELAKTELAAEAKKGVIGGGLFGVAGTIALYSSFFFFFFLAELLSVWLDRW
FT                   AAFLIVFLIMIVLAALLALVGFKKVKKIGKPKQTIQSVTELKNLVPGKAQANLEAKQHG
FT                   MYS"
FT   gene            223115..223780
FT                   /locus_tag="CPFRC_01100"
FT                   /old_locus_tag="cpfrc_00213"
FT   CDS_pept        223115..223780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01100"
FT                   /old_locus_tag="cpfrc_00213"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00213"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28006"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835845.1"
FT                   /protein_id="ADK28006.1"
FT                   /translation="MATLDHLLASGEIKALSQRATDGIAAVHRRPVNLRKYDVTSSESI
FT                   LRGARTSAALDPKVGEKYHISGYSVLAPAVIEQTSRTFLRAPLQVLARIDALAGGPGRP
FT                   TSASMELEVLARVITSGPNPALLPAVVHGEIIGRAAFGPRSALVARVAARSAAVTFGLD
FT                   PRGLCVPETYLRRHRVEYQASAAHFTAGQEQAVKFIELYLKAMIAGAEEAESIAAAAR"
FT   gene            complement(223824..224696)
FT                   /locus_tag="CPFRC_01105"
FT                   /old_locus_tag="cpfrc_00214"
FT   CDS_pept        complement(223824..224696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01105"
FT                   /old_locus_tag="cpfrc_00214"
FT                   /product="HAD-IB family hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00214"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28007"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910664.1"
FT                   /protein_id="ADK28007.1"
FT                   /translation="MAHSSEHPRPGASHDDSTPGSGMIFPADSSKVVAFFDLDKTIIAT
FT                   SSVYVYGREFLHSGLISPVTALQISIAKATYMIAGHSSEQMDTTRDQLAQMIVGWSEEQ
FT                   VKAIATETMHSLVTPTFYAEARELIRMHQEAGHDVVIISASARILVEPIAQELGVENVV
FT                   ATELVVEDGKFTGEMPFYCKGEMKAQAIAELTQQRGYDLDSSFAYSDSVTDLPMLEAVG
FT                   HPIVVNPDRALRRIATEKGWEIRTFKNPVPLFPKPTMREVQIGTGVAAGVAAMLGGVVW
FT                   WNKRTDKRT"
FT   gene            complement(224977..225192)
FT                   /locus_tag="CPFRC_01110"
FT                   /old_locus_tag="cpfrc_00215"
FT   CDS_pept        complement(224977..225192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01110"
FT                   /old_locus_tag="cpfrc_00215"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28008"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523775.1"
FT                   /protein_id="ADK28008.1"
FT                   /translation="MLQVLAEASFNEKEILRWTEKGKKVNHEIWYEEIPLDKSSHSSSL
FT                   PGEIPVYFNGCSFNEGWDQDFHTTVA"
FT   gene            225524..226555
FT                   /locus_tag="CPFRC_01115"
FT                   /old_locus_tag="cpfrc_00216"
FT   CDS_pept        225524..226555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01115"
FT                   /old_locus_tag="cpfrc_00216"
FT                   /product="pilus assembly protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00216"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28009"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366388.1"
FT                   /protein_id="ADK28009.1"
FT                   /translation="MKPAPVLIAVTDPIVHPEAVHIVAATGRPMIDSTDPREITRHAHR
FT                   AAAVLVDATTAPHAATLPAGTRRFLLAAEPGPIDWQLAMACHAEAAYVVPAQAPELLKA
FT                   LGRDDDPPPAEGIVIAVMGAVGGSGTSTLASAIALNCENAVLIDADPSSGGVDLLLGIE
FT                   ESPGMRWNDLALRQGDVRSDDLIAAFPKTSQGLPVLTVARGNDAHTIDDATFNAVIRSL
FT                   HGHTSVVVDLLRETSIADSALDAADCVVLCIPAEIRAVAAAERLVQQMRARNIKVVGVL
FT                   RHRLWSSVDASDVERAAHLDVVAEIGNLSRLTKTTEYTGLSSPLPRSLKAAATAVLEEA
FT                   QAA"
FT   gene            226552..227676
FT                   /locus_tag="CPFRC_01120"
FT                   /old_locus_tag="cpfrc_00217"
FT   CDS_pept        226552..227676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01120"
FT                   /old_locus_tag="cpfrc_00217"
FT                   /product="TadA family conjugal transfer-associated ATPase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00217"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28010"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241077.1"
FT                   /protein_id="ADK28010.1"
FT                   /translation="MMNHQDVVARVQRRIAEDPGLADSASLASLVRQEAHGVISDVDMI
FT                   SLLRQLRYDSVGIGQLERLLVIPGVTDIVVNGTTGVWFDRGQGLERADVAFASDDEVRR
FT                   LATRFLVASGSRLDHSHCFGDGRITRDDATSIRVHAVLSPPSESGTCLSLRVLRQATTT
FT                   IKQLTATGTFSPEVAGGLQEMIALRKPFLVVGGTGSGKTTLLSALLAQVDPGERIVCIE
FT                   DTAELRPAHPHVVSLVSRAKNTEGSGEITMTTLLRQALRMRPDRIVLGEIRGPEVVDLL
FT                   AALNTGHEGCAGTLHANSLQEVPARIEALAALGGLDRQALHSQLAAASPVVLAMKRTRQ
FT                   GRRLQQIGVLRGYPLEVHLVWDDTMQGAPSWNLS"
FT   gene            227676..228431
FT                   /locus_tag="CPFRC_01125"
FT                   /old_locus_tag="cpfrc_00218"
FT   CDS_pept        227676..228431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01125"
FT                   /old_locus_tag="cpfrc_00218"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00218"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28011"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366390.1"
FT                   /protein_id="ADK28011.2"
FT                   /translation="MLAAAAWVSASPSPKRRVVGKKATRQWQKKAISVILVVALIFPLR
FT                   HHIPLVVSGALIVATIVNSWNKRRLEASQRREQEEISTALGSLAGDLRAGVEASVALEN
FT                   VAQNLPESALKDTLMAASRSSRIGGSASAYWQQRALAIHGIEKITHAWRLSERYGIALA
FT                   PLLEKNRASLDEDLRHAERTQAALQGAKATAYILTALPFVGILLGRGMGVNALGFLFHT
FT                   RIGAVLLILGTLLVCVGNLWSQAIMEKAR"
FT   gene            228428..229051
FT                   /locus_tag="CPFRC_01130"
FT                   /old_locus_tag="cpfrc_00219"
FT   CDS_pept        228428..229051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01130"
FT                   /old_locus_tag="cpfrc_00219"
FT                   /product="type II secretion system F family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00219"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28012"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523777.1"
FT                   /protein_id="ADK28012.1"
FT                   /translation="MITVIAMALIALAASIKRPDVVQRIYRARDGPQKIPCGVQRYWDA
FT                   LLHKLFADRLSSDFLRKSAYQLDLFAACVQSGLTPSQSAFAVAATEESSPRDARVRSGW
FT                   LEVAMMLEMGMPAERAWQSLAEHPALGDLVTVARASERSGATLAEACERLARQLRARAS
FT                   DLSLARAERAGVLIALPLTVCFLPAFFLLGLAPVVISLGIGIFS"
FT   gene            229116..229310
FT                   /locus_tag="CPFRC_01135"
FT                   /old_locus_tag="cpfrc_00220"
FT   CDS_pept        229116..229310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01135"
FT                   /old_locus_tag="cpfrc_00220"
FT                   /product="DUF4244 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28013"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835851.1"
FT                   /protein_id="ADK28013.1"
FT                   /translation="MFTAFIHNCHKLVDNEDGMTTIEYAMGALAAAALAGALYLVATSG
FT                   SVSTALEGIITNALNKTPG"
FT   gene            229321..229593
FT                   /locus_tag="CPFRC_01140"
FT                   /old_locus_tag="cpfrc_00221"
FT   CDS_pept        229321..229593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01140"
FT                   /old_locus_tag="cpfrc_00221"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28014"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799949.1"
FT                   /protein_id="ADK28014.1"
FT                   /translation="MSTIETAIVSAALIILAAAMCSGIVSVAAQLTAIDNAGAAARARA
FT                   IGVEFTAPRGTIDFSESGGLITATARVPSPLGTRTATAIFPKEQP"
FT   gene            229590..229922
FT                   /locus_tag="CPFRC_01145"
FT                   /old_locus_tag="cpfrc_00222"
FT   CDS_pept        229590..229922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01145"
FT                   /old_locus_tag="cpfrc_00222"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00222"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28015"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241082.1"
FT                   /protein_id="ADK28015.1"
FT                   /translation="MKKLRLAISNQDGNATILGAGIMVAFSAVLLCFVIIANSVLDQHT
FT                   AQNTADLSAIAGATAATQGLVACEQTQRVAALNDAVLIDCIQIHNDVIVETKVGQQTAK
FT                   ARAGPL"
FT   gene            complement(229954..232311)
FT                   /locus_tag="CPFRC_01150"
FT                   /old_locus_tag="cpfrc_00223"
FT   CDS_pept        complement(229954..232311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01150"
FT                   /old_locus_tag="cpfrc_00223"
FT                   /product="DUF1998 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00223"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28016"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366394.1"
FT                   /protein_id="ADK28016.1"
FT                   /translation="MAEANPNMGYQLGQELASIVADRYPNSTCTHLETTPAKPARYADW
FT                   PEWVYPPVKEALISRGIQRLYAHQQEVAHNAWEKIDTVIATGTSSGKSLGYQLPILSCL
FT                   AYDSTACAIYLTPTKALGSDQLNAVTALLQEAQTLGGDALDSVHPAPYDGDTPSDARSG
FT                   IREQSRFIFTNPDMLHAGILPNHQRWARLFRHLRFIVIDECHSYRGVFGAGVSLVLRRL
FT                   LRIASRYGSTPTVILASATSNNPAEHAELLLGRPVCAVTTDSAPTGARTIMLWEPGFLD
FT                   GVEGEHGAPVRRAASSEAASIMATLIAEGARTLTFVRSRRQAELTALRCAEELSYHGRP
FT                   DLAPRISAYRAGYLAEDRRRIEEQLDNGQLLGVASTNALELGIDVGGLDAVVTAGFPGT
FT                   VASFWQQAGRAGRRGQGSLVTLVARDEPMDTYLVHHPEALLGRPIERTVFNPHNPHILA
FT                   GHLCCAALEAPLSDAEINSLGAQQVAERLEREGLLKHRRHGWFAVEKPGEPSAHELVSL
FT                   RGSGSAITIVDETDGRVLGTIEQTRAVSQVHPGAVYLHRGESFIISSLDLEQHLALAHP
FT                   DAPDHSTYARSTTDIRILGEVDKVANPAPGLWVSNLNVEVTDRVTGYVVKAPDGSVLDV
FT                   VSLQMPPQTLITRAVAYTIDPLILDQLGITDVPGALHAAEHAAIGILPLIATCDRWDIG
FT                   GVSTEMHPDTGLPTVFVYDGHPGGAGFTDCGYERFPEWIATTFDAIRSCSCESGCPSCV
FT                   QSPKCGNGNSPLDKGGAVALLGSICTMLGVTP"
FT   gene            232561..232764
FT                   /locus_tag="CPFRC_01155"
FT                   /old_locus_tag="cpfrc_00224"
FT   CDS_pept        232561..232764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01155"
FT                   /old_locus_tag="cpfrc_00224"
FT                   /product="cold-shock protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00224"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28017"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010266781.1"
FT                   /protein_id="ADK28017.1"
FT                   /translation="MAQGTVKWFNAEKGFGFIAPDDGSADVFVHYSEIQGNGFRTLEEN
FT                   QKVEFEIGEGAKGPQAQQVHAL"
FT   gene            233006..235942
FT                   /gene="topA"
FT                   /locus_tag="CPFRC_01160"
FT                   /old_locus_tag="cpfrc_00225"
FT   CDS_pept        233006..235942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="CPFRC_01160"
FT                   /old_locus_tag="cpfrc_00225"
FT                   /product="type I DNA topoisomerase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28018"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599561.1"
FT                   /protein_id="ADK28018.2"
FT                   /translation="MAEKSGPKRLVIVESATKAKKIAPYLGDDYIVEASVGHIRDLPRG
FT                   AADVPTKYKKEPWARLGVNTENGFAPLYVVSPDKKKKVADLKQKLKLVDELLLATDPDR
FT                   EGEAIAWHLLEVLKPKVPVKRMVFNEITKPAILAAAENTRELDANLVDAQETRRILDRL
FT                   YGYEVSPVLWKKVMPRLSAGRVQSVATRVIVERERERMAFVSAEYWDIEAEFDTGKPDT
FT                   DGNPHQFTGRLTSVDGKRVATGRDFNDRGELKGDAVVVNKQRAEALVAELTGAPMNVAK
FT                   VEEKPYTRRPYAPFMTSTLQQEAGRKLHFTSERTMRIAQRLYENGHITYMRTDSTTLSE
FT                   QGLKAAREQAISLYGNDYVAEGPRRYDRKVKNSQEAHEAIRPAGEHFATPGELHAQLDA
FT                   EEFKLYELIWQRTVASQMADAKGTSMKVTIAGKNAEFSATGRTITFPGFLRAYVEITKL
FT                   SDGRDLADNAERHLPRLAEGDALDVNKLEVDEHSTNPPARYTEASLVKKMEELGIGRPS
FT                   TYASIIKTIQDRGYVYSRGNALVPSWVAFAVVGLLEKSFSALVDYDFTSSMEDELDDIA
FT                   AGREDGTEWLTGFYFGDAAASDATAESIARHGGLKALVGDNLEHIDARLVNSLELFQDS
FT                   EGRAVNVRVGRYGPYIERQIGVSADGEAEYQRANLSDTTTPDELTLDVAEKLFATPQSG
FT                   RELGRNPKNDRMIVAKEGRFGPYVTELVNDDERAQVEAKAEEIVASERKAEDEQRAAEG
FT                   KRAKNWETKTAVKQKEKRIAEIVDETLKPGTASLFKDMEPATVTLEQALQLLSLPREVG
FT                   VDPSDNAPITAQNGRYGPYLKKGNDSRSLASEEQIFTITLDEARRIYAEPKRRGRGATS
FT                   QSVIKELGDNDVSGKPMSVRDGRFGPYVTDGTTNASLRRGDDPTELTDARANELLSERR
FT                   AKEAADGGAEKKATKKAAKKSTKKTTAKKAVKKPAKTTKRVVKAGRKK"
FT   gene            complement(236077..238050)
FT                   /locus_tag="CPFRC_01165"
FT                   /old_locus_tag="cpfrc_00226"
FT   CDS_pept        complement(236077..238050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01165"
FT                   /old_locus_tag="cpfrc_00226"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00226"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28019"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655007.1"
FT                   /protein_id="ADK28019.1"
FT                   /translation="MSDTDIAKPSTGSSIRELTLRAVIIGGLITLVFTAANVYLGLKVG
FT                   ITFATSIPAAVISMAILRRFAGHTIQENNVVQTIASAAGTLSAIIFVLPGLIMVGWWSG
FT                   FPYWTTAFVCAIGGVLGVMYSIPLRRALVTGSDLPYPEGVAAAEVLKVGNDAGNAEEYE
FT                   GNKKGLAVIVWGGIASVGYSLLTAMKGVAGEVSTTFKVGAGGTMFGSSLSLALIGVGHL
FT                   VGPAVGISMIVGLLISYGVLFPYFSAAPLAEGGELASVVNSTFVGEVRFVGAGAMAVAA
FT                   VWTLIKIIGPIVKGIKESLASSRTRAAGGDVDLTERDIPFKLVVGTILASMLPVSALLY
FT                   LFIHASEIAHHTATLVIFSIVFVLLIGLIVASVCGYMAGLIGAPNSPISGVGIIVVLAS
FT                   ALLIKVVTGSESDTNAPALVAYTLFTSAVVFGIATISNDNLQDLKTGQLVNATPWKQQV
FT                   ALIIGVIFGSIIIPPVLQLMLDGFGFVGMEGAGDNALAAPQAALLSSVAEGIFGDSLNW
FT                   NRIGLGAIIGVIVIIIDELLKRTKGWSLPALSVGMGIYLPIALTAIIPVGAFIGYFYDK
FT                   WAKKQSNPEFSKRMGILLATGVIVGESLFGVLNAAMVGGTGMEAPLAIFGYGENVATGV
FT                   GIIVFVLLVVSLYRWVRSKASE"
FT   gene            complement(238258..239784)
FT                   /locus_tag="CPFRC_01170"
FT                   /old_locus_tag="cpfrc_00227"
FT   CDS_pept        complement(238258..239784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01170"
FT                   /old_locus_tag="cpfrc_00227"
FT                   /product="HAMP domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00227"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28020"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010934219.1"
FT                   /protein_id="ADK28020.1"
FT                   /translation="MTRMWRAFKWLFGTSWPLYATTVLGSNVLGAVGVMLFLRYLVPLP
FT                   EFAAFTKGTSYLPTLGISYLVVAVAFGIVVTFRLFRPVLDWQRHPEIHDPNMVRNLVMR
FT                   IPFYQSTLCALVWLIGIVILAVASAQTSLRLSLAIIVATALSGSVVIVLTYLEAERLVR
FT                   PVAATALARRFEDSTLEPPIASRLRLTWLLTSAVPIVGVLLMIAGYYAGLFGNNIRDII
FT                   PAVLTLSLVALVTGFLGTTLSIMSVVDPILELQGAINRVRRGESDVQVDIYDGSELGVL
FT                   QAGFNEMMRGLNERQRVRDIFGRYVGTEVARRALEEKPQLGGEDREVAVIFVDVIGSTT
FT                   FAVNHDPEEVVAELNKFFEHVVGVVHRNKGSINKFQGDAALAVFGAPITLSDATGHALT
FT                   AARELRQELSGLRLEAGIGVASGHVVAGNIGGLDRFEYTVIGDAVNTAARLTEIAKNTP
FT                   GRVLTNAATLKKANEAEQARWTLMKSVELRGRSMMTQLARPIRPTLADRS"
FT   gene            239832..241034
FT                   /locus_tag="CPFRC_01175"
FT                   /old_locus_tag="cpfrc_00228"
FT   CDS_pept        239832..241034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01175"
FT                   /old_locus_tag="cpfrc_00228"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /EC_number="2.7.7.7"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00228"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28021"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799954.1"
FT                   /protein_id="ADK28021.1"
FT                   /translation="MSTNDIFSHMGVSEHIAPALRTAAYAARAHEDGSAMTHAWLFTGA
FT                   PGSGRSVAAVAFAAALECEDPHVAGCGRCPQCRSVMANAHADVVHIVPRELSISVETMR
FT                   AEVVEPAAKRPTVGRWRVVILDNADRLTDGAANALLKTVEEPPAHTVIMLCAPSTDPTD
FT                   IIPTLLSRSRHVYVPQPTTEQVVAVLTRDGSITEEDARLAAASSGGHIGRARWLARDVE
FT                   AQRRRASILNMAELVFHGDQAFQAVTGIVKTVTKQVEEQLSQENDAELDKLRNSLGMGA
FT                   RGKGVHKALRGYEAFVRDLEEKQKKRRTRAIRDSLDLSLVDLAGLYRDAIMISSHADVP
FT                   RTHPDMVGLAEELAQRVSAEGLVACVDAINLCREHINHNVRPEVAFDAMIGRIRLACGA
FT                   H"
FT   gene            241138..241213
FT                   /locus_tag="CPFRC_01180"
FT                   /old_locus_tag="cpfrc_t012"
FT   tRNA            241138..241213
FT                   /locus_tag="CPFRC_01180"
FT                   /old_locus_tag="cpfrc_t012"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:241171..241173,aa:Thr,seq:cgt)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            complement(241354..241590)
FT                   /locus_tag="CPFRC_01185"
FT                   /old_locus_tag="cpfrc_00229"
FT   CDS_pept        complement(241354..241590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01185"
FT                   /old_locus_tag="cpfrc_00229"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00229"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28022"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400945.1"
FT                   /protein_id="ADK28022.1"
FT                   /translation="MASSRLQCSLPQNKKTHSTASIVAGALHALSWIALILVCFFAFKN
FT                   GHFSEQIIGLSFIAVAATGIWVAICGVNRRRNN"
FT   gene            complement(241724..243370)
FT                   /locus_tag="CPFRC_01190"
FT                   /old_locus_tag="cpfrc_00230"
FT   CDS_pept        complement(241724..243370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01190"
FT                   /old_locus_tag="cpfrc_00230"
FT                   /product="AMP-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28023"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525265.1"
FT                   /protein_id="ADK28023.1"
FT                   /translation="MKARRGVPSTLKAMVQLAPTLISSGILNVEGNSSAIFSIPQLLAR
FT                   YRFTTAREVEQAYRICPNRIALIDDDGTLTFSQLRNDSLTVARHFASLGINDLRIGVMA
FT                   RNGRASIYPLAAKGYVGASIYLLNIGSSPEQLVGCIKRDGINVLVIDEEFVDRLPTDLT
FT                   GLHVIVGHREKVSSQRTAELITLDDIVRKPWETADISLPTFPKHGSIVLMSSGTTGIPK
FT                   GVMRKELTAPTVLESVLTQVPWRANMTIQLTGSIFHTWGWACLNIAFGLRCTVITRRKF
FT                   DPQEALADVQKHKIDAMISSPIFLKQFFAVEGQENYDCSSLKFIFSSGHSLSPWLVDAV
FT                   HERFGKILCNLYGSTEISAAAIASMEEIAENPAVAGKICKGTQLVILDDNDNPVGPGVP
FT                   GRIFCHNNLSLTGYTDPNIPIPRVGDLVQIGDRGYIDENNYLFVLGRADDMIIVGGENV
FT                   YPRSVEEVLEPMAGIADLYASGVEDEDMFERIAVWVVRSDSPEGAALTEDSIRDWVKNN
FT                   LAEHSIPRDVHFVDSLPRNATGKVIPRMLKP"
FT   gene            243579..244388
FT                   /locus_tag="CPFRC_01195"
FT                   /old_locus_tag="cpfrc_00231"
FT   CDS_pept        243579..244388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01195"
FT                   /old_locus_tag="cpfrc_00231"
FT                   /product="hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28024"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241091.1"
FT                   /protein_id="ADK28024.1"
FT                   /translation="MLRKLVTALTSAAIVVSLTTAPQALAAERNMVVLGDSIIADSPAT
FT                   QLLADRFTSSRNCRRSPDSYAEQAGRRLGLPVRNFSCPGVQSISTGSFSGGPFNVEVDS
FT                   ALNSGALNTATARVVITHGFNDTYFNGGESEGATRARFVAAMRPQIDRIRAAAPHARIQ
FT                   IVGYPTIVTGSRICPLHIIPNITLPVPAGAMERWENLAQWMNVDLAHATGVEFLDLKPH
FT                   TRNNGMCAPDADRYFSGVIDFTAGRGNMPLHINARGHERIGEILANS"
FT   gene            complement(244493..245362)
FT                   /gene="rfbA"
FT                   /locus_tag="CPFRC_01200"
FT                   /old_locus_tag="cpfrc_00232"
FT   CDS_pept        complement(244493..245362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="CPFRC_01200"
FT                   /old_locus_tag="cpfrc_00232"
FT                   /product="glucose-1-phosphate thymidylyltransferase RfbA"
FT                   /EC_number="2.7.7.24"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00232"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28025"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835861.1"
FT                   /protein_id="ADK28025.1"
FT                   /translation="MKGIILAGGSGTRLHPITFGISKQLMPIYDKPMIYYPLTTLIQAG
FT                   ISEILIITTPEDQQAFQRLLGTGEQWGISLSYAVQPSPDGLAQALVIGRDFIGNDDVAL
FT                   VLGDNIFDGNDLDASLQNCYTPGKATVFAYEVSDPQRYGVVNFDSHGMATAIEEKPTHP
FT                   TSNFAVVGLYFYPNDAATLAERLTPSERGELEITALNSAYLEQGRLRVHKLERGSVWLD
FT                   TGTIDSMSEASSYVEVLQKRTGSIIGSPEVAAWRAGFINDSQLRALGHAQLKSGYGKYL
FT                   LRALGEGW"
FT   gene            complement(245366..246748)
FT                   /gene="rfbD"
FT                   /locus_tag="CPFRC_01205"
FT                   /old_locus_tag="cpfrc_00233"
FT   CDS_pept        complement(245366..246748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="CPFRC_01205"
FT                   /old_locus_tag="cpfrc_00233"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00233"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28026"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241093.1"
FT                   /protein_id="ADK28026.1"
FT                   /translation="MNIETCPIQGMMVIHLDLHEDSRGWFKENWQESKLVGLGLTGFRP
FT                   VQNNISFNAEAGVTRGLHAEPWDKYVSVATGSVFGAWCDLREGSATFGATFTITITPET
FT                   AVFVPRGVANGFQALEATAYTYLVNDHWAPDAHYSFVNLADPALNISWPIPLDQATLSK
FT                   KDTAHPPLASAVPVPPKKVLVTGANGQLGRTLKKVFPHAEFCSRTDLDITTDITEARRW
FT                   ADYSVIINAAAYTAVDAAETDSTAAWRTNAEAPARLAAIAARYGITLVHLSSDYVFDGE
FT                   LPVHSEQEPFSPLSVYGQSKAAGDTAVSVAPQHYVVRTSWVVGEGNNFVSTMLSLAARR
FT                   ISPQVVNDQLGRLTFTEDLAAGIRFLLDNHAPYGVYNLSNSGEIVSWAQLAQRVFTLAG
FT                   RSASDVQPVSTTEYFAGKAPAAPRPRHSALDLSKITGLGFTPRDWQDALASYCTTLDAK
FT                   EG"
FT   gene            complement(246748..247752)
FT                   /gene="rfbB"
FT                   /locus_tag="CPFRC_01210"
FT                   /old_locus_tag="cpfrc_00234"
FT   CDS_pept        complement(246748..247752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="CPFRC_01210"
FT                   /old_locus_tag="cpfrc_00234"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00234"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28027"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910684.1"
FT                   /protein_id="ADK28027.1"
FT                   /translation="MRKNLLVTGGAGFIGSNFVRRTLETRSDYRVRVLDKLTYAGNSAN
FT                   LDGCDAELVEGDICDAALVDKLLSDADVIVHFAAESHNDNSLEDPSPFIHTNVVGTFTL
FT                   LEAARRHRVHLHHVSTDEVFGDLELEDPNRFTERTPYNPSSPYSASKAGSDHLVRAWVR
FT                   SFDVSATLSHCSNNYGPYQHIEKFIPRQITNILSGIPPKLYGTGEQVRDWIHVDDHNDA
FT                   IHAILDRGRIGESYIIGADNDHVNNKQVIELICHLMGADSYEHVADRPGHDMRYAMDST
FT                   KLRTELGWKPRFTDTATGMREGLSHTIQWYRDNEHWWRPLKDTVENNYAKRGQ"
FT   gene            complement(247776..249149)
FT                   /locus_tag="CPFRC_01215"
FT                   /old_locus_tag="cpfrc_00235"
FT   CDS_pept        complement(247776..249149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01215"
FT                   /old_locus_tag="cpfrc_00235"
FT                   /product="M1 family peptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28028"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241095.1"
FT                   /protein_id="ADK28028.1"
FT                   /translation="MTRPRLRSTPVPGTRDSYTGVDFNLGFHVRCYELIMDYAVGPNRL
FT                   AAEATLYMDNYLPLSHLTLDFADNLRATSVDITTAGGVRTDVKRFRQSDNKLRISFTDP
FT                   IPADAEFALSISYAGNPHPIRTFWGLIGWEELTNGSLVASQPCGSRSWLPCDDTPDEKA
FT                   LFDITFTCDSDYSVIANGGLISKNTSGARTTWRYRSEHPLATYLSTIQVGQYQEESLNH
FT                   TPPITTVPIRGYVPPHMISGFRNDFAQQEEMLAIFSKLFGSYPFDSYSVVVTEDELEIP
FT                   LEAQGLSIFGANHARGHGQWERLIAHELSHQWFGNSLGLAQWNDIWLNEGFACYSEWLW
FT                   FEYSGRGPTAHESARFHYDQLAALPQDLLLADPGPKDMFDDRIYKRGALTVHALRCELG
FT                   DAPFFRAVQRYVAAGRHSVVEPHDLRREILKEASNPQRCEELWASWLYRTELPEFPNP"
FT   gene            complement(249142..251223)
FT                   /locus_tag="CPFRC_01220"
FT                   /old_locus_tag="cpfrc_00236"
FT   CDS_pept        complement(249142..251223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01220"
FT                   /old_locus_tag="cpfrc_00236"
FT                   /product="prolyl oligopeptidase family serine peptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00236"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28029"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799960.1"
FT                   /protein_id="ADK28029.2"
FT                   /translation="MSTTPFPRSEHHSLADLPFNADVLETIDAPEALDWAKRWSHATES
FT                   ALDFSDLQQRMRSALNVDTKIPYVLRRGSYLYNFWQDADHPRGLWRRTTLDAFLSGTEE
FT                   WQTLIDVDKLAHEENESWVWKGAHVRPHHFDRALVQLSRGGADAVEIREFDLCANDFVT
FT                   ADPFHIPEAKTRVSWVDRDTLLIGTDLGPGTLTDSGYPARAYTWQRGTPLQSAKEFFAG
FT                   KTSDLAVSAWADSTPGFERKFIRRALDFYRSHTFIERDEALQIVEVPEDCELAFHRQWM
FT                   FVFPREDYAGVPAGGVGAIVFQRFLDGDRDFRRVFTPTPTTSIQDISFTKTRIILTVLD
FT                   NVSSRLEVLRLDSLEPEDATIQLPPLTTARVVATCDDSDEVWLGASSFTQPDTLFRVDV
FT                   NDSLIPVEVRHAPALFNAHGMETRQHWAISADGTKIPYFIVGDFSQGPRPTLVGGYGGF
FT                   EVSLVPGYSATRGLGWLEQGNFYVQPNLRGGGEFGPAWHESVIRMNRPLIYQDHQAVLK
FT                   DVLSRGYASSIFVRGGSNGGLLTSVALTSYPELIQGAVVQVPLTDMLRYHQWSAGSSWI
FT                   AEYGDPSDPQEREVLESYSPLHNIREHSEVSYPPALVTTSTRDDRVHPAHARLFAAALA
FT                   DCGQPVDYYENVEGGHAGAADNEQVAFMEALIFTWLQKHADQASPSRSIFTEEGSHHD"
FT   gene            complement(251308..252387)
FT                   /locus_tag="CPFRC_01225"
FT                   /old_locus_tag="cpfrc_00237"
FT   CDS_pept        complement(251308..252387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01225"
FT                   /old_locus_tag="cpfrc_00237"
FT                   /product="esterase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00237"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28030"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525271.1"
FT                   /protein_id="ADK28030.1"
FT                   /translation="MKFLRSIAAFSVATATTVSLLGAAVAPAAGAAEKTPAQISNGTAL
FT                   ADVHFGATPDISPVWREKLDNDRVVEAWAHSPSMNRNIPMVVLKASSPDRPTVYLLNGG
FT                   DGGEGRANWIMQTDAMDFYKGKDVNVVIPMAGKFSYYTDWVSDNAALGGKQKWETFLTK
FT                   ELPGPMESMLKANNKRAIIGMSMSATSSLLLAEHAKGFYDAVGSFSGCAATSNPMAYQF
FT                   LRLTLQRGHATPEQMWGPMGSDYNRYNDAVVMAEDLRGTEVYVSNASGVAGGHDILANP
FT                   RFAGLDPAIASAGLTAVVVEGGLIEAGTNMCTNDLKVRLQSLNIPADFNLRNTGTHSWS
FT                   YWQDDLRASWATLERAFNK"
FT   gene            complement(252901..253164)
FT                   /locus_tag="CPFRC_01230"
FT   CDS_pept        complement(252901..253164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01230"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400950.1"
FT                   /protein_id="QGW57312.1"
FT                   /translation="MYLCPIRNPPTNKKPHLGGYNAPLSLPQNGALIFPFLRNLTHAIL
FT                   EKTLYEQAPEPALHTKITQALSSAMQRPACVITYEFLLKQPD"
FT   gene            253208..254617
FT                   /gene="lpdA"
FT                   /locus_tag="CPFRC_01235"
FT                   /old_locus_tag="cpfrc_00239"
FT   CDS_pept        253208..254617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="CPFRC_01235"
FT                   /old_locus_tag="cpfrc_00239"
FT                   /product="dihydrolipoyl dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00239"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28032"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004566447.1"
FT                   /protein_id="ADK28032.1"
FT                   /translation="MTEHYDVVVLGAGPGGYVAAIRAAQLGKKVAVVEKQYWGGVCLNV
FT                   GCIPSKALLKNAEVAHIFNHEAKTFGISGDVSFDFGVAHKRSRKVSSGIVKGVHYLMKK
FT                   NKITEIDGLGSFKDAKTIEISEGKDAGKTVTFDDCIIATGSVVCSLPGVEIGGNIVSFE
FT                   EQILKEEAPKSMVIVGAGAIGMEFAYVLANYGVEITIVEFMDRVLPNEDADVSKEIAKQ
FT                   YKKLGVKLLTGHKTTAIRDNGQGVEVDVESKDGSKSETIKAERVMVSIGFAPRVEGYGL
FT                   ENTGVKLTDRGAIQIDDFMRTNVDHIYAIGDVTAKLQLAHVAEAQGVVAAETIAGAETQ
FT                   ELGDYMMMPRATFCNPQVASFGYTEEQAKEKFAGREIKSATFPFSANGKAQGLGESAGF
FT                   VKIVADAEFGELLGAHMVGANVSELLPELTLAQRFDLTAEEIGRNVHTHPTLSEAMKEA
FT                   AEGIMGHMINL"
FT   gene            complement(254686..256113)
FT                   /locus_tag="CPFRC_01240"
FT                   /old_locus_tag="cpfrc_00240"
FT   CDS_pept        complement(254686..256113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01240"
FT                   /old_locus_tag="cpfrc_00240"
FT                   /product="ImmA/IrrE family metallo-endopeptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28033"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241100.1"
FT                   /protein_id="ADK28033.1"
FT                   /translation="MSKTYVGSRLRQLRKERGLSQANLAGTLELSASYVNQIEHDVRPL
FT                   TLPVLHRITEVFGVDATFFSKDDASRLLAEVHDVMLDKELCPEDIDLQELSDLVDHHPD
FT                   IARAVVEMHRRYRNVRDKLSAATDARLVNSLDETRTISGALSMPHDEVRDFFYARQNYL
FT                   DDLDHTAEAISAELGITTFNIRANEAALIDRLESRHGVTIKAGRDIGSTLHHFDTQTRV
FT                   LTLSTRLITGQRAFRLATELAFLEANERIDAYLADAYFTSKEARTLARRGIASYFAAAV
FT                   MLPYRLFHAEAERSGYDIEYLCQMFGVGYETICHRLSTLQRPNLRGIPFTFVRVDRAGN
FT                   ISKRQSATGFHFTHAGGTCPLWNVYETFTSPGTIMRQLAQMPDGRNYLWVARTVRHHQG
FT                   RFGETGKMFSIGLGCEARHAARTVYAHGLDVKTFANAVPIGAGCRVCTREDCAQRAFPA
FT                   VNKLIAIDAHMSSVAPY"
FT   gene            256589..257347
FT                   /locus_tag="CPFRC_01245"
FT                   /old_locus_tag="cpfrc_00241"
FT   CDS_pept        256589..257347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01245"
FT                   /old_locus_tag="cpfrc_00241"
FT                   /product="succinate dehydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28034"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558565.1"
FT                   /protein_id="ADK28034.1"
FT                   /translation="MTVNNIDRDAIAHGKITEKPLRERPKFPTWALKLTMAVTGLIFCF
FT                   FVVFHMVGNLKVFLPFYEDGTHPIDVYGEWLRNLLYPLFPHGAFLWLFRITLLLCIVLH
FT                   IYGAFALIGRSSRSRGKFRRTNLMGGMNSFTTRTMLVTGVILLAFIVFHILDLTVGATP
FT                   AASEVFEHGHIYANMVASFSRWPVTIFYIIAMVTLFMHLSHGIWLAASDLGITGKRWRA
FT                   IILFLAYLVPAIVMIGNIAIPLSIACGWIS"
FT   gene            257366..259381
FT                   /gene="sdhA"
FT                   /locus_tag="CPFRC_01250"
FT                   /old_locus_tag="cpfrc_00242"
FT   CDS_pept        257366..259381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="CPFRC_01250"
FT                   /old_locus_tag="cpfrc_00242"
FT                   /product="succinate dehydrogenase (quinone) flavoprotein
FT                   subunit"
FT                   /EC_number="1.3.5.1"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00242"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28035"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599619.1"
FT                   /protein_id="ADK28035.1"
FT                   /translation="MSFNSETATRPEFTQPASIVDGVKLGSILESNEPKGVPTKDMWEY
FT                   QKDHMNLVSPLNRRKFTVLVVGTGLSGGGAAAALGELGYNVKVFTYHDAPRRAHSIAAQ
FT                   GGVNSARGKKVDNDGAYRHVKDTVKGGDYRCRESDCWRLAYESVRVIDHMNAIGAPFAR
FT                   EYGGTLATRSFGGVQVSRTYYTRGQTGQQLQLSGAAALQRQIGLGTVEIFTHADMHDLI
FT                   LTDENGKKACRGIVTRNLITGELTPHTGHAVILATGGYGNVYHMSTLAKNSNASAMMRA
FT                   YELGAYLASPSFIQFHPTGLPVNSEWQSKTILMSESLRNDGRIWSPLEPKDDRDPNTIP
FT                   EEERDYFLERRYPAFGNLVPRDVASRAISQQINKGLGVGPLHNSAYLDFRDSIERLGEN
FT                   TIRERYSNLFQMYEEAIGENPFKAPMRIAPTCHFTMGGLWTDFNEMTSIDGLFAAGECS
FT                   WTYHGANRLGANSLLSASVDGWFTLPFTIPNYLANHLGEAKLAEDAPEAVAAVARAQAR
FT                   IDKLMNIKGDDPHGPEHYHRQLGDILYFSCGVARNVEDLKTGIEKIRKLRKEFWSNLRI
FT                   TGEAEEMNQVLEYACRVADYIDLGELMCVDALDRDESCGAHFREDHLSSEGEAERDDEN
FT                   WCFVSAWEPGAQEHEFIRHAEPLTFESIPLMTRNYK"
FT   gene            259381..260130
FT                   /locus_tag="CPFRC_01255"
FT                   /old_locus_tag="cpfrc_00243"
FT   CDS_pept        259381..260130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01255"
FT                   /old_locus_tag="cpfrc_00243"
FT                   /product="succinate dehydrogenase/fumarate reductase
FT                   iron-sulfur subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00243"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28036"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010267267.1"
FT                   /protein_id="ADK28036.1"
FT                   /translation="MKLHLEIWRQAGPHSEGHFESIDVEDAVAQMSILELLDHVNTGLV
FT                   EEGKEPFVFASDCREGICGTCGLLVNGRPHGLDKNKPSCQQRLDHVADGSTLKIEPFRS
FT                   AAYPVIKDLAVDRSALDRVMQKGGYVSINAGTAPDADTIYQNHEKAELALDHAACIGCG
FT                   ACVAACPNGAAHLFTGAKLVHLALMPLGREERGKRARNMIDELETNFGHCSLYGECADV
FT                   CPAGIPLSAVAAINKERARAFFRGKDD"
FT   gene            260192..260542
FT                   /locus_tag="CPFRC_01260"
FT                   /old_locus_tag="cpfrc_00244"
FT   CDS_pept        260192..260542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01260"
FT                   /old_locus_tag="cpfrc_00244"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00244"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28037"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910695.1"
FT                   /protein_id="ADK28037.1"
FT                   /translation="MSHSAPATQETAGYPVFEGRMHYIDGYDPASLWAPHSSLQRTSTW
FT                   VGMGAILVSLAGFGALIFGLGAASVGSQDAWATYVIIGAVLGFALLIGGFLLVHHGRRN
FT                   YRQYRAETGRMN"
FT   gene            260801..262108
FT                   /locus_tag="CPFRC_01265"
FT                   /old_locus_tag="cpfrc_00245"
FT   CDS_pept        260801..262108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01265"
FT                   /old_locus_tag="cpfrc_00245"
FT                   /product="DUF445 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28038"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300425.1"
FT                   /protein_id="ADK28038.2"
FT                   /translation="MAQHAAPRGLAVPGPPPEAEAEKRRALRKHKTIATGLLFVAAAIF
FT                   LSCQWYTSVTDPTPAWVGFVRAAAEAGMVGGLADWFAVTALFRYPLGIKIPHTAIVRRK
FT                   KDQVGVALSGFVSENFLNAEQITEKVSQAHVASRIGEWLSEPDNAETVSREVGAFTAKA
FT                   VRALDPQDAEAVIKKAIVEKLAEPEWGPPLGRLLQQLNQGGQTEPIVDQLVSWLHKKAL
FT                   TSESLILKILGERAPSWAPKFVNELVGERVYRELIQWTAAVKSDKNHEARQAIRRFLEK
FT                   FADDLQTDPVLIQKVEDVKHDVMGSAPVQDAASTIWAHVSKNVILAVEDADSLLRQKIK
FT                   EYALEWGNRIHSDDALRADLGARITKAAAFLADNYADQVTSIISETIERWDADEASDKI
FT                   ELMVGKDLQYIRLNGTVVGALAGLAIYTVSYSLFGV"
FT   gene            262170..262460
FT                   /locus_tag="CPFRC_01270"
FT                   /old_locus_tag="cpfrc_00246"
FT   CDS_pept        262170..262460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01270"
FT                   /old_locus_tag="cpfrc_00246"
FT                   /product="DUF2516 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00246"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28039"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241106.1"
FT                   /protein_id="ADK28039.1"
FT                   /translation="MTFVFLIFGYLLKAAVYLAVAAALIGAGLAAATRADAFEAGDRQN
FT                   KWIWVGLLLLAALMVYLKVQFLSWIGLVIIGLYWFDVRPQIKNILNGNYGW"
FT   gene            262468..263043
FT                   /locus_tag="CPFRC_01275"
FT                   /old_locus_tag="cpfrc_00247"
FT   CDS_pept        262468..263043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01275"
FT                   /old_locus_tag="cpfrc_00247"
FT                   /product="aminotransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00247"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28040"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241107.1"
FT                   /protein_id="ADK28040.1"
FT                   /translation="MASDKTVVVTLLDPLATADDVKQLAATARQQGMGICVEPSLLHAI
FT                   DAATEHAEQFPVVSWAGYPTGKHHVLIKASEARLAVQSGATMVIYVPDPASLIHTTGAA
FT                   FIGEIVAAREAVPHPAQLAVLVDDTPLGEELRARAHEWLAKVGVDAVVSYSVGDHEKSG
FT                   IPLYVLCDISEAPVHKAAGAHGVLVTGL"
FT   gene            complement(263040..263888)
FT                   /locus_tag="CPFRC_01280"
FT                   /old_locus_tag="cpfrc_00248"
FT   CDS_pept        complement(263040..263888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01280"
FT                   /old_locus_tag="cpfrc_00248"
FT                   /product="DUF2993 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00248"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28041"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366415.1"
FT                   /protein_id="ADK28041.1"
FT                   /translation="MSKTIGSRISKLILTIIVVLMVLLLLAEFGVRWSISKQLKDAVGS
FT                   NSTGQEASISFGPTPLLFSAVTQNIPSVTIESPSTVNIKHPGGANAVPEVTGTPQAFIN
FT                   VDSLNISDPDNPVAASLSLRTTLADDYLLAVLQKSIAENQTHQPAPTEGKDNELGALAG
FT                   TFLQQLIQVTGITSNPADGTVKVDITGGAAKLTLKPEAVDGRLSFTATNASFLGVELPS
FT                   TVSDALTKGLRDQASTMAGNLKIKSVKVVEHGVTIEVDGENVNLNELGKEKDQQPVAPT
FT                   R"
FT   gene            complement(263980..264849)
FT                   /gene="pflA"
FT                   /locus_tag="CPFRC_01285"
FT                   /old_locus_tag="cpfrc_00249"
FT   CDS_pept        complement(263980..264849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflA"
FT                   /locus_tag="CPFRC_01285"
FT                   /old_locus_tag="cpfrc_00249"
FT                   /product="pyruvate formate lyase-activating protein"
FT                   /EC_number="1.97.1.4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00249"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28042"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799966.1"
FT                   /protein_id="ADK28042.1"
FT                   /translation="MADGINSTVTVERSDGPRLRGTAAGIGTDLELEDVSHKELIEARR
FT                   TGDIALVHSWELVTAVDGPGTRMTMFMAGCPLRCLYCHNPDTMQMKKGTLERVEDIIKK
FT                   IKRYRRVFKASGGGLTISGGEPLFQIAFTRRVLKEVHDAGIHTTIDTSGYLGARLSDED
FT                   LENIDLVLLDVKAGDEETYRRVTGRELQPTIDFGNRLHAVGKPVWIRFVLVPGLTDSPE
FT                   NINKVADIVEQWKDNVERVEVLPFHNMGADKWHELNLQYDLEDVKPPTEESVAFTKNVF
FT                   RSRGLLVP"
FT   gene            complement(265031..265282)
FT                   /gene="grcA"
FT                   /locus_tag="CPFRC_01290"
FT                   /old_locus_tag="cpfrc_00250"
FT   CDS_pept        complement(265031..265282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grcA"
FT                   /locus_tag="CPFRC_01290"
FT                   /old_locus_tag="cpfrc_00250"
FT                   /product="autonomous glycyl radical cofactor GrcA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28043"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910701.1"
FT                   /protein_id="ADK28043.1"
FT                   /translation="MSSKTFEERLNDMKTQRNENNANAGLYHANINVLDQKTLEDAMEN
FT                   PDKYPNLTVRVSGYAVNFVKLTREQQLDVLSRTFHHSA"
FT   gene            complement(265334..267430)
FT                   /gene="pflB"
FT                   /locus_tag="CPFRC_01295"
FT                   /old_locus_tag="cpfrc_00251"
FT   CDS_pept        complement(265334..267430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflB"
FT                   /locus_tag="CPFRC_01295"
FT                   /old_locus_tag="cpfrc_00251"
FT                   /product="formate C-acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00251"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28044"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004566466.1"
FT                   /protein_id="ADK28044.2"
FT                   /translation="MTTAQQETNVSAWEGFAAGPWQEDIDVRDFIQRNYTPYDDDASFL
FT                   AGPTEKTLRVWDTLEKNYLSVERKKRVFDVDTDTPADIDAFPAGYISEDDNVIVGLQTD
FT                   VPLKRAMMPFGGWRMVETAIKEAGKEANEDIKNIFTKYRKTHNEAVFDIYTPRIRAARS
FT                   SHIITGLPDAYGRGRIIGDYRRVALYGVDFLIEEKNRAKDAVATENFSEHWARYREEHS
FT                   EQIKALKKLKIMAAAYGFDISRPAKTAQEAVQWTYFAYLASVKSQDGAAMSIGRLSAFL
FT                   DIYFERDLASGLITEEDAQEMIDALVIKLRIVRFLRTIDYDQIFSGDPYWATWSDAGFA
FT                   EDGRSMVTKTSFRLLQTLRNLGPAPEPNITIFWDPELPEGYKDFCAAISIETSSIQYES
FT                   DKQIRDQWGDDAAIACCVSPMAIGKQMQFFGARVNSAKSLLYAMNGGRDEVSGKQITEP
FT                   GLFAPIQGDGPLDFDEVWEKYENMLDWVVGTYIEALNIIHFCHDRYAYESIEMALHDSN
FT                   IVRTMGCGIAGLAIVADSLSAIKYAKVTPVRDETGLIVDYITEGDFPRYGNDDDRVDDI
FT                   AATIVHTVMSKIKEIPLYRDAIPTQSVLTITSNVVYGKATGAFPSGHKAGTPFSPGANP
FT                   ENGADTHGMVASMLSVGKLDYQDALDGISLTNTITPSGLGRTADEQVKNLVGILDAGFI
FT                   MDEE"
FT   gene            complement(268005..268805)
FT                   /locus_tag="CPFRC_01300"
FT                   /old_locus_tag="cpfrc_00252"
FT   CDS_pept        complement(268005..268805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01300"
FT                   /old_locus_tag="cpfrc_00252"
FT                   /product="class I SAM-dependent methyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00252"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28045"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400954.1"
FT                   /protein_id="ADK28045.1"
FT                   /translation="MADHAHNLRASFGQGRPSSRPVGVITRGTTGYNRLRRCDRWMAHH
FT                   PDIRTALRRAQNPLALDVGYGASFTTTVEWARWLRTIRLNTQVTGLEIDPERVLPPRDG
FT                   VTFELGGFELAGYRPTIVRAFNVLRQYDVDQVHAAWDMVTSRLQPGGFFIEGTCDELGR
FT                   RSTWVLLDSSGPLSLTLAWDPFDVERPSDIAERLPKALIHRNVPGEKIHQLLSLADAAW
FT                   NRSDPWASYGPRVRWRAARASLVEQGISLMPIRRPVRDNLITVP"
FT   gene            complement(268828..269331)
FT                   /locus_tag="CPFRC_01305"
FT                   /old_locus_tag="cpfrc_00253"
FT   CDS_pept        complement(268828..269331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01305"
FT                   /old_locus_tag="cpfrc_00253"
FT                   /product="DUF2505 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00253"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28046"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910704.1"
FT                   /protein_id="ADK28046.1"
FT                   /translation="MTTRSENTVTINQPAEKVHAALTNPDYWAFVVENLSPEPGQVHEF
FT                   ADANGGAVATLFEVLPLEILPEAVRAMISQALKVKRVVTVGGLNGDTAPISYTADVKGT
FT                   PVDFNGEISLTGAGQSTTLSYANEVTVNIPFMGAAIEPKIGEALGELFQNEGNLTAQWI
FT                   SENL"
FT   gene            269355..270494
FT                   /locus_tag="CPFRC_01310"
FT                   /old_locus_tag="cpfrc_00254"
FT   CDS_pept        269355..270494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01310"
FT                   /old_locus_tag="cpfrc_00254"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00254"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28047"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835870.1"
FT                   /protein_id="ADK28047.1"
FT                   /translation="MTDTSLAQTFAEIRPAIEQHADIRVDSLSFSELTTLHLGGTPIAA
FT                   VRCGSRASVVHAVKLLDAHRIPLLIVGGGSNLVIADGDIPVVAVIVECKEMSADMHTGK
FT                   LVADAGVVWDEVVAFAVEAGLGGIECLSGIPGSAGATPVQNVGAYGVEIADVLVSVELL
FT                   DRATGEVSEVPAAELDLAYRYSNLKFTGRGVVLGITLQLALDGLSAPLRFGELARLLGV
FT                   TATGGEQIRWNSREVREAVLQLRRGKGMVYDPDDHDTWSAGSFFTNPIISDALLASVRT
FT                   RVAELCTPEDAAAMPCYAAGSGAWKLSAAWLIDRAGYKKGYPEGAVARLSTKHTLALTN
FT                   QGNANTADLVALARDIRDGVQETFGVALEPEPVWIGVEF"
FT   gene            complement(270589..272295)
FT                   /locus_tag="CPFRC_01315"
FT                   /old_locus_tag="cpfrc_00255"
FT   CDS_pept        complement(270589..272295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01315"
FT                   /old_locus_tag="cpfrc_00255"
FT                   /product="AMP-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28048"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599647.1"
FT                   /protein_id="ADK28048.1"
FT                   /translation="MSAFETKAWLQYYPSWTPHSLDYGDTTLLDIYDNNLAINADKPAT
FT                   YFFGKRQSYAELDKQVRSAAAGLRALGVRAGDRVAICLPNCPQHVAAHYAVLKLGAIVV
FT                   EHNPLYTAHELEAPFTDHGARVAIVWDKAAPTLEKLRRTTPLETIVSVNMIDAMPPLQK
FT                   YALKLPIPTLMKKRDALTAPAPNTIPWQILTGSALGGQGEDIVSCPEVTKASVALILYT
FT                   SGTTGAPKGAQLTHGGLFANLLQGKAWIQGLGDQDERLLGAIPMFHAYGVTIVLNLAIY
FT                   IGGEMVLLPAPQIPLIMKTMKKEPVTWVPGVPTLYQKIAEAAEKSGISISSVRNSFSGA
FT                   SALPVDTVAYWEKLTSGLLVEGYGLTETSPVIVGNPMTSDRRPGYVGIPFPDTEVRIAN
FT                   PENLDETMPDGQEGEILVRGPQVFAGYLNQPEATANSFHNDWYRTGDVGIMEEDGFIRL
FT                   VARIKEVIITGGFNVYPAEVEDVLRQHPDVLDAAVVGLPRSDGSESVVAAITLNEGAAL
FT                   DPEGLKDYCRENLTRYKVPRTFYHFEELAKDQLGKIRRREVQAELIRKLKK"
FT   gene            272614..273885
FT                   /gene="mshA"
FT                   /locus_tag="CPFRC_01320"
FT                   /old_locus_tag="cpfrc_00256"
FT   CDS_pept        272614..273885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshA"
FT                   /locus_tag="CPFRC_01320"
FT                   /old_locus_tag="cpfrc_00256"
FT                   /product="D-inositol-3-phosphate glycosyltransferase"
FT                   /EC_number="2.4.1.250"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00256"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28049"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_016829999.1"
FT                   /protein_id="ADK28049.1"
FT                   /translation="MAYMRIAMISMHTSPLQQPGSGDAGGMNVYVLSMARELARRGLEV
FT                   DVFTRATRLSHGETVDVEPGLRVINIVAGPYEGLSKEELPTQLAAFAGGIVQFVKCNAL
FT                   AYDVVHSHYWLSGQVGWLLRDLWEIPLVHTSHTLAAVKNFHSSTSDMRESEARRICEQQ
FT                   LVDNADILVVNTPEETSDLVHHYDALPDKVAVIAPGTDISLFTPGTQRNTEVSRRCLGI
FT                   PLHIKVIAFVGRLQEFKGPQVLLAAVAELLRRDPDRELRVIFCGGPSGAAATVEHYIEL
FT                   SRRLGLGKQVRFLDPRPPEELVSIYQAADIVAVPSYNESFGLVAMEAQASGTPVVAARV
FT                   GGLSIAVSDGETGLLVDGHAPEAWADALAQLLDDDALRIQMGEDAVGHAANFTWAASAE
FT                   KLEEVYEAALDIGVDECKERHAEG"
FT   gene            274009..274755
FT                   /locus_tag="CPFRC_01325"
FT                   /old_locus_tag="cpfrc_00257"
FT   CDS_pept        274009..274755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01325"
FT                   /old_locus_tag="cpfrc_00257"
FT                   /product="phosphoglyceromutase"
FT                   /EC_number="5.4.2.11"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00257"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28050"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599649.1"
FT                   /protein_id="ADK28050.1"
FT                   /translation="MTIGKLILLRHGQSEWNASNQFTGWVDVNLTEQGEAEAKRGGEML
FT                   KQQDVLPTVVYTSLLRRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETK
FT                   DKYGADQFMEWRRSYGTPPPELEDSSEFSQANDPRYADLSQVPRTECLKDVVERFVPYF
FT                   EEEILPRAKKGETVLIAAHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDQEGKV
FT                   LNPGGTYLDPEAAAAGAAAVAAQGGK"
FT   gene            274776..276014
FT                   /locus_tag="CPFRC_01330"
FT                   /old_locus_tag="cpfrc_00258"
FT   CDS_pept        274776..276014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01330"
FT                   /old_locus_tag="cpfrc_00258"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00258"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28051"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366422.1"
FT                   /protein_id="ADK28051.1"
FT                   /translation="MNVLLAFVLGAALMGLALPAFKWVQGRSGRYRRALASAHANQVTT
FT                   VGQMLHLAVQGSPTGVTVVDRTGSVLLSNARAHDMGIVHERTLNPDIWALSQEVFEDRE
FT                   THSLELAIADRRTRITSVRAMVKPLTLVDDRYVIVFSTDESENQRMEAARRDFVANVSH
FT                   ELKTPVGGMALLAEAITQGSDDQEQVEYFGKRLQKEAHRLADMINELISLSKLQGAEAL
FT                   PDLQPVAVDEIIDEALSRNYLAAENAGIELTRGKKCGVEVMGDRSLLVTAVSNLISNAI
FT                   NYSPNAMPVSVTTKVLFDELVLIRVIDSGIGISPENQGRVFERFFRVDKARSRSTGGTG
FT                   LGLAIVKHVAANHGGDVKLWSRPGTGSTFTIDLPIYHPEEPAPVDSVDTESDSDLLLYP
FT                   SASRGDSRRKDKA"
FT   gene            276015..276710
FT                   /locus_tag="CPFRC_01335"
FT                   /old_locus_tag="cpfrc_00259"
FT   CDS_pept        276015..276710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01335"
FT                   /old_locus_tag="cpfrc_00259"
FT                   /product="response regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00259"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28052"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910710.1"
FT                   /protein_id="ADK28052.1"
FT                   /translation="MITILLVEDEESLADPLAFLLRKEGFEVVVAGDGPTALVEFEKND
FT                   IDIVLLDLMLPGMSGTDVCKRLRKVSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYS
FT                   ARELIARIRAVLRRGGEPQVADYEEEGDDILGGGRVRMDVERHTVTVAGENISMPLKEF
FT                   DLLEYLMRNSGRVLTRGQLIDRIWGADYVGDTKTLDVHVKRLRSKIEEEPSSPKHLVTV
FT                   RGLGYKFED"
FT   gene            complement(276707..277639)
FT                   /locus_tag="CPFRC_01340"
FT                   /old_locus_tag="cpfrc_00260"
FT   CDS_pept        complement(276707..277639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01340"
FT                   /old_locus_tag="cpfrc_00260"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28053"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241120.1"
FT                   /protein_id="ADK28053.1"
FT                   /translation="MNDPKTTPESAPVHLGFPEFSPAADSIRRGDELPPDFPRQWFEFT
FT                   NPEDPTHQFSIDLTWIESTYSCAFGTESCKGIDASLPSVGCCGHGAFLSDDEDREQLLH
FT                   AVTQMPARYWQLRPEETDAFLSADDPAELEPWLVWDELDDDNGEPEPALKTTVVDGACI
FT                   FANREGWATGTGCAIHQWALDAGQDLTVVKPEVCWQLPLRRLEAYEERADGVEILRTTI
FT                   TEYERRGWGNGGEDFDWYCTTAPGCHENADPLWVTHESELRALMGDSSYEFLAHICRTR
FT                   DNARSNGVPSSIFSPHPASVAAARPQTES"
FT   gene            277672..278628
FT                   /locus_tag="CPFRC_01345"
FT                   /old_locus_tag="cpfrc_00261"
FT   CDS_pept        277672..278628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01345"
FT                   /old_locus_tag="cpfrc_00261"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28054"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910712.1"
FT                   /protein_id="ADK28054.1"
FT                   /translation="MRLGVLDVGSNTVHLVAVDAQQGGRPTPMSDWKTTLKLVGYLDKK
FT                   GAITAAGVDKLVDSVAEAAALAQQLGCEELMPFATSAVRSATNSDEVLAEVARHTGINL
FT                   EVLSGTDEAKLTFLAVRRWYGWSAGRIINLDIGGGSLEMSTGENENPDAAFSLDLGAAR
FT                   LTHDWFDTDPPERRKINLLRDFIDAELVESAKILRTYGEARLAVGTSKTFRTLGRLTGA
FT                   SPSPAGLFIKRELSAPGLRQLIAFISRMTAADRAELEGVSANRSQQIVAGALVAEAAMR
FT                   ALGIEHLEICPWALREGVILRRMEQGIVPKETPLGEK"
FT   gene            278634..279740
FT                   /locus_tag="CPFRC_01350"
FT                   /old_locus_tag="cpfrc_00262"
FT   CDS_pept        278634..279740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01350"
FT                   /old_locus_tag="cpfrc_00262"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00262"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28055"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241122.1"
FT                   /protein_id="ADK28055.1"
FT                   /translation="MSEKQLTVAELLARSGKNGGSSETSRRRRRNLEDGGISVAELTGS
FT                   IPKVNSKPTESKHSSQPIDVPAAAAASSNTRESDSAAQGPHSHPESFVDSASAAPFADA
FT                   FPTTSRTQALKRDAAFTAVKEQAEKTQERQAADKAEELLAADSAETSTTPENTAAAIPS
FT                   KEQTIVLSVVDEKDPVRLTTDSFPAVSQNSQREEVQVAADSLGMPAVASAEPTDAPSSE
FT                   TLNAAEETSTFAVVEDEEPYGREDDYEAYEDYAAYEEYEDYECAEEFNDEYDDYDEYYE
FT                   EDEEERVSAMGVILMALAGIVLGVVIFLGFQQLWGALGKAIVAVLAVAVTGAIVGVVHA
FT                   LRTERDRESMILAGVAGLIMTFGPLLLS"
FT   gene            279838..280641
FT                   /gene="proC"
FT                   /locus_tag="CPFRC_01355"
FT                   /old_locus_tag="cpfrc_00263"
FT   CDS_pept        279838..280641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="CPFRC_01355"
FT                   /old_locus_tag="cpfrc_00263"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00263"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28056"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241123.1"
FT                   /protein_id="ADK28056.1"
FT                   /translation="MTSIAVIGGGKIGEALISGLIAAGMNPKNINVTNRNAEHGQALKE
FT                   KYGVVSFTENIPAVDEVDVVFLCVKPKQIIKVVEEIADAVDNNSNTTVVSMAAGVNTAA
FT                   IEEILAAGSPVIRVMPNTPMLVGKGNSAVAPGRFADQSAVEQVRKLLETVGNVTLIEES
FT                   DLDAVVALSGSSPAYLFLFAEALIDAGVNLGLNREQSKELAVNAFYGAAAMLKETGEEP
FT                   AQLRANVCSPAGTTIAAIREMEESGLRGMVYRAAEAAAKRNGELG"
FT   gene            complement(280646..280843)
FT                   /locus_tag="CPFRC_01360"
FT   CDS_pept        complement(280646..280843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01360"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366427.1"
FT                   /protein_id="QGW57313.1"
FT                   /translation="MKRVALATHLLIYFPTRNISHANTFAFSVETTGHRENTKVSTLKY
FT                   RFNKKGKAKGVEVFFYPFSF"
FT   gene            280928..281119
FT                   /locus_tag="CPFRC_01365"
FT                   /old_locus_tag="cpfrc_00264"
FT   CDS_pept        280928..281119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01365"
FT                   /old_locus_tag="cpfrc_00264"
FT                   /product="excisionase family DNA-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00264"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28057"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599659.1"
FT                   /protein_id="ADK28057.1"
FT                   /translation="MAREDNGTFLTVAEVAEIMRVSKMTVYRLVHSGELPAVRVGRSFR
FT                   VHEKAVNEYLDASYYDVG"
FT   gene            281431..281532
FT                   /locus_tag="CPFRC_01370"
FT                   /old_locus_tag="cpfrc_00265"
FT   CDS_pept        281431..281532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01370"
FT                   /old_locus_tag="cpfrc_00265"
FT                   /product="AURKAIP1/COX24 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28058"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_003402602.1"
FT                   /protein_id="ADK28058.1"
FT                   /translation="MGSVIKKRRKRMSKKKHRKLLRRTRVQRRKLGK"
FT   gene            281615..282496
FT                   /locus_tag="CPFRC_01375"
FT                   /old_locus_tag="cpfrc_00266"
FT   CDS_pept        281615..282496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01375"
FT                   /old_locus_tag="cpfrc_00266"
FT                   /product="thioredoxin domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00266"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28059"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241125.1"
FT                   /protein_id="ADK28059.1"
FT                   /translation="MFSIKRPAVLALLIVILLIVGIGAYTLGRGSAAKDGDTSANSAGS
FT                   SQGAGPSLPPGFTGKTGSSRVSPGTKTDGPVALANGSYDAMIYGPGKELKSAEDILNVH
FT                   RRNAKDPFALGALDAPVVISEFSDFECPFCAKWSNETEPTIIKEYVEKGFVRIEWNDLP
FT                   INGPDAVSAAKAGRAAAAQGKFNEFRSALFQASKTIKGHPENKLTNFEEFAREAGVKDM
FT                   ARFSREASDATYDSVVDKAREYAGSLGINGTPGFVVGTQYVSGAQPTEVFIRAIEAELA
FT                   KVADGKVAVPSV"
FT   gene            282489..283313
FT                   /locus_tag="CPFRC_01380"
FT                   /old_locus_tag="cpfrc_00267"
FT   CDS_pept        282489..283313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01380"
FT                   /old_locus_tag="cpfrc_00267"
FT                   /product="cytochrome c biogenesis protein CcdA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00267"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28060"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366430.1"
FT                   /protein_id="ADK28060.2"
FT                   /translation="MSDIGLLGAFLGGILALLSPCSALLLPAFFAYAFQRSSQIMARTG
FT                   VFFLGLAAVLVPVGTAAGRLGGFLALHRETLIIGGGIVIVALGIFTFFGGGITLPGLSG
FT                   LAGRVRGRGWLSVFLLGAAYGFSGFCAGPLLGAVLTTAVVSASSAYGALVLGCYALGMV
FT                   VPLVVLALFWERIPHGALGGKVVHIGRLKLNTMSMISGVIFVIIGLVFIFTHATTGLPG
FT                   LLGIETQSKIQAWALDVAANVSNLTSVLIALGIIAVGLVIYILRTPEKGKRD"
FT   gene            complement(283310..284353)
FT                   /locus_tag="CPFRC_01385"
FT                   /old_locus_tag="cpfrc_00268"
FT   CDS_pept        complement(283310..284353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01385"
FT                   /old_locus_tag="cpfrc_00268"
FT                   /product="HAD-IB family hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00268"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28061"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014317526.1"
FT                   /protein_id="ADK28061.1"
FT                   /translation="MSISQPDPTWPQTPQEFLAGWSTSRGNLRRFFEEHALPPIDAQAQ
FT                   REAGEAAAALAAAEIYGIELDQYTSGLESVSGSFEAAGATHVTSPDPDIPQDLGAAAFF
FT                   DIDNTLIQGSSLVVFALGLAKKRYFKLSEILPVAWKQIKFRVTGAENAADVAEGRKQAL
FT                   EFIKGRRVDELVELCEEIVGNNMSEKLWPGTKSLADQHIAAGQQVWLVSATPVQLAQSL
FT                   AKRLGFTGALGTVAEVKDGVFTGRLVGDILHGPGKLHAVAALATIERLDLSRCTAYSDS
FT                   VNDVPMLSMVGTAVAINPDRPLAKVAKQHGWEMHDYRSLRKAMRTYGLPALITAAFSLG
FT                   GWKAWRR"
FT   gene            284447..284701
FT                   /locus_tag="CPFRC_01390"
FT                   /old_locus_tag="cpfrc_00269"
FT   CDS_pept        284447..284701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01390"
FT                   /old_locus_tag="cpfrc_00269"
FT                   /product="glutaredoxin family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00269"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28062"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366432.1"
FT                   /protein_id="ADK28062.1"
FT                   /translation="MSGVASAREVELMTRKTCGSCQRVAEQIIPVVAAAGAKLSIVDVD
FT                   MDRLLAAEYGDRVPVVVIDGEEFACWEVDNEELAAELAS"
FT   gene            284864..286228
FT                   /locus_tag="CPFRC_01395"
FT                   /old_locus_tag="cpfrc_00270"
FT   CDS_pept        284864..286228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01395"
FT                   /old_locus_tag="cpfrc_00270"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28063"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525281.1"
FT                   /protein_id="ADK28063.1"
FT                   /translation="MSVLVVGMSHRSAPVTLLERLSMNDEVRSQTATDLIARPSLTEAM
FT                   IISTCNRLEVYAMTSSFHTGVNDVVEVLHAVSGVDMDTLRGYLYVRYADAAAEHMMVVA
FT                   SGMDSMVTGEQQIIGQVRTAYQQAIESGTVGPALHGLVQASLHTGKRVHTETDIDDAGA
FT                   SMVSFALDQAMSGAGLSDLRGKKALVLGAGAMASLAATHLGRLGIEGIIFSNRTRNRAE
FT                   RLAEHSREAGVPAEVVDFASRGNALSGVHIAISATGAHTYTISAQDVPEKHLGLIFVDL
FT                   SMPRDINDDVAEIAGVQLVNIEKLHEAKAEGKDADEAAHKIVAEELSAYTSAQRVRGVA
FT                   PAVSALRRHASGLITTELERLKTRTPSMGEEDFEEVQRTIRRVVDKLLHQPTVRVKELA
FT                   ASSGAVSYETALQDLFGLPVEAKSVKLGVRDLPDAEVVALGVSDANKIIRAIKED"
FT   gene            286231..287121
FT                   /gene="hemC"
FT                   /locus_tag="CPFRC_01400"
FT                   /old_locus_tag="cpfrc_00271"
FT   CDS_pept        286231..287121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="CPFRC_01400"
FT                   /old_locus_tag="cpfrc_00271"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00271"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28064"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241130.1"
FT                   /protein_id="ADK28064.1"
FT                   /translation="MTFTIGTRGSLLATTQSGHVRDALISQGYSAELSIVTTPGDVNMA
FT                   PVERIGVGVFTQALRDVLVKGGCDIAVHSFKDLPTQRDPRFHLIVPERADARDCLVARD
FT                   GLTLAELPQGARIGTGAPRRISQIKALRPDVECVPLRGNIDTRMGKVFSGELDAVVLAY
FT                   AGLSRVGRGDEATEVFNPERFLPAPAQGALAIECRVDDAAAVAAINAIRNAEDETCALA
FT                   ERVVLNRLEAGCTAPVAAHSVIIEQELQVTGAVISLDGSKVLRATMTGGLSEAVAIGEK
FT                   VAAKLIQDGAAELLS"
FT   gene            287375..289063
FT                   /locus_tag="CPFRC_01405"
FT                   /old_locus_tag="cpfrc_00272"
FT   CDS_pept        287375..289063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01405"
FT                   /old_locus_tag="cpfrc_00272"
FT                   /product="bifunctional uroporphyrinogen-III
FT                   C-methyltransferase/uroporphyrinogen-III synthase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00272"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28065"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241131.1"
FT                   /protein_id="ADK28065.1"
FT                   /translation="MSSTPQPTPVTPAPEGKVIFVGAGPGNPDLLTVRAREVLSHTAFA
FT                   VVDAEVLPGVRSVVARELDVPMDKVQAAEEEYERLCAEAKEAGARRKPQRPDAPTAAEI
FT                   TEVDDDVPVVEVVEKLKELLSSGEDVIRLVQGNPLSCDRTLEEISAVKQAGLEFHVVPG
FT                   MSLPATVPAFAGIALGSSYTETDVTGEDVDWEQLAAAPQPLVLQATKEDLPTIAAELKS
FT                   RGIEASTPVTVTARGTTRLQRSFDISLGALHKLDGDLAGTLVVTLGKAADERTKYSWWE
FT                   NRSLFGWRVLVPRAKEQAGSMSALLAAQGAIPQEVPTISVEPPRNPAQMEKAVKGIVEG
FT                   RYQWVIFTSVNAVKSVREKIGSFGLDARAFAGVRIGAVGTKTAKAIRELGITPELLPPR
FT                   NRQNAAGLVSVFPEYVEDLDPVGRVLLPRADIATDVLVEGLEGLGWEVDDVVAYRTVRA
FT                   APPSAEVRDMIKSGGFDAVCFTSASTVKNLVGIAGKPHQRTIIACIGPMAAAAAKELGL
FT                   RVDVIPEVADVPHLINGLATHVAQLRAAGQLPPPRKKRRARKNRE"
FT   gene            289110..290117
FT                   /gene="hemB"
FT                   /locus_tag="CPFRC_01410"
FT                   /old_locus_tag="cpfrc_00273"
FT   CDS_pept        289110..290117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="CPFRC_01410"
FT                   /old_locus_tag="cpfrc_00273"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00273"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28066"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599678.1"
FT                   /protein_id="ADK28066.2"
FT                   /translation="MSNADLHLIRRPRRLRSTPVMRELVAETTLRPADLILPMFVADGI
FT                   AEPREISSMPGVYQHTIPSLIEAVREAISVGIKCIDLFGVPLDADKDAQGSQSWAPDGI
FT                   LNRGIRALRQEFGNDVIIMADTCLDEFTDHGHCGVLDTDRFGEAVVDNDATIPLYQKMA
FT                   VAQAEAGAHMVSPSGMMDGQILAIRDALDAHGFQDVAIMAYSAKYASAFYGPFRDAVGS
FT                   SLDGDRRTYQQDPANCRESLMEVDLDIEEGADFVMVKPAMPYLDVLAEVASTSSVPVAA
FT                   YQVSGEYAMLHAAARNNWLDLERVMMESLISIKRAGADQILTYFAVDAAKKLQH"
FT   gene            290125..290706
FT                   /locus_tag="CPFRC_01415"
FT                   /old_locus_tag="cpfrc_00274"
FT   CDS_pept        290125..290706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01415"
FT                   /old_locus_tag="cpfrc_00274"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00274"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28067"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799983.1"
FT                   /protein_id="ADK28067.1"
FT                   /translation="MTNHQQRLERSPSQQTTPNAKRERPDAIRWAVRAWIFAICVEVVH
FT                   QIINIIVGFANKPELISRLKDSMKDENLSPEIMNVAASLSIVLAGLFAFIMLGIIAWLA
FT                   ALLYKSNKSATLARRILTYFSIYFGVRLVTVFLLTPSSPSVPVAVYAVDGCIQIGMGVA
FT                   AIVALIFKMRPESLIWTGEWETSRGKNGRA"
FT   gene            290693..293329
FT                   /locus_tag="CPFRC_01420"
FT                   /old_locus_tag="cpfrc_00275"
FT   CDS_pept        290693..293329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01420"
FT                   /old_locus_tag="cpfrc_00275"
FT                   /product="HAD family hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28068"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300440.1"
FT                   /protein_id="ADK28068.1"
FT                   /translation="MGAPSGSRDSQEGGVPARPLGTQEGLADAIEKAKRAAAQAGINTG
FT                   AFHAIDPEEVAAAAIHAGKTSFAFELKGLTSASSVAEVEEALGELEGVEAKIVYPSSMA
FT                   WVSASRTIDPMMFVDVFQRFGISATLTDSSLRRRLAWSDVEEGRYKRSRRRDRRVSRFG
FT                   SRVDEEERRFELARRAGFLERREDVSRKEPSTAVLFTARSLMTKTRLFTSALFTIPVVA
FT                   ISYSRDLQFDGWQWVLAVLSIPVVFYGAWPFHRATLGGARHGMSALDSASSVAILLAWL
FT                   WSLSMVLFTAVGDPGYRARPKWVAIDPTIFESGALFFDVACGMTLILLAGKLAARRARS
FT                   SLQDDLLKYKPNPASTVTVVSKKRKSGAVGKEDKAIQKLNVGDDVIVPAGELVPVDGIV
FT                   VGGGGTLDGTALGIGSFDVKVNDRVYAGCINGSKNLKVRVLQTGHRTWLAAINRWVVDA
FT                   NVHQNRSDAIATKAASMLVPVSFVIAATDFALWALITNNLNQAFATGLAVLGCVAPAAL
FT                   ATSASLAMRQGIEGAARRGTLIKSGETLRNVDEVDTVIFNRVGAISRPEMSVETVTADR
FT                   GENPDLVLRVAGALAMESGHPVSRALVRAAREARDASTDDSIPGWIEVSHSEVDEEGSF
FT                   RGHVELPVVNSDGEEELRSVEAVLWRPRNLSDLHGRLAAAAVSGSSPLVVRWKNKDRGV
FT                   ITLYNGAKDDAVDAVDALEAMGLETMMLSRDTYPVARRYGDMVGVSHVLAGVQPGRKPQ
FT                   TVRSVRSHGANIAMVGDESVEECYRVANVGIMISAMSGPQGALALEHPAADVVMLKPDV
FT                   APIPRLFHFARRLNRRIRGNLIFAWTYNLLAIVAAVAGVLHPMIAPLLMLGSSVIIEVR
FT                   SHWLRSM"
FT   gene            293463..294509
FT                   /gene="hemE"
FT                   /locus_tag="CPFRC_01425"
FT                   /old_locus_tag="cpfrc_00276"
FT   CDS_pept        293463..294509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="CPFRC_01425"
FT                   /old_locus_tag="cpfrc_00276"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00276"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28069"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523029.1"
FT                   /protein_id="ADK28069.2"
FT                   /translation="MSQPFNAPILDAIQGKTPTRRPVWFMRQAGRSLPEYRKVREGIGM
FT                   LDSCFMPELLAEITLQPVRRHDVDAAILFSDIVVPLKAAGVKVEIIPGRGPVMDRAIQS
FT                   RADVDALPILEEDVLQVARGIEIIRDELTEQQTLIGFAGAPFTLASYLVEGGPSKNHEK
FT                   TKSMMHGDPETWHALMQRLVPTIVRFLRTQIDAGVQAMQFFDSWAGFLTERDYRNHVLP
FT                   YSTQILEEVADVPRIHFGVSTGELLATMSEAGSEVMGVDWRVPLDAAAERIHARSGAKV
FT                   LQGNLDPALLFAGDDVLKAEIERICMEADRAIAAGHATGHIFNLGHGVLPHTDPEAITR
FT                   AVELIHRF"
FT   gene            294577..295962
FT                   /locus_tag="CPFRC_01430"
FT                   /old_locus_tag="cpfrc_00277"
FT   CDS_pept        294577..295962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01430"
FT                   /old_locus_tag="cpfrc_00277"
FT                   /product="protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00277"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28070"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241136.1"
FT                   /protein_id="ADK28070.1"
FT                   /translation="MRIAIIGAGLAGLTAAYEIHKLAPHADVEVFEATDRIGGKLFTVP
FT                   FASGPTDMGAEAYLVFREDTTEFFKELGLEESLRSPSGLPSLLYQGGSLHSMPSNTIMG
FT                   IPGTSEDLGNLVSEETRKRIDSEINAESIEWPQEISLGALLRERLGDDVVDHVVSTLQG
FT                   GVYSSTSDDLSVRATVPQLARALDKLKEEGKPVTITGAVQRLLSEREERNKKRGYTPSV
FT                   FASFAGGYAEMYEALAERSEAKIHIDAFITAVDKKPEGFVLKGAEGVFDKVLLTVPAPT
FT                   AALLLKNLVPEAAQQLKTIKLASSAVVGMKFDNSAGLPDNSGILVATNAQDVRAKAFTF
FT                   SSKKWPHLGERGGALVRASFGRFGEDAIARADEDELVDAALDDLQTITGFDGRAAGLSE
FT                   IFVQRWFGGLPVYGPGHLDTVAAIKKALAQVEGIDATGAWADGVGVPAVIDAAKAAAKR
FT                   ALA"
FT   gene            complement(295969..296805)
FT                   /locus_tag="CPFRC_01435"
FT                   /old_locus_tag="cpfrc_00278"
FT   CDS_pept        complement(295969..296805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01435"
FT                   /old_locus_tag="cpfrc_00278"
FT                   /product="NAD-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00278"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28071"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241137.1"
FT                   /protein_id="ADK28071.1"
FT                   /translation="MTIAFLGTGRMGTELALHLLKEHELVVWNRTPSKAERLVAAGATL
FT                   ASSPEEAVAAADIVVTSLFGPDTVRDVVITPRLIPDGVLWIDTTTVSPEDCIEFAHAVP
FT                   SYVAAPVVGTLGPARAGSLGVYVGGTDEQYRNTAAALVAPWADPERLVLVDAAPKAAVG
FT                   KLLANLALAVSAQGLKEALLLGDSSGLSPEETLTMLRSTGLAFIAGMKHPFVVGERPTA
FT                   PGDFTADAIAKDARLMLNTADQPLPAVASALKSLEEQQQAGHGDEDFSVMLTRRDS"
FT   gene            296892..298217
FT                   /gene="hemL"
FT                   /locus_tag="CPFRC_01440"
FT                   /old_locus_tag="cpfrc_00279"
FT   CDS_pept        296892..298217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="CPFRC_01440"
FT                   /old_locus_tag="cpfrc_00279"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00279"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28072"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366441.1"
FT                   /protein_id="ADK28072.2"
FT                   /translation="MVRMTVIPTSSNVQRSRELFDQACKVTPGGVNSPVRAFGSVGGQA
FT                   RFIASAQGSKLYDVDGNEYVDLVCSWGPMLLGHAHPEIVEAVQKAAEKGLSFGAPTEAE
FT                   VRIANMIVERTSVEEVRMVNSGTEATMSAVRLARGFTGRPKIIKFDGCYHGHVDALLAS
FT                   AGSGVATFALPDSPGVTGASAADTIVVPYNDIEAVAQAFAENDGQIACIIAEAAAGNMG
FT                   TVAPRNDFNAKLKELAHAHGALLILDEVMTGFRTSYNGWFGVDHVAGDLTTFGKVISGG
FT                   LPAAAFGGRADIMKYLAPEGPVYQAGTLSGNPVAVAAGMKSLELATPEVYDIVRANADR
FT                   LAELLSSALEREGVAHHIQRAATMLSIRFAEGEGHNFDQMKSAETFRFSPFFHALMDNG
FT                   IYAPASVFETWFVSAALSDEDFEKIENALRPAAQAAAAANKY"
FT   gene            298226..298834
FT                   /locus_tag="CPFRC_01445"
FT                   /old_locus_tag="cpfrc_00280"
FT   CDS_pept        298226..298834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01445"
FT                   /old_locus_tag="cpfrc_00280"
FT                   /product="histidine phosphatase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28073"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241139.1"
FT                   /protein_id="ADK28073.1"
FT                   /translation="MSTTIVHLIRHGEVFNPERILYGRIPDYHLSSRGHSMAARTASSF
FT                   AGHDVSVLMSSPLERAQETAAPFAEKLGLEVRLDDRLLESGNRFEGLRVKGLRSQLWNP
FT                   VRWPLMANPLLPSWGEHYVDQRDRMMAVVEDARRAAEGHEAILVSHQLPIVCVQRHVQG
FT                   KPLAHNPAARQCNLASVSSLVFEGDQLVDYIYTEPAQEI"
FT   gene            298837..299421
FT                   /locus_tag="CPFRC_01450"
FT                   /old_locus_tag="cpfrc_00281"
FT   CDS_pept        298837..299421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01450"
FT                   /old_locus_tag="cpfrc_00281"
FT                   /product="redoxin domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28074"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241140.1"
FT                   /protein_id="ADK28074.1"
FT                   /translation="MKRTLAATMISSLLVLSACSSEDTAGTDAVAIGGTFQFHSPGGQT
FT                   EIFYEEADRAPVKNISGESLSSDAKISLDDYKDQVVVLNAWGQWCAPCRSESDDLQTVQ
FT                   EYLEKEQRGTVLGINVRDYSKQIAQDFVKDNGLTYPSLYDPPFKSAAQLGGVPAAVVPT
FT                   TIILDKQHRPAAVFLREITAKDVIDVVERIV"
FT   gene            299418..300224
FT                   /locus_tag="CPFRC_01455"
FT                   /old_locus_tag="cpfrc_00282"
FT   CDS_pept        299418..300224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01455"
FT                   /old_locus_tag="cpfrc_00282"
FT                   /product="cytochrome c biogenesis protein CcdA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00282"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28075"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241141.1"
FT                   /protein_id="ADK28075.1"
FT                   /translation="MTDVLASGIGEQIADVAATGPLLLGLAAAALAGLASFASPCVIPL
FT                   VPGYMSYLAGVVGAEMELGEQGPQVAKKGRWRVTGAALLFVLGFTVIFTLATATVFGAI
FT                   SALTLNAETLMRIGGVVTLLMGVVFLGWVPFLQEDKRMAPKRWSTWLGAPLLGGVFALG
FT                   WTPCLGPTLAAIISISAGTEGTTAARGVALILAYCVGLGFPFVAVALGSARAMHGIGVL
FT                   RRHSRTIQIVGGVALIAVGTALVSGTWGIFINWVRQWTVEYGATFI"
FT   gene            300238..301845
FT                   /locus_tag="CPFRC_01460"
FT                   /old_locus_tag="cpfrc_00283"
FT   CDS_pept        300238..301845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01460"
FT                   /old_locus_tag="cpfrc_00283"
FT                   /product="cytochrome C biogenesis protein ResB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00283"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28076"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522675.1"
FT                   /protein_id="ADK28076.1"
FT                   /translation="MSKRTRKLLSYPLKAWHWLTSMRTALALLFLLALASIPGALLPQR
FT                   SLNQSKVTEYIANNGRTAEIYDKLQLFDVFSSTWFTAIFALLFLSLIGCIIPRSWDHYK
FT                   AMKTPPVRAPKNLSRLPLHGEGSVEKPLSQVEEDIRAQLKGWKLAEYTPEEDRAGMRSF
FT                   SAERGYLREFFNLTFHLGLVGMLVAIAMGKLFFYEGQVIIVASDDKTKSTEFCNTATAN
FT                   YDSFRAGSLFDGTGLNPFCFIAHNFSADYLPNGQAKMFSSLVSYAAGEKIFNDTETWQQ
FT                   YTLKVNHPLRIAGDRVYLQGHGYAPTFSVTWPNGEKRTQTVQWQPTDLMNFLSDGVVRF
FT                   DPPAGMYKDAFEKRQNQLAIQGLFAPTASWEGENKALLTSRYPAMTNPAVAIDIYRGDN
FT                   GLDSGRGQNLFSLDSALIHSGQLQKLERVNLSVGQSVTLDNGTVVSFDGAEQFANYQIS
FT                   HDPAQLWVLFFTVIALCSLAGSLLIRRRRIWVRVRPVSSTVTCVETAGLARTDRAGWGR
FT                   EYERIHRRILGLPDPDED"
FT   gene            complement(301849..302610)
FT                   /locus_tag="CPFRC_01465"
FT                   /old_locus_tag="cpfrc_00284"
FT   CDS_pept        complement(301849..302610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01465"
FT                   /old_locus_tag="cpfrc_00284"
FT                   /product="methyltransferase domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00284"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28077"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241143.1"
FT                   /protein_id="ADK28077.1"
FT                   /translation="MTPQELLMAWHEQQTAFIEHRALRTRTLIEVLKARYGDAPISVLD
FT                   LACGPGSLGTEILQELPNATVVGVDRDPVLLRLGAETNQFGERLRFVDANLTDSAWVEQ
FT                   LPATNFDAVISATALHWFAPDQLSQLYQDLTRVVKPGAIFMNADHLLYDAHHNPVLASL
FT                   SETIREDFRARTVSSGVFTWEAWWDAAFQMPGWEKEADLWHQRWANKSATVKVDSTYHL
FT                   AALRSAGCSETGHLYQWLDDYLIYGIWPTAS"
FT   gene            complement(302630..303400)
FT                   /locus_tag="CPFRC_01470"
FT                   /old_locus_tag="cpfrc_00285"
FT   CDS_pept        complement(302630..303400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01470"
FT                   /old_locus_tag="cpfrc_00285"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28078"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300444.1"
FT                   /protein_id="ADK28078.1"
FT                   /translation="MITATDLNITFQGTPILQGVNLSAQGGHTIGIVGPNGSGKTTLLR
FT                   ALYKSLSPQSGRIEIDTEDLSSLTPRRIAQKVAVVAQERDSSLPLRVSDCVGLGRLAQS
FT                   TLLSYSNAHNHMIVASALEQVGLSGFGSRLISELSGGERQRVLIARAIAQQADHVLLDE
FT                   PTNHLDLAHQFAIMELVTTLRSTSVVVLHDLNLAARFCTEVIVLNHGMVVAQGKPDHVF
FT                   NAEMFAEVFGLHAQILQHRGSPQFLFSPLSSRAS"
FT   gene            complement(303407..304393)
FT                   /locus_tag="CPFRC_01475"
FT                   /old_locus_tag="cpfrc_00286"
FT   CDS_pept        complement(303407..304393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01475"
FT                   /old_locus_tag="cpfrc_00286"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00286"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28079"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523030.1"
FT                   /protein_id="ADK28079.1"
FT                   /translation="MKKTTAQYLALVSVAALALTACGESAADKQAAHDKTAASEAKIQV
FT                   ASCDETLSFNKAPEKVLVMSETDISILHDLDVIDKVVAKAGAKRVEGISPSLEKAIANI
FT                   PTIAAGELDTGGAKVSTEAILELKPDLVIGFDTGADRQALKDAGIPLYSPDAFCPNASA
FT                   KKADWGLVNNEIDKLATIFDVKGKGEELKKSVQDKLKQQGSTQGDTSAVMLYITPGSDE
FT                   FYAYGNTSMVQPILEANGLKNVYADNPERVFDSSMEEILAKNPDRIVLLSESSDSDAAM
FT                   KTFLNFPGAKDLKAVQNNHVAHMPFILTDPPTTLSVEGASYLHNLIK"
FT   gene            complement(304442..305494)
FT                   /locus_tag="CPFRC_01480"
FT                   /old_locus_tag="cpfrc_00287"
FT   CDS_pept        complement(304442..305494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01480"
FT                   /old_locus_tag="cpfrc_00287"
FT                   /product="iron chelate uptake ABC transporter family
FT                   permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00287"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28080"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400967.1"
FT                   /protein_id="ADK28080.2"
FT                   /translation="MFISQGHQLTVQYTGQRTTITTLVLSIMVLFIPALSVCIGAAGVA
FT                   PSHVFGVILSHIPHVPVDISWDRATDAIIWHNRFPRVLLGLAVGAILGVSGVVFQAVIR
FT                   NSLAEPYVLGVSSGASTGAAFSLIILGLSSAWAMGFFAFAGSVIATCAVLIIAGRSSSP
FT                   LKLILSGLAIGFGAQAFTNFIIFTNGSPETNQAVMFWMLGSLGRARWQAVVATIIVAIF
FT                   LTLLMAIIGPLLDALASGDETARAVGVPPEITRLLVLIVVSAAVAIAVSSSGGIGFVGL
FT                   IVPHIMRIVSGYSHRMLVINTALASALFLVLADALARVLISPQELPIGVLTGLIGAPVL
FT                   AILIRRTTNV"
FT   gene            305734..306735
FT                   /gene="ccsB"
FT                   /locus_tag="CPFRC_01485"
FT                   /old_locus_tag="cpfrc_00288"
FT   CDS_pept        305734..306735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccsB"
FT                   /locus_tag="CPFRC_01485"
FT                   /old_locus_tag="cpfrc_00288"
FT                   /product="c-type cytochrome biogenesis protein CcsB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00288"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28081"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241147.1"
FT                   /protein_id="ADK28081.1"
FT                   /translation="MNVNPNLASLSDMAFASSFVIYFIALVLSIVFYMKTRTFIDLERE
FT                   RVNERALVTVGSESDSTEGMGTELDSADDQISKVGASAEKFAGMTQMIVWLGVVVHAAS
FT                   VILRGLSASRFPFGNLYEYVLVISCFAVAIAAFFLQRREMRVLWPWVLTPILALLFFGG
FT                   TKLYADSAPVVPALQSFWFPIHVSTVSIGASIGMISGVASVLYLLRLYQEQGKEKGVLG
FT                   ALAKPLPSAKLLDAIAYRTAIITVPVFGLGIILGAIWAESAWGRFWGWDPKETVAFATW
FT                   ILYAAYLHARATSGWRDSRAAWINIVALCTMVFNLFFINMVVSGLHSYAGLN"
FT   gene            complement(306865..307155)
FT                   /locus_tag="CPFRC_01490"
FT                   /old_locus_tag="cpfrc_00289"
FT   CDS_pept        complement(306865..307155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01490"
FT                   /old_locus_tag="cpfrc_00289"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00289"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28082"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241148.1"
FT                   /protein_id="ADK28082.1"
FT                   /translation="MGRLILLLLLIAAIVLVWKAFGPKTWQKSTIPEPPRIKGPDDDEE
FT                   FLWRLERDQFKKRRAAEEAKRKAAEQKKREATEDTSHGDREKSQDDGTPSA"
FT   gene            307239..307574
FT                   /locus_tag="CPFRC_01495"
FT                   /old_locus_tag="cpfrc_00290"
FT   CDS_pept        307239..307574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01495"
FT                   /old_locus_tag="cpfrc_00290"
FT                   /product="DUF4229 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28083"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522106.1"
FT                   /protein_id="ADK28083.2"
FT                   /translation="MLNVSETAMSENSRPIVDPQVRTAARKAVIVYGIARCALFIVLTA
FT                   IIQGIAVAIGAPVPILISATLALILAMPLSMFVFKGIRVQATQAVALWSAQRKAEKDWV
FT                   KSELSSR"
FT   gene            complement(307560..308435)
FT                   /locus_tag="CPFRC_01500"
FT                   /old_locus_tag="cpfrc_00291"
FT   CDS_pept        complement(307560..308435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01500"
FT                   /old_locus_tag="cpfrc_00291"
FT                   /product="1,4-dihydroxy-2-naphthoate polyprenyltransferase"
FT                   /EC_number="2.5.1.74"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28084"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522107.1"
FT                   /protein_id="ADK28084.1"
FT                   /translation="MSKATFADWKEGARPHTWANAFAPVIIGSGAAAQAHGFSWWRALL
FT                   ALVVAWALIVGVNYANDYSDGIRGTDDDRTGPLRLTGSGLAQPEDVKRAAFLAFGVAAI
FT                   AGIALCLASAWWLIAVGALCILGAWFYTGGKNPYGYRGLGEVSVFVFFGLVAVLGTQFT
FT                   QLGRVTWVGFGCAVAVGAMSAGVNLVNNLRDIPTDSAAGKTTLAVILGDTATRRLYCVL
FT                   VAIPFAVSLAFFAVSPWAGIGIIALPLVIKAAQPVVKGRHAQDLIPVLGATGKSMAVWA
FT                   VATAIALAAG"
FT   gene            complement(308449..309576)
FT                   /locus_tag="CPFRC_01505"
FT                   /old_locus_tag="cpfrc_00292"
FT   CDS_pept        complement(308449..309576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01505"
FT                   /old_locus_tag="cpfrc_00292"
FT                   /product="o-succinylbenzoate--CoA ligase"
FT                   /EC_number="6.2.1.26"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00292"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28085"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655037.1"
FT                   /protein_id="ADK28085.1"
FT                   /translation="MHVLEPLVVPTHNPASILDRLEQAIVGQRSFLPLPSDDKDRAELL
FT                   RRTQRVGHPIDPDIALVMSTSGSTGIPKGAMLTAGNLVSSADATHQFLGGEAQWLLAMP
FT                   AHHIAGMQILVRSIIAGYDPIVVDVSRGFNVAAFAAAAASVEGERVYTSLTPLQLLKAM
FT                   DTLVGIEALRVFTAILVGGAPLRADDRRAAKELGINVVTTYGASETSGGCVYNGRPVPG
FT                   ATIRVINERIHLGGPMIAQGYRNIPDHHAFSQPGWFITSDAGILNDGILEVVGRLDNVI
FT                   DSGGLKIHPEVLERKLCDVPGVTAACVVGLPDRRFGHIIVAAYEGNAHPTTIISALDDL
FT                   PRWQLPKDIRRVESLPLIGPGKIDRRGVTALFTQQ"
FT   gene            complement(309639..310607)
FT                   /locus_tag="CPFRC_01510"
FT                   /old_locus_tag="cpfrc_00293"
FT   CDS_pept        complement(309639..310607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01510"
FT                   /old_locus_tag="cpfrc_00293"
FT                   /product="1,4-dihydroxy-2-naphthoyl-CoA synthase"
FT                   /EC_number="4.1.3.36"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00293"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28086"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010189742.1"
FT                   /protein_id="ADK28086.1"
FT                   /translation="MDEQKTYSTDNPFDASQWETVAGFQDLTDITYHRHVGEGRENGIV
FT                   RIAFDRPEVRNAFRPHTVDELYRALDHARRTPDVGTVLLTGNGPSEKDGGWAFCSGGDQ
FT                   RIRGRSGYRYATEHAHDDATADESTVDTAREKVEGGRLHILEVQRLIRTMPKVVIAVVN
FT                   GWAAGGGHSLHVVCDMTIASRQEARFKQTDADVGSFDAGYGSAYLAKMVGQKFAREIFF
FT                   LGRTYDAETMQRMGAVNIVADHKNLEDEAIQMAREINGKSPTAQRMLKFAFNLTDDGLM
FT                   GQQVFAGEATRLAYMTDEAVEGKEAFLQKRAPDWNDFPYYY"
FT   gene            complement(310739..312160)
FT                   /locus_tag="CPFRC_01515"
FT                   /old_locus_tag="cpfrc_00294"
FT   CDS_pept        complement(310739..312160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01515"
FT                   /old_locus_tag="cpfrc_00294"
FT                   /product="transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00294"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28087"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366456.1"
FT                   /protein_id="ADK28087.1"
FT                   /translation="MLYILIALLAVAAVVYLIVKKVHAAAAIFFVGVLLLMIAALTGRA
FT                   EFRSTDITSSGNALYDQLLVVEALFKSRFSGIGMAIMVLFGFVSYMRHIGADAKTVVIL
FT                   STPLRRFKGSYWLVPVGFLIGNLLSLVIPSASALSLLLVATLLPALIAAGLTPLTVGAI
FT                   VVTSSTIIPTPLEAGLIQGADLTGMTVTEFVYGHVAWATVPALIITAFVHMWWQRHCDI
FT                   VDTRHAHEGTQHNAENREISDSDAATRDALERASGLPGYYAVLPLMPLLLIVVSALLKR
FT                   LSVLPFEAGILPVTVVSLFVALIIESLRKRTITGAIDSVASFFKGMGEGAAGVVSLLVA
FT                   AAVLVEGITQMGVIDMLIQAAEGSSGAAILIVLIFVVATAAMATLTGSGTAPYFAFSEV
FT                   VPSLATQSSIHAPQMLTAIWGTSNLMRQISPVNAAVLIVAGAIKVNPIRLVKRTLVPMV
FT                   VATVLNTLFAFLFIG"
FT   gene            312464..313501
FT                   /locus_tag="CPFRC_01520"
FT                   /old_locus_tag="cpfrc_00295"
FT   CDS_pept        312464..313501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01520"
FT                   /old_locus_tag="cpfrc_00295"
FT                   /product="o-succinylbenzoate synthase"
FT                   /EC_number="4.2.1.113"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28088"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655039.1"
FT                   /protein_id="ADK28088.1"
FT                   /translation="MTQAKPLSAWGATIDEVLERAPVVALPMRVPFRGVTTREALLFRG
FT                   PVGWGEFAPFSDYSPEESAYWLSSGLEMAYQGPPKAMRDCVEVNGTIPAVIPEQVPEVM
FT                   AHFDGCRTFKVKVAEKGHSLSDDVARVNAVREAMPSAIIRVDANRGWSVEQAFCAAKQL
FT                   SPLDYMEQPCATVAELIELRQRLIRAGLFVRVAADEAIRRAEDPYEVARAQAADVAVVK
FT                   AAPLGGPRKLLQIAEFMRARGLDITVASALDTGVGMNAGLAAVAALPKHTDDEDFDVPP
FT                   AAAGLATQRLFVEDITAPRQIVDGQLAVEMLSPDPDRLSEFSVKDSRRDAWLQRLQEAW
FT                   EFLER"
FT   gene            313565..315178
FT                   /locus_tag="CPFRC_01525"
FT                   /old_locus_tag="cpfrc_00296"
FT   CDS_pept        313565..315178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01525"
FT                   /old_locus_tag="cpfrc_00296"
FT                   /product="2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid
FT                   synthase"
FT                   /EC_number="2.2.1.9"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00296"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28089"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014799996.1"
FT                   /protein_id="ADK28089.1"
FT                   /translation="MISSPQLARAVAAKLAHYLTDVVICPGSRNSPLSLELLARDDIRV
FT                   HTRIDERSAAFLALGMGRASGRHVGVVTTSGTAVASCLPAMVEAYHSHAPLAMISADRP
FT                   AHLHGTGANQTINQTGIFGVVPTTSVAALADVELIDAAFKRGQVHINVELDTPLVEDCL
FT                   PAPTTKGAKKAPIKGDFTDHGEVEIDLSRPTLVITGDEAWDVPGLEDVPTIAEPSAPAP
FT                   YHPVHPLATSIFAHEQVSAEGYVVNTKPEQVIVVGHPTLHRSVFDLIADPAIEVTVLTR
FT                   TDTITDPTHSAQKVATRIKTTGRPSEQWLKICEAASELAAEAVRDVLAQDFRFSGLHVA
FT                   AAVADTLATGDTLVLGASNPVRDASFVGLPFSAVDTYTPRGTAGIDGTVSQAIGVALTV
FT                   QARNPEEIRAARTVALMGDVTFLHDVGGLFTGPDSPQPENLTIVVANDSGGGIFETLEV
FT                   GSPQLRGSFERAFGTPHEIDIESIAAAYGVEYQLATDMQGLIEKLIDATDTAGFTLIEA
FT                   RTTRADRRAMHEALVKKVNM"
FT   gene            315175..315630
FT                   /locus_tag="CPFRC_01530"
FT                   /old_locus_tag="cpfrc_00297"
FT   CDS_pept        315175..315630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01530"
FT                   /old_locus_tag="cpfrc_00297"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00297"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28090"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241156.1"
FT                   /protein_id="ADK28090.1"
FT                   /translation="MSRLPHYPPASIRRRLHQAILALFVAATVGCISMVIGPALNDREI
FT                   SKAPGRTLAKVIDVGTFRSTVEYQDEEGVYHSPRGGLLYPTGLGKGQRVWVTYAKSNPD
FT                   LVKVQGRGWTLALIPALSTWVVSFMITMTLWWVVTLWYRKHANSDNR"
FT   gene            315608..316726
FT                   /locus_tag="CPFRC_01535"
FT                   /old_locus_tag="cpfrc_00298"
FT   CDS_pept        315608..316726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01535"
FT                   /old_locus_tag="cpfrc_00298"
FT                   /product="glycosyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00298"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28091"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910750.1"
FT                   /protein_id="ADK28091.1"
FT                   /translation="MRIAIIAESFLPAVNGVTNSVLRVLEHTQRCGHEAMVIAPGARNG
FT                   EEEIRSYCGASIYRVPTVMVPLINSLPIGIPLGLRELLQAFRPDVVHLASPYALAARGA
FT                   FVARNLGLPCVAVFQTDIAGFSHRYHLRCLERTSWAWTRAFHNAATLTLAPSRSAAAAL
FT                   NVHGIERVKPWGRGVDLELFHPDRRDEKLARNWGADNRIVVGYVGRLAAEKGVHRLVDL
FT                   ACDNNIQLVIVGDGPERKNLEKQLPCAIFTGGLTGLDLARAYASFDVFVHPGEFETFCQ
FT                   TIQEAKASGIPVISVAEGGPRDLIDNRSGVLLPLIHDSLVGLSQSVYEVFENREDLSKT
FT                   ARQSVEDKSWARVCDQLFRYYQEAMITLDNRG"
FT   gene            316719..317417
FT                   /locus_tag="CPFRC_01540"
FT                   /old_locus_tag="cpfrc_00299"
FT   CDS_pept        316719..317417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01540"
FT                   /old_locus_tag="cpfrc_00299"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.163"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00299"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28092"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241158.1"
FT                   /protein_id="ADK28092.1"
FT                   /translation="MAKASLEKNPFDVAKMFDGVGKNYDITNTVLSFGQDRKWREKTRE
FT                   RLNLQPGERVLDLAAGTAVSTVELGKSGAWVVACDFSQGMLAAGKERDVPKVVGDGMQL
FT                   PFADNSFDAVTISYGLRNVHDFQAALREMARVTKPGGRLTIAEFSTPNVPGFKTIYKEY
FT                   LTRLLPLIAKAVGTNPEAYEYLAESIRAWPEREELARAINNNGWSDAGWQNLSLGIVAL
FT                   HSAVKPEHNG"
FT   gene            complement(317497..318459)
FT                   /locus_tag="CPFRC_01545"
FT                   /old_locus_tag="cpfrc_00300"
FT   CDS_pept        complement(317497..318459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01545"
FT                   /old_locus_tag="cpfrc_00300"
FT                   /product="L-lactate dehydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28093"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910752.1"
FT                   /protein_id="ADK28093.1"
FT                   /translation="MHTSKLVVVGVGHVGSYVLSYAMDSGLYSEIATIDIKPGVSKGEA
FT                   IDQAQSTGVPGTAYTYCHPGDYSDCADADVIIVAAGGSILPDPDDPERMPDRAELAEIS
FT                   GAVIRDVMGNIAAHTKNAVVIFITNPLDAMVHIASTEFDYPTEKIFGTGTMLDSARMRW
FT                   IIGTELGIDPKSVTGYMMGEHGSTSVPILSRVNVQGLSWDELSAWRGSPLPTAPEIQER
FT                   VIKAAYDVLLAKGWTNAGVARSANELAKCVLLNEHAVHPICTPLDGEYGLHDVSMSVPT
FT                   LIGNAGALRKMPPTLNDWELEQIHKSAEFIRETVSRASS"
FT   gene            complement(318557..319834)
FT                   /locus_tag="CPFRC_01550"
FT                   /old_locus_tag="cpfrc_00301"
FT   CDS_pept        complement(318557..319834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01550"
FT                   /old_locus_tag="cpfrc_00301"
FT                   /product="geranylgeranyl reductase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28094"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800000.1"
FT                   /protein_id="ADK28094.1"
FT                   /translation="MRVNNSVFSVDVLVVGAGPAGSTAAINAAQRGSTVLLIDAATFPR
FT                   DKTCGDGLTPRAVHQLEKIGIDVTSRYASKGLKLHGFGGSVTAPWPQSPFGTISSAMPR
FT                   SEFDELLLNTAQQHSNVQVWQGVTAVSVEASPASSQPTSEFPKAGRIRTVTLDDGRVVA
FT                   PAFVIVADGVRSTFGKLLGRQWHRGEVYGIAARSYCETPRGDDPWMHSHLELRDDTGTA
FT                   QPGYGWIFPLGNGTANVGCGALSTDARPAKVNTKKLLQSYAQQQSDEWGFGVPQRVTSA
FT                   LLPMGGAVSNVAGPNWMLIGDAAACVNPLNGEGIDYGMETAALAVSLMGTDADLSHAWP
FT                   ELLRSTYGEAFLLARTAARLLTYPRLLPIAGPLALRKPLGTVIMPAAARLMGNLVSDSD
FT                   RDLVARLWRFAGTGVSRWRRDSPLWS"
FT   gene            319989..321008
FT                   /locus_tag="CPFRC_01555"
FT                   /old_locus_tag="cpfrc_00302"
FT   CDS_pept        319989..321008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01555"
FT                   /old_locus_tag="cpfrc_00302"
FT                   /product="polyprenyl synthetase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00302"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28095"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523037.1"
FT                   /protein_id="ADK28095.1"
FT                   /translation="MSNGAEGLSTSTGTRVDLGNPALNEDISAGMTRVEELLQKELCVG
FT                   EDFIVEKVKHLANAGGKRFRPMFALLASQYGDHPVSEDVIKAAVVVEMTHLATLYHDDV
FT                   MDEAAKRRGVESANARWNNSVAILAGDILLAHVSRLMADLGTDTVRHFSETFGDLVTGQ
FT                   MRETIGVGEGDPIEHYMAVIREKTGVLIASAGYLGALHSGATADHIEALRAYGAAIGMV
FT                   FQIVDDIIDIFSDSEDSGKTPGTDLREGVFTLPVLYALREQTPIGEELRATLTGPVTDD
FT                   TTVARVLDLLTQSTGRDRALADVHHYLNEAEAQLELLPQNATTEALRNLARFTVQRVG"
FT   gene            321088..321172
FT                   /locus_tag="CPFRC_01560"
FT                   /old_locus_tag="cpfrc_t013"
FT   tRNA            321088..321172
FT                   /locus_tag="CPFRC_01560"
FT                   /old_locus_tag="cpfrc_t013"
FT                   /product="tRNA-Tyr"
FT                   /anticodon="(pos:321122..321124,aa:Tyr,seq:gta)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            321477..321549
FT                   /locus_tag="CPFRC_01565"
FT                   /old_locus_tag="cpfrc_t014"
FT   tRNA            321477..321549
FT                   /locus_tag="CPFRC_01565"
FT                   /old_locus_tag="cpfrc_t014"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:321510..321512,aa:Thr,seq:ggt)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            321588..321659
FT                   /locus_tag="CPFRC_01570"
FT                   /old_locus_tag="cpfrc_t015"
FT   tRNA            321588..321659
FT                   /locus_tag="CPFRC_01570"
FT                   /old_locus_tag="cpfrc_t015"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:321620..321622,aa:Met,seq:cat)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            321787..321859
FT                   /locus_tag="CPFRC_01575"
FT                   /old_locus_tag="cpfrc_t016"
FT   tRNA            321787..321859
FT                   /locus_tag="CPFRC_01575"
FT                   /old_locus_tag="cpfrc_t016"
FT                   /product="tRNA-Trp"
FT                   /anticodon="(pos:321820..321822,aa:Trp,seq:cca)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            322185..322511
FT                   /gene="secE"
FT                   /locus_tag="CPFRC_01580"
FT                   /old_locus_tag="cpfrc_00303"
FT   CDS_pept        322185..322511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="CPFRC_01580"
FT                   /old_locus_tag="cpfrc_00303"
FT                   /product="preprotein translocase subunit SecE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00303"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28096"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800001.1"
FT                   /protein_id="ADK28096.1"
FT                   /translation="MTEQQPEKVGAASRPTGKRQLAGVNTTSTSSYEAKKVAPAGDSEG
FT                   KKNNKVVAFVPEVASEMKKVIWPTAKQMINYTLIVFAFLILMTALVAGVDFVAGLGVEK
FT                   VLTR"
FT   gene            322630..323460
FT                   /gene="nusG"
FT                   /locus_tag="CPFRC_01585"
FT                   /old_locus_tag="cpfrc_00304"
FT   CDS_pept        322630..323460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="CPFRC_01585"
FT                   /old_locus_tag="cpfrc_00304"
FT                   /product="transcription termination/antitermination protein
FT                   NusG"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00304"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28097"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525303.1"
FT                   /protein_id="ADK28097.1"
FT                   /translation="MSDENNSGSFAEAFDDAVEATIAAETEAAEAGVELDEAVEQPVQE
FT                   VDAEAALAGAVEDGDAEYKARLRKYTRELKKLPGSWYIIQCYSGYENKVKTNLDMRAQT
FT                   LEVEDSIFDVVVPIEQAVELRDGKRKLVKRKLLPGYVLVRMDINDRSWSVVRDTPGVTS
FT                   FVGNEGNATPVKHRDVAKFLMPQESVAGDGGESNAVNAEGEKVVAMPGASSKPKVEVDF
FT                   QVGEAVTILSGALASVSATISAIDTENNKLQALVSIFGRETPVELNFDQVEKVS"
FT   gene            323757..324188
FT                   /gene="rplK"
FT                   /locus_tag="CPFRC_01590"
FT                   /old_locus_tag="cpfrc_00305"
FT   CDS_pept        323757..324188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="CPFRC_01590"
FT                   /old_locus_tag="cpfrc_00305"
FT                   /product="50S ribosomal protein L11"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28098"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366465.1"
FT                   /protein_id="ADK28098.1"
FT                   /translation="MAPKKKVTGLIKLQIQAGQANPAPPVGPALGAHGVNIMEFCKAYN
FT                   AATENQRGSVVPVEITVYEDRSFEFKLKTPPAAKLLLKAAGLQKGSGVPHTQKVGKVTM
FT                   EQVREIAQTKLEDLNANDIDNAARIIAGTARSMGIVVED"
FT   gene            324267..324977
FT                   /gene="rplA"
FT                   /locus_tag="CPFRC_01595"
FT                   /old_locus_tag="cpfrc_00306"
FT   CDS_pept        324267..324977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="CPFRC_01595"
FT                   /old_locus_tag="cpfrc_00306"
FT                   /product="50S ribosomal protein L1"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00306"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28099"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241165.1"
FT                   /protein_id="ADK28099.1"
FT                   /translation="MGNKKSKAYRAAAEKIDKGRLYTPLKAAELVKETSSKNYDATIDV
FT                   AIRLGVDPRKADQLVRGTVSLPNGTGKTVRVAVFAEGEKATEAEAAGADIVGTTELIEQ
FT                   ITAGTINFDVAIATPDQMAKVGRVARVLGPRGLMPNPKTGTVTTDVAKAIADVKGGKIS
FT                   FRVDKAANLHAVIGKASFDAKALAENYGALLDEINRIKPSSSKGIYVKKVTLASTSGPG
FT                   VPVDTSIQKNYTAE"
FT   gene            325086..326422
FT                   /pseudo
FT                   /locus_tag="CPFRC_01600"
FT                   /old_locus_tag="cpfrc_00308"
FT   CDS_pept        325086..326422
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01600"
FT                   /old_locus_tag="cpfrc_00308"
FT                   /product="biotin transporter BioY"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00308"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28101"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525304.1"
FT   gene            326462..327763
FT                   /locus_tag="CPFRC_01605"
FT                   /old_locus_tag="cpfrc_00309"
FT   CDS_pept        326462..327763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01605"
FT                   /old_locus_tag="cpfrc_00309"
FT                   /product="aminopeptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00309"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28102"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523039.1"
FT                   /protein_id="ADK28102.1"
FT                   /translation="MTELTMNSVSAINTELLKDPTLRLARNAVAVSSATKVALNREAVR
FT                   SLDTSVSTKVDSWTVANQKKSGRCWIFAGLNSLRGAIMKETAIKDFELSQTYIHFWDKV
FT                   EKANYFLCAMDELRDRDLTDRTVEKLLHDPIDDGGQWNMFVALVQKYGVVPQYAMPETF
FT                   SSSNTYAMNRDLASVLRRGALRIRDGVPGAREEALESAFKVITTHLGVPPETFQWQYRT
FT                   KDDDFVREGTLTPLDFAQRYLPDDLGDYVCVVNDPRNAFGELYTVEYLGNVVGAPPVTY
FT                   VNAPIEVLRDAVRDSLIDATPVWFGCDTEVQAYSDAGLWDAHLFDYEGLYGVNFDMSKT
FT                   QRLLTGDSLMTHAMVFTGMDLAEDGTTVNRWRVENSWGTEKADKGFWTMSDSWFEEYVF
FT                   EVAVPASRLPEEYRQALTKTPHVLPAWDPMGALA"
FT   gene            327889..328962
FT                   /locus_tag="CPFRC_01610"
FT                   /old_locus_tag="cpfrc_00310"
FT   CDS_pept        327889..328962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01610"
FT                   /old_locus_tag="cpfrc_00310"
FT                   /product="alkene reductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28103"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241169.1"
FT                   /protein_id="ADK28103.1"
FT                   /translation="MTSLFTSAQAGALNLRNRITMAALTRLRAGEDGVPSALHAEYYAQ
FT                   RASAGLIVTEGTYPTLRGRGFSGQPGIANSAQQEGWRKVAEAVHTAGGSVVMQVMHAGR
FT                   MSHESMNGGVLPEAPSAVASGTQMRTPAGKIDLPVPHALEAEELERVKQEFVAASRRAV
FT                   DAGLDGVELHGANGYLLHEFLSPSSNVRTDEFGGTPENRARFVIQVVQAVAEEIGAHRV
FT                   GLRISPEHNIQGVLETDREETLATYRVLLNEIRSLELAYLSILHADYRSDFVHQLAEAF
FT                   GGFVILNSGFGTYTEYAEAVGIVESGYADAVAVGRELIANPDLVRRWQEGIELNVPDPD
FT                   TFYVGGPKGYTDYSFAE"
FT   gene            329296..329811
FT                   /gene="rplJ"
FT                   /locus_tag="CPFRC_01615"
FT                   /old_locus_tag="cpfrc_00311"
FT   CDS_pept        329296..329811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="CPFRC_01615"
FT                   /old_locus_tag="cpfrc_00311"
FT                   /product="50S ribosomal protein L10"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28104"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599730.1"
FT                   /protein_id="ADK28104.2"
FT                   /translation="MANPKNVSSLAELKERFADTDSIVITEYRGLTVAQITELRRSLGA
FT                   DVQYSVAKNTLLKLAAKEAGVEGLDDLLSGPTAIAFIKGEAVDAAKAMKKFASNNKAFV
FT                   VKGGYMDGDALNADQVNAIAELDNRETTLAKLAGAMKGNLAKAAGLFNAPASQVARLGA
FT                   ALQEKKEA"
FT   gene            329890..330273
FT                   /gene="rplL"
FT                   /locus_tag="CPFRC_01620"
FT                   /old_locus_tag="cpfrc_00312"
FT   CDS_pept        329890..330273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="CPFRC_01620"
FT                   /old_locus_tag="cpfrc_00312"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00312"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28105"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_006770269.1"
FT                   /protein_id="ADK28105.1"
FT                   /translation="MAKLTKDELIEAFKEMTLIELSEFVKEFEEVFEVTAAAPVAVAAP
FT                   GAAGAEAAAEEKTEFDVVLEDAGAKKIGVIKAVREIVSGLGLKEAKELVESAPKAIIEA
FT                   ASKDDAEAAKAKLEEAGAKVTLK"
FT   gene            330608..331561
FT                   /locus_tag="CPFRC_01625"
FT                   /old_locus_tag="cpfrc_00313"
FT   CDS_pept        330608..331561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01625"
FT                   /old_locus_tag="cpfrc_00313"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00313"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28106"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835911.1"
FT                   /protein_id="ADK28106.1"
FT                   /translation="MFTRPLRSSRTSRIAAASAVVLVGLSASFVPTAWAEDLELDSGHI
FT                   DVFNVTADGGNLKLDLKEDVTGSHVLRDPDSVTLRVKEEAWTDKTAQVPEVGTSGYYLP
FT                   QTQDPNLIWPGWDTNGVRSGGFGEVDINFVKVSGPGQIYAFQTGSFGGNTPILANNGFE
FT                   VRSGEMITQQEPAHVHTNWVFTAPGTYTMCVQATADGASSNVARYVWSVGNGGPNTVAS
FT                   CDGEGEAVAVAARSGNDDRKNRSSSTSSSRSTSRATTSSKPTSSKPAPAAAPAKRNSLP
FT                   ETGPSYMTAAFLVLGVGLAVFGAGTVRLVKAITRNK"
FT   gene            331570..333195
FT                   /locus_tag="CPFRC_01630"
FT                   /old_locus_tag="cpfrc_00314"
FT   CDS_pept        331570..333195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01630"
FT                   /old_locus_tag="cpfrc_00314"
FT                   /product="anchored repeat ABC transporter,
FT                   substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00314"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28107"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241173.1"
FT                   /protein_id="ADK28107.1"
FT                   /translation="MYSKTILSAYQRSVGAGALVACAFLVAACGTDTRDLPSRVDGITD
FT                   VVASTQIVADIARNVAGDRARVTALMPRGADPHTYEPSLRDVRNVANADVIFTNGLLLE
FT                   QQSVLRAIDNAVVAPAKVVALGEQSTKHGAHLLQLVEDVTLDSVWLGMRVEGTGAQLGA
FT                   NSHSEINIHVTGVRGIDGSEAPGDAAAYLTTAFGKPEVYFNSRDGFHPERGYDGDTITL
FT                   PAAAHTHVSWAFSKPGVYVIDIEAELVTERGARPIPVGASSITMAVGVRGESALPGTSA
FT                   TVINQGHQDVSINLNSKKIEIQGDSANGKDIATVYDSASTVIEVPNNTLQKIPAGSQFR
FT                   FLGTPGDEVYVLPQAVLGKHVHGEVDPHLWHDVDNVIAFVKTIRDELISADPQGAREYT
FT                   TNADAYIDQLGKVHQEVRDAIAAIPEEHRHLVTTHDGYSYLAHAYGIDVAGFVTPNPGV
FT                   EPSARDLIALTNTLKNLHVPAVFLEPQLAVASTDLLETAKRLNIRVCPIRGDSFDEDVT
FT                   TYVDLMRANAASLQQCLGDRRDTS"
FT   gene            333287..334321
FT                   /locus_tag="CPFRC_01635"
FT                   /old_locus_tag="cpfrc_00315"
FT   CDS_pept        333287..334321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01635"
FT                   /old_locus_tag="cpfrc_00315"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28108"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523041.1"
FT                   /protein_id="ADK28108.1"
FT                   /translation="MSTNLKFRIPVACLSKARVGVLATSMVIASSIAVPAAHIAFPAAA
FT                   LAQTQDDPSLEQTVTDSEDVVPLGTQKVFDHGHADLGPVVDSDSGETRFLVRDDSEFPP
FT                   KWRHLSDTIFLVDDSAKQTLPEEAQSFDFTGAQPGSQVWVIPQSEVHGVPWLGWNTQNP
FT                   TLTKSADRGITLEFAGHEGDGQFSLFLQNGGFAEPQVLWTSAKKESQPMWVDLNTHTHA
FT                   NWVFTQPGVHKVAVRALIPLLDGTTKEFTEVLTFAVGKDALEEAKSAQWEGEYLPSSTK
FT                   GEEKGASASSTAKGAPASEKSSSVAVWIFVAMILIALGFVVAGLRMRASAKKRKETAAQ
FT                   NGQR"
FT   gene            334318..335118
FT                   /locus_tag="CPFRC_01640"
FT                   /old_locus_tag="cpfrc_00316"
FT   CDS_pept        334318..335118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01640"
FT                   /old_locus_tag="cpfrc_00316"
FT                   /product="anchored repeat-type ABC transporter ATP-binding
FT                   subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00316"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28109"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300454.1"
FT                   /protein_id="ADK28109.2"
FT                   /translation="MSKAASVIEVRGLGVSLGGRTVMKDINFDVRAGEFIGLIGPNGAG
FT                   KTTMMRAILGLIPTDSGRVTISGVQGRGVRNHAGYVPQRHEFAWDYPIDVHGLVMNGRT
FT                   GLIGWFKRAGQKDFDAVHRALDMVGMAHLSDRPIGELSGGQKQRVLIARALSIAPKVLF
FT                   LDEPFTGLDMPSAESLLELFHRLAQEGTAIVMSTHNLVEAISSCDRILLFNGQIVADAA
FT                   PEDLERPQPWIETFSVSEHSPLLVSVGALRREDARSAQKGMPAP"
FT   gene            335115..335996
FT                   /locus_tag="CPFRC_01645"
FT                   /old_locus_tag="cpfrc_00317"
FT   CDS_pept        335115..335996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01645"
FT                   /old_locus_tag="cpfrc_00317"
FT                   /product="anchored repeat-type ABC transporter permease
FT                   subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00317"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28110"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800009.1"
FT                   /protein_id="ADK28110.1"
FT                   /translation="MISLVEFFSDLSNPALAFLPKALLISVISSIVCGVVGTHVVLRGM
FT                   AFVGDAVAHAVFPGIAIAFVLQGSVLLGGAVAGAVVALLIAMFSQRRRVKEDTVIGIFF
FT                   AAAFASGVVFISQVDGYTASLTSFLFGSITGVSTEDIILTAVVGLVVIVLLALLAPQFT
FT                   AVTLDRETARAMNLPTMLLDVLLYVAVTAAVVISVQTIGNILVLALLVTPAATARMLTD
FT                   KFSVMSAIAAGVGTCSSLVGVYLSWALDLPTGATIVLVATAFFLLSWCLSPRRGLFKRR
FT                   ISADNSQGAVFS"
FT   gene            335993..337954
FT                   /locus_tag="CPFRC_01650"
FT                   /old_locus_tag="cpfrc_00318"
FT   CDS_pept        335993..337954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01650"
FT                   /old_locus_tag="cpfrc_00318"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00318"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28111"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800010.1"
FT                   /protein_id="ADK28111.1"
FT                   /translation="MRKQRITTRIGRPLVGVGLAAALCGLQNPLGLAQEAADPEPTAAL
FT                   ESNSETDKNIAHDFESIRKKINSFTLPIGSVAPSDKEPTLKPSESTEDLPEEPETLEGG
FT                   SEEESELLPETLEKKLIKEGKKLEASDRDNSKLNDQEVRSLWEKLIQKTKAPQKVLRKG
FT                   DMSITIPGQKTGEKHDAQNVASLVVAKEEKDVLTTNTEVPQTYASGEALLAIGDAARVP
FT                   GALLGLKEKKDLAPVWYLPQEKDANPDAPSVGFNFEQVSATKKITVSLTDYHGPGRMVT
FT                   AEMGEEKAETAFDSQDLEQAWEYEGGASYRQAFAFTEPGAYTATFKFLVEDQESQGKTA
FT                   SQEYSFNTTFLVGSVKEEKVTPLKEIVEKSVNKKPLKEKTKETDATETERKTNKDNKKE
FT                   QSKAPGSQEPQTSVPKTPETDVPQKTPEKDPENVEPETKHPESKEPRAEEHAPSVPSPI
FT                   VPVDLKGLAKEIRELDRELNAMSRQTDSLFKAINANEPERKQEQRRPASNASGRTETGG
FT                   SEQGSGNQNAPAPVRSSSGGSSGRGSNAAKPNKPRNSAASGSSSAKSSDKNKESSKDKK
FT                   KSAKKSTEKKASAKSAKKTTEGKTDEAQGASNEKIAATGESMRKRGWWTGFLFGLGAMA
FT                   MLGGVVFFTQARNIAKRK"
FT   gene            338059..339000
FT                   /locus_tag="CPFRC_01655"
FT                   /old_locus_tag="cpfrc_00319"
FT   CDS_pept        338059..339000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01655"
FT                   /old_locus_tag="cpfrc_00319"
FT                   /product="DUF3068 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00319"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28112"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014835917.1"
FT                   /protein_id="ADK28112.1"
FT                   /translation="MLPRSRILAVLGLGLGLAFIMWGVLAPRFLISDARLPLNLSHTTL
FT                   TLRDEKATTRVVGKDLVVQAPVTRQFHMEILPPSDNVNATVRIGVTDMRESLQKDLDRL
FT                   INATIWSYSIDRLSGAATSQATVADQLASPTRSVDIDGQWLKFPTNAEKTTYEVFDVTL
FT                   RKTLPAVFAEEATKEGRTLYRYRQEIQPTNVAQLYQSVFNTTTLGNGEDAAPGYLFHSG
FT                   TRDWWVDQKTGLIVDVEEKIDDYFGDAEGAKHEDVLTFNGKISEEQVSELLHQASSVSD
FT                   GKIVRVINYVVLAVGVILTIVGAVGAFGPRKR"
FT   gene            339245..342727
FT                   /locus_tag="CPFRC_01660"
FT                   /old_locus_tag="cpfrc_00320"
FT   CDS_pept        339245..342727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01660"
FT                   /old_locus_tag="cpfrc_00320"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28113"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599733.1"
FT                   /protein_id="ADK28113.2"
FT                   /translation="MAVSRQTKSVADIPGAPERFSFAKITEPIEVPGLLDIQLDSFAWL
FT                   IGTPEWRARQQEELGESVRITSGLEEILEELSPIQDYSGNMSLSLSEPRFEDMKNTIDE
FT                   CKDKDINYSAPLYVTAEFINNETQEIKSQTVFIGDFPMMTDKGTFIVNGTERVVVSQLV
FT                   RSPGVYFDQTIDKSTERPLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLK
FT                   ALGWTTEQITERFGFSEIMMSTLESDGVANTDEALLEIYRKQRPGEQPTRDLAQSLLDN
FT                   AFFRAKRYDLAKVGRYKVNRKLGLGGDNEGLMTLTEQDIATTLEYLVRLHAGESTMVAP
FT                   NGDVIPVDTDDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDAESITPTSL
FT                   INVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVH
FT                   ASHYGRMCPIETPEGPNIGLIGSLASYARVNSFGFIETPYRKVENGVLTDQIDYLTADE
FT                   EDRFVVGQAHVEVDAQGKITADSVTVRVKNGDIQVVAPESVDYLDVSPRQMVSVATAMI
FT                   PFLEHDDANRALMGANMQRQAVPLVRSEAPFVGTGMERRAAYDAGDLIINKKAGAVENV
FT                   SADFITVMADDGTRETYMLRKFERTNQGTCYNQIPLVNLGDRVEAGQVLADGPGTHNGE
FT                   MSLGRNLLVAFMPWEGHNYEDAIILNQRVVEEDILTSIHIEEHEIDARDTKLGAEEITR
FT                   EIPNVSEDVLKDLDERGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAR
FT                   EVRDTSMKVPHGETGKVIGVRRFSREDDDDLAPGVNEMIRVYVAQKRKIQDGDKLAGRH
FT                   GNKGVVGKILPQEDMPFMPDGTPVDIILNTHGVPRRMNIGQVLEVHLGWLAAAGWKIDP
FT                   EDPANAELLKTLPEDLYDVPAGSLTATPVFDGATNEEVAGLLANSRPNRDGDVMVDANG
FT                   KAQLFDGRSGEPFPYPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGG
FT                   QRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVL
FT                   LKELQSLCLNVEVLSADGTPMELSGSDDDEFDQAGASLGINLSRDERSDADIA"
FT   gene            342833..346843
FT                   /locus_tag="CPFRC_01665"
FT                   /old_locus_tag="cpfrc_00321"
FT   CDS_pept        342833..346843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01665"
FT                   /old_locus_tag="cpfrc_00321"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28114"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558579.1"
FT                   /protein_id="ADK28114.2"
FT                   /translation="MIDVNFFDELRIGLATADDIRRWSKGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTRDWECACGKYKRVRYKGIICERCGVEVTKSKVRRERMGHIELAAPVTHI
FT                   WYFKGVPSRLGYLLDLAPKDLERIIYFAANIITGVDEEARHSDQTTLEAEMLLEKKDVE
FT                   ADAESEIAERAQKLEEDLAELEAAGAKADARNKVQKAADKEMQRIRERAEREIDRLEEI
FT                   WQTFIKLAPKQMIIDETIYEELVDRYEDYFTGGMGAEAIQTLIRNFDLDAEAEELREII
FT                   NNGKGQKKMRALKRLKVVAAFQRSGNDPAGMVLDCIPVIPPELRPMVQLDGGRFATSDL
FT                   NDLYRRVINRNNRLKRMIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPL
FT                   KSLSDLLKGKQGRFRQNLLGKRVDYSGRSVIIVGPQLKLHECGLPKLMALELFKPFVMK
FT                   RLVENDYAQNIKSAKRMVERQRPEVWDVLEEAISEHPVMLNRAPTLHRLGIQAFEPKLV
FT                   EGKAIQLHPLACEAFNADFDGDQMAVHLPLSAEAQAEARILMLASNNILSPASGKPLAM
FT                   PRLDMVTGLYYLTMDKTEGEIGGQGAYQPATEDGPATGVYSSYAEALMARDRGVLGLQA
FT                   KIRVRISHLRPPVEVEAEQFPEGWEQGQTWLADTTLGRIMFNELLPWNYPYLEGVMVRK
FT                   GGGSNKILLGDVINDLAATYPMITVAQTMDKMKDAGFYWATRSGVTITMSDVLVLPNKE
FT                   EILDRYEAEAAKIERKYWEQGALTERERYDRLVELWKEATDEVGNAVEKLYPDDNPIPM
FT                   IVKSGAAGNMRQIWTLAGMKGMVVNSKGDYITRPIKTSFREGLSVLEYFNNSHGSRKGL
FT                   ADTALRTADSGYLTRRLVDVAQDVIVREDDCGTKQGIRVPVAVEVKDAQGNVTGYTGHS
FT                   LIETSVAGRVASVDIKDSEGNVLVPAGENLTDQLIEKLIAAGVAEVKVRSVLTCQTPTG
FT                   VCAKCYGKSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGGDITGGLPRVQ
FT                   ELFEARVPKNRAPIASVAGTVHLEDEGNFYTLTINPDDGSDVVVYEKLSKRQGLATVRV
FT                   PMESNPGAMIERTLSEGDHVNVGDRLLRGPADPHDVLEVLGRRGVEQHLVDEVQDVYRA
FT                   QGVAIHDKHIEIIIRQMLRRGTVIESGATEFLPGTLVDLSEAKAANAEAIAAGGHPAEL
FT                   RSEIMGITKASLATESWLSAASFQETTRVLTDAAINKRSDKLIGLKENVIIGKLIPAGT
FT                   GISRYRNISVKPTEAARNAAYSIPTYGDSIYGDDSYGEFTGASVPLDEAYDL"
FT   gene            346993..348264
FT                   /locus_tag="CPFRC_01670"
FT                   /old_locus_tag="cpfrc_00322"
FT   CDS_pept        346993..348264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01670"
FT                   /old_locus_tag="cpfrc_00322"
FT                   /product="histidine kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00322"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28115"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400977.1"
FT                   /protein_id="ADK28115.2"
FT                   /translation="MFIMKYFSALTRRIGAHGWIWDHGFWLQLITQILVGGFLFLMAVQ
FT                   NMMRPEGPHSALVYHSVVFILLWIGGGALFIGLLVQRARKILGLGIVIAALLLLALGPP
FT                   LVAPLGYVVVCYQSWFISAYIQRHRWAWGIALVFGSAIGLTLIPLSNALRGKAFLTSHA
FT                   VKEPNFWVGGAGVLIIIIISISLWWQIGLNTKRKNQALEELRAKAELAALAERNRIARE
FT                   MHDIVAHSLTVVIAQADGGRYAGKKDPMIAIEALETISSVGRDALSQMRGLLTVLREAT
FT                   GEKDEREINATPGFAEIGRLIDEACSAGLQVNFSVYGEPVAVDESRGLTVFRVIQESLT
FT                   NVLKHAGKTVVDVTLDWGVPKDKTLHISVDNAHGEALVNYKSDSVGRGLSGIKERALLH
FT                   GGKATWGASLSNAGGWRVNVEIPL"
FT   gene            348278..348943
FT                   /locus_tag="CPFRC_01675"
FT                   /old_locus_tag="cpfrc_00323"
FT   CDS_pept        348278..348943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01675"
FT                   /old_locus_tag="cpfrc_00323"
FT                   /product="response regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00323"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28116"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523794.1"
FT                   /protein_id="ADK28116.1"
FT                   /translation="MINVGLVDDQQLVRAGFNMVLSSQDDIQIAWEANNGAEALERIEV
FT                   EPVDVVLMDVQMPIMDGISATKELVTRGLMGPNDEPLRVIILTTFDSENYVMEAVENGA
FT                   SGFLLKDTAPEELIEAVRSVGEQSAVISPAATAKLFRRIRSGQTDKKPDGLKHINEDLI
FT                   EPLTPRELEILELIAMGKSNAEIAAELFISLPTVKTHVGRVLTKTGSRDRVHAVLFAF"
FT   gene            349123..349368
FT                   /locus_tag="CPFRC_01680"
FT                   /old_locus_tag="cpfrc_00324"
FT   CDS_pept        349123..349368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01680"
FT                   /old_locus_tag="cpfrc_00324"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00324"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28117"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241183.1"
FT                   /protein_id="ADK28117.1"
FT                   /translation="MHTIFSLCTICFDLLKKLNKRVSVIPYAFYPYLGRFLSKRIGLEI
FT                   EKFWQRIYIVWLVLISRIMMLGKAVLLGEEEQYCAQ"
FT   gene            349473..350483
FT                   /locus_tag="CPFRC_01685"
FT                   /old_locus_tag="cpfrc_00325"
FT   CDS_pept        349473..350483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01685"
FT                   /old_locus_tag="cpfrc_00325"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28118"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241184.1"
FT                   /protein_id="ADK28118.1"
FT                   /translation="MESMITVRHLSKKYGSKTAIADLSFTVPDGTVTGFLGPNGSGKST
FT                   TMRCILGLDRPTHGDVEFSTDTYTGTFANVKDKPKMAGAILDSSWFNPDSSWFNPARSG
FT                   RNHLRVLARGAGISDNRVEECLDIVGLQEAAKGKIGGYSLGMKQRIGVAAALLGDPQHL
FT                   ILDEPVNGLDPEGVSWMRNTIRSLAREGRSVLVFSHLLSEMQLTADRLVVIGRGHMIGE
FT                   YSLEEFLADGTRVQVETPHAVELAAKLQSQGFEIVDLQEAAGFSVNVDKDADEQAVRTT
FT                   VAMTALAAQLPVLGLSTIQDNLEQRFLAATAEVQEYRTKQAVDSAVGDTALSATQ"
FT   gene            350522..351283
FT                   /locus_tag="CPFRC_01690"
FT                   /old_locus_tag="cpfrc_00326"
FT   CDS_pept        350522..351283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01690"
FT                   /old_locus_tag="cpfrc_00326"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00326"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28119"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800016.1"
FT                   /protein_id="ADK28119.1"
FT                   /translation="MINALRSEITKLLTLRSTWVWAILLTGSLYGPVVLIGLFSGEVSD
FT                   YDWGFALPGAMIFVMLAVSFSASAMAGEFNDRMHAQAFLTQPRRSLWFNARTLVISGFL
FT                   LINYLVGVGLIYLVFLVFPKITLVNEKTVLILVDGVLFLVFSFIAIGVAALTRNRVAAM
FT                   AVPLAWFLAIERLITVAASQIAAFMPLWLVTPGERVSQLAKYGKDNAEFSSIGWDFMDV
FT                   QPLGYNIGIIVAWTVVSLLLGLWVNAKRDVR"
FT   gene            351405..352130
FT                   /locus_tag="CPFRC_01695"
FT                   /old_locus_tag="cpfrc_00327"
FT   CDS_pept        351405..352130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01695"
FT                   /old_locus_tag="cpfrc_00327"
FT                   /product="TIGR03943 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00327"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28120"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400979.1"
FT                   /protein_id="ADK28120.1"
FT                   /translation="MNIGQSHTGLAKGTAVGAFVIAALGVLLLTESITGGINNYLQPAF
FT                   RPWTLLSGVLLIGLGCWSIYSARRYPCSHSPMHTTSWLLLIPVILVALCAPTALGAASL
FT                   RYTAESTSATVRRNSLDDLAMEPLRGYGTNEITLEELTARFLRSDNTSMLAKTVSVAGF
FT                   ASRSIDGTWRLSRYKIFCCAADAMAYTASLAGATELVEDEWYEITAEVIAPPEGFNPQF
FT                   PVLKVDRATQIPQPEQPYL"
FT   gene            352127..353089
FT                   /locus_tag="CPFRC_01700"
FT                   /old_locus_tag="cpfrc_00328"
FT   CDS_pept        352127..353089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01700"
FT                   /old_locus_tag="cpfrc_00328"
FT                   /product="permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00328"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28121"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400980.1"
FT                   /protein_id="ADK28121.1"
FT                   /translation="MRKGLGQYGAVAALLILIALFIFGPLIQLHGIAEAWAQISIAIIL
FT                   QAIPFLILGVIISGFIELFVPEAAFRRLPRSQHLAVPTAAASGMLLPACECASVPITQS
FT                   LIRRGVPPAAALAFLLASPAINPVVLVSTAVAFGGDTRMMLARFVASLSAAVLVGWIWI
FT                   SGRAELSSGESRSHEHQHHAPSAWERLRESFLHDLLNAGGYLVLGALLAGMLKLFIPRD
FT                   WFLVLGDKPVLACLAMAVLAVLLALCSEADAFIAASFTMMPPTAQLVFLVVGPMVDVKL
FT                   MAMQRGAWGNGFIARFVPLTFAVALLTAIGVGALFFGDI"
FT   gene            complement(353086..353745)
FT                   /locus_tag="CPFRC_01705"
FT                   /old_locus_tag="cpfrc_00329"
FT   CDS_pept        complement(353086..353745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01705"
FT                   /old_locus_tag="cpfrc_00329"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00329"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28122"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523047.1"
FT                   /protein_id="ADK28122.2"
FT                   /translation="MLNQTAAELPIAGIIPFSATDWPGKLVAAAFTQGCPLRCVYCHNS
FT                   QLQAFTPGAHSLAEFLSLLSSRHGLIDAAVISGGEPTAVRGLGDAIAAIHNIGFPVGIH
FT                   TCGYAPSRIAELLRDPATTPDWVGLDIKALPRHMREVTGCSPRVATAVWDSLRILQESE
FT                   IDVTLRTTLWEGSVIEQNIDELRSVVKNRSMDSSVELVIQHARAADGSPWTPDCCF"
FT   gene            complement(353738..355534)
FT                   /locus_tag="CPFRC_01710"
FT                   /old_locus_tag="cpfrc_00330"
FT   CDS_pept        complement(353738..355534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01710"
FT                   /old_locus_tag="cpfrc_00330"
FT                   /product="ribonucleoside triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28123"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800020.1"
FT                   /protein_id="ADK28123.1"
FT                   /translation="MLFPMTESHVNSRSTIEEYLDRSDWRVNANANQDYSLGGMILNSA
FT                   GKITANYWLDNVFSPEAGQAHRDGTIHIHDLDMLSGYCAGWSLRQLLEQGFNGVSGTIS
FT                   SHPPKHFSSACGQIVNFLGTLQNEWAGAQAFSSFDTYMAPFVRLDNLSYNDVVQQMQEF
FT                   IFNLNVPSRWGTQTPFTNLTFDWTCPEDLQDQVPFIGEEPQPFTYGDLQSEMDIINRAF
FT                   IEVMSAGDADGRPFTFPIPTYNITKDFDWDSSNSKALFTMTAKYGLPYFQNFINSDLDP
FT                   GMIRSMCCRLQLDLRELLKRGNGLFGSAELTGSIGVVTLNCARLGYLHADDEEGLLANV
FT                   DKLVQLGIETLERRRAFVAKQMDAGLYPYSSRWLPSLDNHFSTIGVNGCNEMIRNFTHD
FT                   AYDLTDPQGHAQVARLLDHINDLLVKAQERTGHLFNLEATPAEGATYRLAKEDIKRYPG
FT                   ILHAGTEEEPYYTNSSQLPVSHTPDPFEALALQEDLQSKYTGGTVLHLYMGAAMSDGEA
FT                   CAKLVRRSLENFRLPYVTITPTFSICPTHGYISGEHPECPDCGEHTEMWTRVMGYFRPV
FT                   QSFNTGKKGEFHERTYFAETLA"
FT   gene            355806..356189
FT                   /locus_tag="CPFRC_01715"
FT                   /old_locus_tag="cpfrc_00331"
FT   CDS_pept        355806..356189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01715"
FT                   /old_locus_tag="cpfrc_00331"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28124"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300461.1"
FT                   /protein_id="ADK28124.2"
FT                   /translation="MSYNSYVAVEDWILDDLRIKDDDLVEALYMGDHGELFDVAAAWMD
FT                   VQEFLHSEGLSTAAVDGEEIIVGDPMVGIVAPQRVEKVLSDLSSVDDAAVREAGLGEAI
FT                   RSFTDFYEGARSSGLGVVVLAGE"
FT   gene            356625..356996
FT                   /locus_tag="CPFRC_01720"
FT                   /old_locus_tag="cpfrc_00332"
FT   CDS_pept        356625..356996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01720"
FT                   /old_locus_tag="cpfrc_00332"
FT                   /product="30S ribosomal protein S12"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00332"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28125"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_018297794.1"
FT                   /protein_id="ADK28125.1"
FT                   /translation="MPTIQQLVRKGRHDKTAKVSTAALKGSPQRRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTSGIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGALDT
FT                   QGVKDRKQARSRYGAKKEK"
FT   gene            357000..357467
FT                   /gene="rpsG"
FT                   /locus_tag="CPFRC_01725"
FT                   /old_locus_tag="cpfrc_00333"
FT   CDS_pept        357000..357467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="CPFRC_01725"
FT                   /old_locus_tag="cpfrc_00333"
FT                   /product="30S ribosomal protein S7"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00333"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28126"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_016458991.1"
FT                   /protein_id="ADK28126.1"
FT                   /translation="MRKNAAPKRPIVKDPVFGSEVVTQLVNKVLLDGKKSTAERIVYGA
FT                   LDICKEKTGTDPVLTLEKALGNIKPDLEVRSRRVGGATYQVPVEVRPGRANTLALRWLV
FT                   TFTRQRRENTMIERLANEILDAANGLGASVKRREDTHKMAEANRAFAHYRW"
FT   gene            357756..359882
FT                   /gene="fusA"
FT                   /locus_tag="CPFRC_01730"
FT                   /old_locus_tag="cpfrc_00334"
FT   CDS_pept        357756..359882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="CPFRC_01730"
FT                   /old_locus_tag="cpfrc_00334"
FT                   /product="elongation factor G"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00334"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28127"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004566710.1"
FT                   /protein_id="ADK28127.1"
FT                   /translation="MAQEVLKDLNKVRNIGIMAHIDAGKTTTTERILFYTGINRKVGET
FT                   HDGASTTDWMEQEKERGITITSAAVTCFWNGNQVNIIDTPGHVDFTVEVERSLRVLDGA
FT                   VAVFDGKEGVEPQSEQVWRQAAKYDVPRICFVNKMDKLGADFYFTVQTIIDRLGAKPLV
FT                   MQLPIGAEDDFDGIVDLLEMKAITWRGKVETGAEPVIEEIPADLADKAAEYREKLVETV
FT                   AESDEALMEKYFGGEELTIEELKAGIRKLTVNSEVYPVLCGTAYRNKGVQPLLDAVIDY
FT                   LPTPLDIGEVHGHKVGDESVDLVRKPSVDEPFSALAFKIAAHPFFGKLTFVRVYSGIVE
FT                   PGAQVANSTKGKNERIGKLFQMHANKENPVDEARAGNIYAFIGLKDTTTGDTLCDKNNQ
FT                   IILESMDFPDPVIKVSIEPKTKSDQEKLGTAIQKLSEEDPTFTVELDEESGQTVIGGMG
FT                   ELHLDVLVDRMKREFKVEANVGNPQVAYRETIRKPVEKLEYTHKKQTGGSGQFAKVIIG
FT                   IEPYAPEQETLEEGESAIYKFENAVTGGRIPKEYIPSVDAGIQDAMQYGYLAGFPLVNI
FT                   KATLIDGAYHEVDSSEMAFKLAGSQALKEAVAKAKPVLLEPLMAVEVITPEEYMGDVIG
FT                   DINSRRGQVSAMDDRAGAKVVKAKVPLSEMFGYVGDLRSRTQGRANYTMIFDSYAEVPT
FT                   NVATEIVAERNGTA"
FT   gene            360190..361380
FT                   /gene="tuf"
FT                   /locus_tag="CPFRC_01735"
FT                   /old_locus_tag="cpfrc_00335"
FT   CDS_pept        360190..361380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="CPFRC_01735"
FT                   /old_locus_tag="cpfrc_00335"
FT                   /product="elongation factor Tu"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28128"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005527719.1"
FT                   /protein_id="ADK28128.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPDLNE
FT                   AFAFDAIDKAPEEKERGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGA
FT                   ILVVAATDGPMPQTREHVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEIRELLAEQ
FT                   DYDEEAPIIHISALKALEGDEEWTKSILELMQACDDSIPDPERETDKPFLMPIEDIFTI
FT                   TGRGTVVTGRVERGQLNVNEDVEIIGIKEKSTQTTVTGIEMFRKLLDYTEAGDNCGLLL
FT                   RGIKREDVERGQVVVKPGAYTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDV
FT                   TGVVKLPEGTEMVMPGDNVDMSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK"
FT   gene            361476..362105
FT                   /locus_tag="CPFRC_01740"
FT                   /old_locus_tag="cpfrc_00336"
FT   CDS_pept        361476..362105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01740"
FT                   /old_locus_tag="cpfrc_00336"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00336"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28129"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522346.1"
FT                   /protein_id="ADK28129.2"
FT                   /translation="MMDRPHMDRMLDAVREVWEGQPDLDFAALMGMLNAHGLTWGISDS
FT                   DALDICMMISTTYPGALSKVAGQHSVLLANGTTAVLTSEQVVLLRGWQQPIWWNYESLV
FT                   QAQVGLPLVLKDREGIEHRLDMIHRIEKTMVVEGMDTRVIELVDASVILQRGHHARHFV
FT                   RRRRDLVTKDYQVPRAWVPGEGKPARLLTREQNIVELPAIATIILG"
FT   gene            complement(362247..362792)
FT                   /locus_tag="CPFRC_01745"
FT                   /old_locus_tag="cpfrc_00338"
FT   CDS_pept        complement(362247..362792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01745"
FT                   /old_locus_tag="cpfrc_00338"
FT                   /product="alkaline shock response membrane anchor protein
FT                   AmaP"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00338"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28131"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241197.1"
FT                   /protein_id="ADK28131.1"
FT                   /translation="MKRSTASFDRLLCILVGVLLGALAVWTIALKFDLLWAQQLADLAE
FT                   FPQWHQASQQRWFDVALFFAAIFFLISGIWIVVANLRRNHISRVTQNDGKISVNIDHIA
FT                   ELAAEDLEELEPVISAHGHVESRGQETVIILDILLESVPHALSIQQSLQQLDQDVAVAL
FT                   PETPIRTEYRVHMAKVED"
FT   gene            complement(362794..363345)
FT                   /locus_tag="CPFRC_01750"
FT                   /old_locus_tag="cpfrc_00339"
FT   CDS_pept        complement(362794..363345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01750"
FT                   /old_locus_tag="cpfrc_00339"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00339"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28132"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241198.1"
FT                   /protein_id="ADK28132.1"
FT                   /translation="MDSPSPTAIKGRPAARLAAILIGLAAIGIGFVAARELWWVRTEGN
FT                   HRHAWVDPILRFISAVTYQPWMLAAGVATAILALILIAIAFKPRPRTHVAFIDGVTCYM
FT                   RPLDIARLATLNAKQIPGVTQARTTVNSSARSIRVVASIDSQHLDEVKKYEERIRSVVE
FT                   PIALKLQTHPKLKVVVRGEG"
FT   gene            complement(363338..363799)
FT                   /locus_tag="CPFRC_01755"
FT                   /old_locus_tag="cpfrc_00340"
FT   CDS_pept        complement(363338..363799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01755"
FT                   /old_locus_tag="cpfrc_00340"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28133"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241199.1"
FT                   /protein_id="ADK28133.1"
FT                   /translation="MTPPPVTITDRALTKLAKAAVHSVPGTVRVSRRAGRSLPRIDVRR
FT                   DDLHSPPTVEAFIAVTWPSPVTGVAENVAAAISTWFSAYAGIHDVPVNVVVTALNHGTR
FT                   FAATHEIQPPEVTHPQVPDHQVLMPIVTAPPRPLKPIAIRRIEPRRSHG"
FT   gene            complement(363799..364005)
FT                   /locus_tag="CPFRC_01760"
FT                   /old_locus_tag="cpfrc_00341"
FT   CDS_pept        complement(363799..364005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01760"
FT                   /old_locus_tag="cpfrc_00341"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00341"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28134"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800025.1"
FT                   /protein_id="ADK28134.1"
FT                   /translation="MFQNKTLLGAILGVLVAFAILSGHVFLLLILAVAGGIGALIGAHC
FT                   DGKINLYKIFHDLIENVRRGGRG"
FT   gene            complement(364015..364353)
FT                   /locus_tag="CPFRC_01765"
FT                   /old_locus_tag="cpfrc_00342"
FT   CDS_pept        complement(364015..364353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01765"
FT                   /old_locus_tag="cpfrc_00342"
FT                   /product="Asp23/Gls24 family envelope stress response
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00342"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28135"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241201.1"
FT                   /protein_id="ADK28135.1"
FT                   /translation="MSTPRPSGLPNLPSYESAQALAEKILGIDGVAELRGGRFGEVALL
FT                   YPRHKVIGLRLDDAQGHQTLEVNVAAYYGYSLTDLAQSIVAAVTDSGLCDAASIDVVVS
FT                   DVVKLTQL"
FT   gene            complement(364366..364833)
FT                   /locus_tag="CPFRC_01770"
FT                   /old_locus_tag="cpfrc_00343"
FT   CDS_pept        complement(364366..364833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01770"
FT                   /old_locus_tag="cpfrc_00343"
FT                   /product="Asp23/Gls24 family envelope stress response
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00343"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28136"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241202.1"
FT                   /protein_id="ADK28136.1"
FT                   /translation="MSDAQNTPAADTSTAGSPTTLETTHGRTVIENTVVAKIAGLATRE
FT                   VSGVHAVGGNTARVVGALRDSIPGSRTNLQQGVEVEVGERQAAVDVAIVAEYGVAIHQL
FT                   AQAIRQNIINAIERMTGLEVTEVNVTVHDVHLDFDEDEGEANDSPTHTRVH"
FT   gene            365572..365877
FT                   /gene="rpsJ"
FT                   /locus_tag="CPFRC_01775"
FT                   /old_locus_tag="cpfrc_00344"
FT   CDS_pept        365572..365877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="CPFRC_01775"
FT                   /old_locus_tag="cpfrc_00344"
FT                   /product="30S ribosomal protein S10"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00344"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28137"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_009948626.1"
FT                   /protein_id="ADK28137.1"
FT                   /translation="MAGQKIRIRLKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTE
FT                   KNVYAVIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ"
FT   gene            365910..366566
FT                   /gene="rplC"
FT                   /locus_tag="CPFRC_01780"
FT                   /old_locus_tag="cpfrc_00345"
FT   CDS_pept        365910..366566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="CPFRC_01780"
FT                   /old_locus_tag="cpfrc_00345"
FT                   /product="50S ribosomal protein L3"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28138"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010189651.1"
FT                   /protein_id="ADK28138.1"
FT                   /translation="MSETEIKGILGTKLGMTQIFDEDNRVIPVTVVEAGPCVVTQIRTI
FT                   ETDGYNAIQIAYGDIDPRKANKPATGHFKKAGVTPRRHVAEIRMNDVSAYELGQDVTVE
FT                   IFEGITFVDVTGTTKGKGYAGAMKRHGFAGQGAAHGNQAAHRRVGGIGACATPGRVFKG
FT                   TRMAGRMGNDRVTTQNLKVQKIDADANLILIKGAIPGNRGGIVTVKTAVKGGAHA"
FT   gene            366563..367216
FT                   /gene="rplD"
FT                   /locus_tag="CPFRC_01785"
FT                   /old_locus_tag="cpfrc_00346"
FT   CDS_pept        366563..367216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="CPFRC_01785"
FT                   /old_locus_tag="cpfrc_00346"
FT                   /product="50S ribosomal protein L4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00346"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28139"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599749.1"
FT                   /protein_id="ADK28139.1"
FT                   /translation="MTNLKLDVLTAEGKTDGQVELPAEIFDREASVALMHQVVNAQLAA
FT                   KRQGTHSTKTRAEVSGGGRKPFRQKGTGRARQGSIRAPHFTGGGISHGPKPRDYSQRTP
FT                   KKMIKAALYGALSDRARHERIHVITELVPGQTPSTKSARAFVERITDRRNVLLVVGRED
FT                   TTAQKSARNLPGVHILFADQLNTYDVLKSDDVVFSVEALNTFINRVTGAAQEEK"
FT   gene            367216..367521
FT                   /gene="rplW"
FT                   /locus_tag="CPFRC_01790"
FT                   /old_locus_tag="cpfrc_00347"
FT   CDS_pept        367216..367521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="CPFRC_01790"
FT                   /old_locus_tag="cpfrc_00347"
FT                   /product="50S ribosomal protein L23"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00347"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28140"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599750.1"
FT                   /protein_id="ADK28140.1"
FT                   /translation="MAKIADPRDIILAPVVSEKSYGLMEQNTYVFFVSPSANKTEIKIA
FT                   IEQIFGVKVASVNTANREGKRKRTRSGYGVRKATKRAYVTLREGSDAIDIFGGSAA"
FT   gene            367543..368385
FT                   /gene="rplB"
FT                   /locus_tag="CPFRC_01795"
FT                   /old_locus_tag="cpfrc_00348"
FT   CDS_pept        367543..368385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="CPFRC_01795"
FT                   /old_locus_tag="cpfrc_00348"
FT                   /product="50S ribosomal protein L2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00348"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28141"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_011075029.1"
FT                   /protein_id="ADK28141.1"
FT                   /translation="MAIRKYKPTTPGRRQSSVSMFEEITRSTPEKSLVRPLPKKGGRNV
FT                   HGHITVRHKGGGHKRQYRVIDFRRNDKDGIPAKVAHIEYDPNRTANIALLHYVDGEKRY
FT                   IIAPKGMKQGQMIESGAAADIKVGNNLPLRNIPAGTTIHCVELKPGAGAKLARSAGASI
FT                   QLLGKAGKYAVLRMPSSEIRRVDIRCRATVGEVGNADQINIRWGKAGRMRWKGVRPTVR
FT                   GVVMNPVDHPHGGGEGKTSGGRHPVSPWGKKEGRTRNPNRYSNNMIVSRRRTNKSKKR"
FT   gene            368402..368680
FT                   /gene="rpsS"
FT                   /locus_tag="CPFRC_01800"
FT                   /old_locus_tag="cpfrc_00349"
FT   CDS_pept        368402..368680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="CPFRC_01800"
FT                   /old_locus_tag="cpfrc_00349"
FT                   /product="30S ribosomal protein S19"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00349"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28142"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013837842.1"
FT                   /protein_id="ADK28142.1"
FT                   /translation="MPRSLKKGPFVDEHLLAKVDAQNEKGTKQVIKTWSRRSTILPDFI
FT                   GHTFAVHDGRKHVPVFVDDSMVGHKLGEFAPTKTFKGHIKDDKKGRR"
FT   gene            368684..369046
FT                   /gene="rplV"
FT                   /locus_tag="CPFRC_01805"
FT                   /old_locus_tag="cpfrc_00350"
FT   CDS_pept        368684..369046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="CPFRC_01805"
FT                   /old_locus_tag="cpfrc_00350"
FT                   /product="50S ribosomal protein L22"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28143"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_018118340.1"
FT                   /protein_id="ADK28143.1"
FT                   /translation="MSESVTSARATARFVRVSPMKARRVIDLVRGKSIEEALAILKYAP
FT                   QAASEPVAKVVASAAANAENNFGLDRRSLVISEAFADEGPTMRRFSPRAQGCAFQIRKR
FT                   TSHITVVVESQKEGAK"
FT   gene            369046..369792
FT                   /gene="rpsC"
FT                   /locus_tag="CPFRC_01810"
FT                   /old_locus_tag="cpfrc_00351"
FT   CDS_pept        369046..369792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="CPFRC_01810"
FT                   /old_locus_tag="cpfrc_00351"
FT                   /product="30S ribosomal protein S3"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28144"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241209.1"
FT                   /protein_id="ADK28144.1"
FT                   /translation="MGQKIHPHGLRLGITSEWKSHWYADRNYSEYVAEDIRVREYLVKT
FT                   LDRAGIADIVIERTRDRVRVDIHTARPGIVIGRRGSEADRLRKELEKLTGKQVALNILE
FT                   VKNIDANAQLVAQSIAEQLTNRVAFRRAMRKAIQSAMRQPQVKGIKVVCSGRLGGAEMS
FT                   RTERYHEGRVPLHTLRAEIDYGTYEAHTTFGRIGVKVWIYKGDVVGGRRESEINAPAER
FT                   RRRGDRNARPRRGGQRRNRAEQKQEG"
FT   gene            369795..370211
FT                   /gene="rplP"
FT                   /locus_tag="CPFRC_01815"
FT                   /old_locus_tag="cpfrc_00352"
FT   CDS_pept        369795..370211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="CPFRC_01815"
FT                   /old_locus_tag="cpfrc_00352"
FT                   /product="50S ribosomal protein L16"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00352"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28145"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_020441956.1"
FT                   /protein_id="ADK28145.1"
FT                   /translation="MLIPKRVKYRRQHRPTRSGVSKGGNRITFGDYGIQALEPAYITNR
FT                   QIESARIAINRHVKRGGKVWINIFPDRPLTQKPLGVRMGSGKGPVEKWIANVKPGRILF
FT                   EMSFPNEEVALEALRRAGQKLPCKVRIVKKEDQF"
FT   gene            370211..370441
FT                   /locus_tag="CPFRC_01820"
FT                   /old_locus_tag="cpfrc_00353"
FT   CDS_pept        370211..370441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01820"
FT                   /old_locus_tag="cpfrc_00353"
FT                   /product="50S ribosomal protein L29"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00353"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28146"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599756.1"
FT                   /protein_id="ADK28146.1"
FT                   /translation="MANGTPAHELRELNAEELKTRLTEAKEELFNLRFQAATGQLTNNR
FT                   RLRTVKRDIARIYTVIRERELGLSEVPGAEA"
FT   gene            370444..370722
FT                   /gene="rpsQ"
FT                   /locus_tag="CPFRC_01825"
FT                   /old_locus_tag="cpfrc_00354"
FT   CDS_pept        370444..370722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="CPFRC_01825"
FT                   /old_locus_tag="cpfrc_00354"
FT                   /product="30S ribosomal protein S17"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00354"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28147"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599757.1"
FT                   /protein_id="ADK28147.1"
FT                   /translation="MSEANVNKKEKGARKVRTGYVVSDKMQKTIVVELEDRKQHAKYGK
FT                   TIRTNSKVKAHDEDSIAGVGDLVRIEETRPLSKDKHFRLVEIIEKAK"
FT   gene            complement(370883..372559)
FT                   /locus_tag="CPFRC_01830"
FT                   /old_locus_tag="cpfrc_00355"
FT   CDS_pept        complement(370883..372559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01830"
FT                   /old_locus_tag="cpfrc_00355"
FT                   /product="ABC transporter family substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28148"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800027.1"
FT                   /protein_id="ADK28148.2"
FT                   /translation="MKLRSPSGKLAAVFAASALLLAGCGGDSSTSKNAQNADSISVADY
FT                   NPLDRDKVKQGGTFTTAIGEISEQQNRHHADSTRYTTMLWEWYNPSIIESTAEGESSFN
FT                   KNYVTDAKEESSGSKTKIVYTINDKAVFNDGTPIDWHAFETTWKINNGKNPTFSPSSTD
FT                   GYENIASVTKGANDKQAVVEFESTYPWWQGLFGIIAHPALNDPHNYNDYVKKVHPEWGA
FT                   GPYKVESIDFNRGEATFVPNEKWWGDTPKLDKRIFRQMDTAAAVNAFKNGEIDATAVPS
FT                   KDRYAAVKDMQGIELRTGRLPKNALLVLNAKSDVLQDIKVREAVSRGLDRKLLSSIWFQ
FT                   GVPYTEDPPGSLINFPFQKNYQDNFSKVATFDAGKAKALLDESGWAEGPDGIREKDGKP
FT                   LSLRYVLVGEDEQTTSIAKASQKMLKDIGIDLKIETHPSSDFSKLVSSDDYDIFPIGFT
FT                   ASDPFGVTYFGQTYLSDSQLNRSHAGTPELDAKIRELQALPTRDEQNKRANELEVEALA
FT                   RYGVIPQFNGVNIVAVKKGLANYGAYAFANVPVENIGWASE"
FT   gene            complement(372590..374662)
FT                   /gene="oppD"
FT                   /locus_tag="CPFRC_01835"
FT                   /old_locus_tag="cpfrc_00356"
FT   CDS_pept        complement(372590..374662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="CPFRC_01835"
FT                   /old_locus_tag="cpfrc_00356"
FT                   /product="oligopeptide ABC transporter ATP-binding protein
FT                   OppD"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00356"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28149"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241213.1"
FT                   /protein_id="ADK28149.1"
FT                   /translation="MTNPVLSVQNLNVTFPSEAGNVNAVRGVSFNLYPGQTLGIVGESG
FT                   SGKSVASMAVMGLLPDYATFTGSAQLHNRELIGLSDDAMSKIRGKEIGMIFQDPLSALT
FT                   PVFNVGSQIVEALRCHQKITKAKAWDTAIELLDLVGIPDPKRRALAFPHEFSGGMRQRV
FT                   VIAIAIANNPSVLIADEPTTALDVTIQAQILDLIKMAQKETNAATIMITHDMGVVAGTA
FT                   DNVMVMYAGRPVEYAGVHELFSEPKMPYTVGLLGSIPSVRKREKVSLTTIEGSPPIVVN
FT                   LPDECSFAPRCPIATAECLKTEPGLLSINDKHQAACIRSTEISHGELNGAPIFPTPPVH
FT                   EGALMRIPREKRSCVLSVSDLTKTFPLVKGALLKRTVGEVRAVNGLTFDIKEGECFAIV
FT                   GESGCGKTTTLLEIMDLAPQAPTQIQLGEKDVAGISKRQRRLLRKDIQIVFQDPMGALD
FT                   PRLTVAEILREPLDSLGWDGDKNERIRELIQLVGLNPAHIHIDRFPGHFSGGQRQRISL
FT                   ARALAANPKLIVLDEPVSALDVSVQAGMLNLLDELKARLGISYLFVAHDLSVIRHISDR
FT                   AAVMYLGRFVEQGDTDSLFDNPQHPYTKALLSAIPLADPIAERNRRRIILTDSQPSPTE
FT                   EITGCAFRGRCPLYVTLGDAHQRRCRTEEPEVRSLDNSDNPDHLHACHFAGTPLN"
FT   gene            complement(374666..375706)
FT                   /locus_tag="CPFRC_01840"
FT                   /old_locus_tag="cpfrc_00357"
FT   CDS_pept        complement(374666..375706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01840"
FT                   /old_locus_tag="cpfrc_00357"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00357"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28150"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241214.1"
FT                   /protein_id="ADK28150.1"
FT                   /translation="MRKEYRNNGEDRHEDLSPNVLPTADLTVSSSPLTQTNTSSVTESE
FT                   ILNAQQGIETAHVTGKNPMRKYRLYLRRFLRNKMAVIGSIILFLLFLLAVFGSLVAQWS
FT                   FDDPDFLALSSPPSPEHWFGTSSSGNDLFAMVVHGLGRSLTIAITVSLATTLISAFVGS
FT                   TAALLGGRPERAILGIIHFLLVIPSFLIIALIVSGSGGDWKLLIVVLIVFGWMYYARVI
FT                   WSMALSLREREYIKAARYMGVSNFTIIRRHLIPNIGSLLVINATLGVVSAVMSETGLSF
FT                   LGLGVKIPDVSLGTLLSTGANSLLSSPWEFYFPAAVLTLLTVSMAFIADGLRDALDPNS
FT                   AAVGKA"
FT   gene            complement(375708..376691)
FT                   /locus_tag="CPFRC_01845"
FT                   /old_locus_tag="cpfrc_00358"
FT   CDS_pept        complement(375708..376691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01845"
FT                   /old_locus_tag="cpfrc_00358"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00358"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28151"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522347.1"
FT                   /protein_id="ADK28151.1"
FT                   /translation="MIKFLVKKTLGWLAMIFLAVNLTYFLASFFLDPRSNYAGRRPPVP
FT                   ESRIDAILTPLNLNDKESIFERWWHWLSNVVLHWDWGSSPLGDPINSQISYRIWVSAQL
FT                   LLLATIISVLLGVGIGVFTASRQYKAGDRVFQFISILAMNIHVVVASIVVVWIAIKTNQ
FT                   ALGTNLFFVTGSSSVGVEGFIPKLIDYAQHLILPTVSLIIISYASYHFLQRSILLDNID
FT                   ADYVRTARAKGLTRAQAVRRHALRTSIIPVATTVAFSIPGIFTGAIMTETIFGWQGMGQ
FT                   YFVSTINKNDIHGVVAVAAFGALMTAIGAVLADIFVVILDPRVRVS"
FT   gene            377404..377772
FT                   /gene="rplN"
FT                   /locus_tag="CPFRC_01850"
FT                   /old_locus_tag="cpfrc_00360"
FT   CDS_pept        377404..377772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="CPFRC_01850"
FT                   /old_locus_tag="cpfrc_00360"
FT                   /product="50S ribosomal protein L14"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28153"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010189586.1"
FT                   /protein_id="ADK28153.1"
FT                   /translation="MIQQESRLRVADNTGAREILCIRVLGGSTRRFAGIGDVIVATVKE
FT                   ATPGGNVKAGEVVKAVIVRAKKETRRADGSYIRFDENAAVLIKNDNEPKGTRIFGPVAR
FT                   ELRDKRFMKIVSLAPEVI"
FT   gene            377775..378089
FT                   /gene="rplX"
FT                   /locus_tag="CPFRC_01855"
FT                   /old_locus_tag="cpfrc_00361"
FT   CDS_pept        377775..378089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="CPFRC_01855"
FT                   /old_locus_tag="cpfrc_00361"
FT                   /product="50S ribosomal protein L24"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28154"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_020441932.1"
FT                   /protein_id="ADK28154.1"
FT                   /translation="MKVHKGDMVLVISGPDKGAKGKVIQAFPQTEKVLVEGVNRVKKHV
FT                   ANSAPERGAESGGIVTQEAPIHVSNVMVLDSDGNPTRIGYRFDENGKKVRISRRNGKDI
FT                   "
FT   gene            378092..378655
FT                   /gene="rplE"
FT                   /locus_tag="CPFRC_01860"
FT                   /old_locus_tag="cpfrc_00362"
FT   CDS_pept        378092..378655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="CPFRC_01860"
FT                   /old_locus_tag="cpfrc_00362"
FT                   /product="50S ribosomal protein L5"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00362"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28155"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241219.1"
FT                   /protein_id="ADK28155.1"
FT                   /translation="MSENYTPRLKTRYREEIRTALNEEFSYENVMQIPGVTKVVVNMGV
FT                   GDAARDSKLINGALEDLTLITGQKPELRRAKKSIANFKLREGMPIGARVTLRGDRMWEF
FT                   LDRLLTVALPRIRDFRGLSDQQFDGHGNYTFGLAEQTMFYEIDVDKVDRPRGMDITVVT
FT                   TATNNEEGRALLRELGFPFKKAEN"
FT   gene            379350..380693
FT                   /locus_tag="CPFRC_01865"
FT                   /old_locus_tag="cpfrc_00363"
FT   CDS_pept        379350..380693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01865"
FT                   /old_locus_tag="cpfrc_00363"
FT                   /product="HAAAP family serine/threonine permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00363"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28156"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525334.1"
FT                   /protein_id="ADK28156.1"
FT                   /translation="MSQTISVPANSGSADSSSSDSSPSHSTSAPKWRKSDTVWALSLFG
FT                   TAIGAGVLFLPINAGIGGIIPLIVMTIVAFPMTYWAHRGLTRFVLSSSRGGGDLTDAVE
FT                   EHFGRKAGAFMTILYFLSVYPILLVYSVTITNTVNSFLEHQLGVTPWPRWLMSLILVGG
FT                   LIFVVSLGRDVIVKAMSVLVFPFIGILVLLSLYLVPKWNTSLFETFSLESASAATGHSI
FT                   WVTLLLLVPVMVFSFNHSPIISSFAVEKREEYGIYADEKTGKVLRVAQILMVCVVMFFV
FT                   FSCALSLSPQNLAEAKSQNITILSYLANHFDNPVIQWAAPVIAMIAVAKSFLGHYLGAA
FT                   EGFQGLISKKGAEAPAGAKGDRKLALITLSFILVTAWLVGWLNPSILGMIETLCGPTIA
FT                   ILLFLMPMYAIHKVPALQKYRGRLSNYFIFFMGLVAFGTIFYNIVQAI"
FT   gene            380745..382121
FT                   /locus_tag="CPFRC_01870"
FT                   /old_locus_tag="cpfrc_00364"
FT   CDS_pept        380745..382121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01870"
FT                   /old_locus_tag="cpfrc_00364"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00364"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28157"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366504.1"
FT                   /protein_id="ADK28157.1"
FT                   /translation="MFISSFDMFKIGIGPSSSHTLGPMKAGKAFADELETRGLLDATVR
FT                   VQADVYGSLSLTGVGHATDKAIIMGLAGFEPESVDIDAMPSFLEEVASLQRLPLSGGKK
FT                   LVNFPRGKDIVFHNTCLQLHENGMTITAFSEEEVLLQKTYFSIGGGFIVDEEHFGVVDE
FT                   DTSSVPFAYRSAEEFLTMCDIEGLSIPELEWRNETAAASEEEVRAHLAKAWNVMRTGIE
FT                   RGSSAEGILPGELRVPRRAKALRTRLENTSENEPLRMMSWLNMFALAVNEENAAGGRVV
FT                   TSPTNGACGVLPAVLSYWDKLVKPVDEKMYTDYFLTCKVVGALYKMNASISGAEVGCQG
FT                   EVGVACSMAAAGIAQLMGGTPQQVFIAAEIAMEHNLGLTCDPVCGQVQVPCIERNAVAA
FT                   VEAVNAANMALQRESNPTVSLDQIIATMYQTGKDMDSKYRETSLGGLAKVVLPKLMPCS
FT                   "
FT   gene            382330..383406
FT                   /locus_tag="CPFRC_01875"
FT                   /old_locus_tag="cpfrc_00366"
FT   CDS_pept        382330..383406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01875"
FT                   /old_locus_tag="cpfrc_00366"
FT                   /product="asparaginase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00366"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28159"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241223.1"
FT                   /protein_id="ADK28159.1"
FT                   /translation="MTQIFSRRRFLGATALAATGGIGVLTACAQEEAKPKLGKEEATKD
FT                   VDYSAISGHLVVLSTGGTIASTNVDGALVPTVSGEDLVAPVYKKFSKDKLTIEVRQVSQ
FT                   LDSSAMTLKDTDNIIREVLKTVKEDKVTGVIVTHGTDSMEESAIAVDTFLSGDKPVVFT
FT                   GSMLPFDDPHTDGPDNLTLAVTAATDSKNQGKGAFIAFGGTLIRARGAYKSHTSENDGF
FT                   RTNASEDLVRPKALDFKPLESHRVDIIAAYPGAPRELIDAAISTGAEALVIEGMGAGNV
FT                   GGDIAEGIVAAAEKNIPVVMTTRVDAGLVEGTYGGAGGGATLAQKGVIGSNYLRAGQSR
FT                   IVLAAALATGADPKTLFS"
FT   gene            383948..385105
FT                   /locus_tag="CPFRC_01880"
FT                   /old_locus_tag="cpfrc_00367"
FT   CDS_pept        383948..385105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01880"
FT                   /old_locus_tag="cpfrc_00367"
FT                   /product="phosphatase PAP2 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00367"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28160"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241224.1"
FT                   /protein_id="ADK28160.1"
FT                   /translation="MHSQCFRSLRIQAWGHRWRRQASYIQVLQSRNRLVRRIIYGYISD
FT                   ISSYSGGIYYDVVSNFEDLRQNHPKAMEENSATSIRINNEATAESVARAQRDALTEHDG
FT                   VLVAFSDALGPRLGEHLRTALAENRLPKLQMLLGGWTARAGGLASSTFVEKNIFRNPRP
FT                   YIAHAGSIRQYRVSHHDLYPTSGSFPSGHTNQATWTTALWAYMLPEFSAQILDRGSEAR
FT                   FNRVVLGVHYPLDVIGGRMTGNAAAADRLNDPKMRIALDAAAAELRAELEWRCGKSLLE
FT                   CATDTRSKEQAVQKYTERMTYGMKTRVYSSEAPMVVPQAAPVLLASAFPSLTWGQRAEV
FT                   LRQTAFEAGYPLDDQSTRGSWQRINLARAMAASVTVGANGVVSVN"
FT   gene            385398..385796
FT                   /gene="rpsH"
FT                   /locus_tag="CPFRC_01885"
FT                   /old_locus_tag="cpfrc_00368"
FT   CDS_pept        385398..385796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="CPFRC_01885"
FT                   /old_locus_tag="cpfrc_00368"
FT                   /product="30S ribosomal protein S8"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00368"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28161"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_003854344.1"
FT                   /protein_id="ADK28161.1"
FT                   /translation="MTMTDPIADMLSRVRNANHARHDVVSMPSSKLKANIAEILKQEGY
FT                   IADYKVEEVKVGKTLTLNLKYGPNRQRSIEGVRRVSKPGLRVYAKSTNLPKVLGGLGVA
FT                   IISTSQGLLTDRQATEKGVGGEVLAYVW"
FT   gene            385813..386349
FT                   /gene="rplF"
FT                   /locus_tag="CPFRC_01890"
FT                   /old_locus_tag="cpfrc_00369"
FT   CDS_pept        385813..386349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="CPFRC_01890"
FT                   /old_locus_tag="cpfrc_00369"
FT                   /product="50S ribosomal protein L6"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00369"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28162"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599777.1"
FT                   /protein_id="ADK28162.1"
FT                   /translation="MSRVGKAPIAIPSGVETKIDGQLVEVKGPKGTLSFELPEPIRASI
FT                   EDGQISVVRPDDHRKNRSLHGLSRSLVNNMVVGVSEGYTIKMEIFGVGYRVALKGQNLE
FT                   FSLGYSHPVLIEAPEGITFAVDGNTKLSVSGIDKQKVGQIAAIIRRLRKDDPYKGKGIR
FT                   YEGEQIRRKVGKTGK"
FT   gene            386353..386760
FT                   /gene="rplR"
FT                   /locus_tag="CPFRC_01895"
FT                   /old_locus_tag="cpfrc_00370"
FT   CDS_pept        386353..386760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="CPFRC_01895"
FT                   /old_locus_tag="cpfrc_00370"
FT                   /product="50S ribosomal protein L18"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28163"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599778.1"
FT                   /protein_id="ADK28163.1"
FT                   /translation="MSNNENNNGKRLPVGKDISTRRRIARARRHNRIRKNLCGTAETPR
FT                   LVVHRTSRHMHVQVIDDFAGHTLAAASTLEAEVRAIEGDKKAKGAKVGQLIAERAKAAG
FT                   IESIVFDRAGYKYHGRVAALADAAREGGLKF"
FT   gene            386801..387427
FT                   /gene="rpsE"
FT                   /locus_tag="CPFRC_01900"
FT                   /old_locus_tag="cpfrc_00371"
FT   CDS_pept        386801..387427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="CPFRC_01900"
FT                   /old_locus_tag="cpfrc_00371"
FT                   /product="30S ribosomal protein S5"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28164"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599779.1"
FT                   /protein_id="ADK28164.1"
FT                   /translation="MPGRERRDGGRSADDNQKKNDRRGGRRDDRRNQQQDERSQYIERV
FT                   VTINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIQKGAEEARKNFFRV
FT                   PMVAGTITHPVQGEAAAGIVMMRPAAPGTGVIAGGAARPVLECAGVQDILCKSLGTDNA
FT                   INVVHATVAGLKQLNRPEEVAARRGKTLEEVAPARMLRARAGQEA"
FT   gene            387430..387615
FT                   /gene="rpmD"
FT                   /locus_tag="CPFRC_01905"
FT                   /old_locus_tag="cpfrc_00372"
FT   CDS_pept        387430..387615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="CPFRC_01905"
FT                   /old_locus_tag="cpfrc_00372"
FT                   /product="50S ribosomal protein L30"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00372"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28165"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004566826.1"
FT                   /protein_id="ADK28165.1"
FT                   /translation="MALKITQHKGLVGANPKQRKNMAALGLKRINHSVVHEDTPAVRGM
FT                   INVVRHMVSVEEVAGE"
FT   gene            387619..388065
FT                   /gene="rplO"
FT                   /locus_tag="CPFRC_01910"
FT                   /old_locus_tag="cpfrc_00373"
FT   CDS_pept        387619..388065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="CPFRC_01910"
FT                   /old_locus_tag="cpfrc_00373"
FT                   /product="50S ribosomal protein L15"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00373"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28166"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013889193.1"
FT                   /protein_id="ADK28166.1"
FT                   /translation="MSEPIKLHDLRPAKGANKPKTRVGRGEASKGKTAGRGTKGTKARK
FT                   QVSAAFEGGQMPIHMRLPKLKGFKNPSKVYYQVVNVADLEKAFPNGGEIAAADIAAAGL
FT                   VRAKQPVKVLGEGEISVKLTVSGVKFSKSAKEKIEAAGGSIAEA"
FT   gene            388292..388747
FT                   /locus_tag="CPFRC_01915"
FT                   /old_locus_tag="cpfrc_00374"
FT   CDS_pept        388292..388747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01915"
FT                   /old_locus_tag="cpfrc_00374"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00374"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28167"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241231.1"
FT                   /protein_id="ADK28167.1"
FT                   /translation="MQKIKVSLIAGAVCCLTLGGSVAGASQILLTEDGGRETNVRESVE
FT                   KLGDTWSCKREWDVTDRGGSYPVVFQRPCTVSLLGSAYEKLQSSDKQETRGLRADLREA
FT                   SAERDYYKKLSKDQWDLIEKLAKNDDTYKAEVEKLKPRLSGPSQTGR"
FT   gene            389218..390465
FT                   /locus_tag="CPFRC_01920"
FT                   /old_locus_tag="cpfrc_00375"
FT   CDS_pept        389218..390465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01920"
FT                   /old_locus_tag="cpfrc_00375"
FT                   /product="extracellular solute-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28168"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366510.1"
FT                   /protein_id="ADK28168.1"
FT                   /translation="MKIHAKKALSVLAISTLVLAGCSSDKDSKGANGSGDSKGGKITLS
FT                   VWSSQEDQDGSDGWLQSVEKKFEEAHPDYDITWKNSVVGADQAATTVNQDPSAAADVYV
FT                   YANDRLGSLLDSGSVGELSDASMKQLSEQAEDTIAASVKGQDGKAYGLPIEPNTWFMYY
FT                   NKAKLNQEDIKSFDTMLSKAKVSFPMSNSWYYPAFYAGAGASFFGKDGLDEKAGIKLGD
FT                   KAGEVTKYLTSVVKNPNFVNDSEGSGIGGLANGSVDVVFSGSWDAKNIKKALGDNYGVA
FT                   SLPTFKLDGQDVQMKAFSGSKAIAYNPNTKNPKAASEFAAFLASTESQKSHFDKNGVIP
FT                   ADKSLAKDAAIAADPVAVALFETVSNASILQPTLKPMTDFWDPATTFGKALVNGEVNSE
FT                   NAVAKTDAWTSSFSKK"
FT   gene            390575..391981
FT                   /locus_tag="CPFRC_01925"
FT                   /old_locus_tag="cpfrc_00376"
FT   CDS_pept        390575..391981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01925"
FT                   /old_locus_tag="cpfrc_00376"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00376"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28169"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522119.1"
FT                   /protein_id="ADK28169.1"
FT                   /translation="MKAGVHRSGVLTKSKSKTQKRNDEPSLYSLSRAWANGDNVTKASF
FT                   VVFGLGNLVRKQFLKGIVLLAIEIVAIALFCDKGIKALQELPGLGTGEQGRVKVGGFWV
FT                   YKNSEPSVVLLLEGVATIFLIIVFLWLATIALRSAYKAQTFVEKQGRARTLKEDLHALT
FT                   DEDAPITLMSLPTAGILIFTVLPLIFMISMAFTSYDSRNVQKFDWVGLENFGKVFSNTG
FT                   GEVNLQIFIGVLTWTLVWAFFATFLNYFLGMFLAMIIQRKTTRGKTFWRAIFSLSVAVP
FT                   QFVTLLVLRSMLQPEGIVNRLLLNWGWIDSSLPFFTDATWARVTVIIVNLWIGIPYTIM
FT                   QVTGILQNIPGELYEAARLDGASWWQTYRNVTLPYMFFVMTPYLITTFTANVNNFNVIY
FT                   MLSRGDPTPIGASAGKTDLLITWLYKLTVDRGDYNVGAVIGILTFIVLSTVALITYRRS
FT                   GSYRNEEGFQ"
FT   gene            391981..392859
FT                   /locus_tag="CPFRC_01930"
FT                   /old_locus_tag="cpfrc_00377"
FT   CDS_pept        391981..392859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01930"
FT                   /old_locus_tag="cpfrc_00377"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00377"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28170"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241234.1"
FT                   /protein_id="ADK28170.1"
FT                   /translation="MSTKQVGIRGSQRRTRQLVDFFVHLFLTVLAIIWVIPIVWVVAES
FT                   FNKNTAPYTNTFLPTEYSVDNYVQLFTDHSVLNFPKMFVNTLIIACFTCAISIVFVLFV
FT                   SYSLSRLRFRFRKVYMNTALILGMFPGIMSVVAIYFILKAIGLTQDWTTTFALIIVYSA
FT                   GTGMGFYVMKGFMDTIPISLDEAALLDGCTRWQVFTKIILPISKPMIVYQAIVGFLTPW
FT                   LDFVLAKAIARTQENYTVSLGLWKMLEKEYIYDWFARFAAGAVCISIPITILFIVMQRY
FT                   YQESMAGSVKG"
FT   gene            392992..393735
FT                   /locus_tag="CPFRC_01935"
FT                   /old_locus_tag="cpfrc_00378"
FT   CDS_pept        392992..393735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01935"
FT                   /old_locus_tag="cpfrc_00378"
FT                   /product="traX"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00378"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28171"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241235.1"
FT                   /protein_id="ADK28171.1"
FT                   /translation="MNVQLRQRGLNAHKLAGLAGFFILASSLGSLMVRPTDTGYVDAGL
FT                   GLLTVGIVMEVISWCAIPLVAWLYTWAIKRGINRWRLAAWTFVIAAVSEVPYDLALDRR
FT                   AWSTESQNPAWVLLVALVVLAAIDITAQLSTALRWAVMLGVTLAAVFWIVALSLGTRLG
FT                   ILPMGIALLGFVIIFYLFWGAENRMMYSAGAFGAAMFISPALGTVFLHYRQPLLDQEGT
FT                   LPAAWVPWAYPVILLFTGLIATVLL"
FT   gene            393904..394701
FT                   /locus_tag="CPFRC_01940"
FT                   /old_locus_tag="cpfrc_00379"
FT   CDS_pept        393904..394701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01940"
FT                   /old_locus_tag="cpfrc_00379"
FT                   /product="formate/nitrite transporter family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00379"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28172"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300470.1"
FT                   /protein_id="ADK28172.2"
FT                   /translation="MTAPVSLTNKVSSAVAKKVVLFETDFWRYSVRCIFAGVYLTLGTA
FT                   FAVTLGQKLDHVVHGVGYPIFGLMFFVGLYTIVLLNAELATSNMMYLGFGVVHKKLSLP
FT                   KATQILLVCTFFNLVGAVLVAFLLSRAVVFSHVDAESLVSTITETKLGKSSLGLLVEGI
FT                   LANVAVNMGIIGVAMVKEFSGKFLTLVVTISMFTVMGLEHVIANFSLVSLVGFSAESLP
FT                   SHFDAAHIARNWAIVFIGNLIGGGVCMGAAYAWLNRGNEKYRD"
FT   gene            complement(394722..395969)
FT                   /locus_tag="CPFRC_01945"
FT                   /old_locus_tag="cpfrc_00380"
FT   CDS_pept        complement(394722..395969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01945"
FT                   /old_locus_tag="cpfrc_00380"
FT                   /product="DUF4032 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28173"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800039.1"
FT                   /protein_id="ADK28173.2"
FT                   /translation="MPATPFMQITNGTIAPALLQLPWSLPLEDWPEEYLASLPRGISRH
FT                   VVRFVGIDGRVFAIKEIGQKVAYHEYKTLRDLNRLGAPSVRPLAVITGRVDATGEPLTA
FT                   ALVTEHLKFSLPYRAVFSQSMRSETATRLIHSLAVLLVRLHLLNFFWGDVSLSNTLFRR
FT                   DADSFSGYLVDAETGELQPKLSDQRRLYDVDIARVNIIGELMDLQSGKLLSPDVDAIEI
FT                   GNRIVEKYSLLWEELTAEQTIRPDEHWKVQQRIDKLNALGFDVGELKLTSSDEGQSVHI
FT                   RPRVVDAGHHHRALMRLTGLDVQENQARRILNAIETYRAIHSDSHRPMSTIAHEWLTHI
FT                   FEPTLAAIPKEYSARLQPAQIFHEVLEHQWYLSEQAGHEIPLNSAAVDYAKTILPHRPD
FT                   EERMLDQDPHDELSED"
FT   gene            complement(396085..397221)
FT                   /gene="ugpC"
FT                   /locus_tag="CPFRC_01950"
FT                   /old_locus_tag="cpfrc_00381"
FT   CDS_pept        complement(396085..397221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpC"
FT                   /locus_tag="CPFRC_01950"
FT                   /old_locus_tag="cpfrc_00381"
FT                   /product="sn-glycerol-3-phosphate ABC transporter
FT                   ATP-binding protein UgpC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28174"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300472.1"
FT                   /protein_id="ADK28174.1"
FT                   /translation="MASVTFEKASRVYPGANKPAVDEFDLHIEDGEFLVLVGPSGCGKS
FT                   TTLRMLAGLEEVNSGRVSIGNRDVTDIPPRDRDIAMVFQNYALYPHMTVRENMGFALKI
FT                   DKKPKEEINRRVEEAARTLDLTEYLDRKPKALSGGQRQRVAMGRAIVRKPEVFLMDEPL
FT                   SNLDAKLRVQTRTQIAALQRELGVTTLYVTHDQTEALTMGDRIAVLKFGVLQQVGTPRE
FT                   LYDFPANEFVAGFIGSPAMNLGTFTVEGDHAVLGKARVPLSPATRAAITPSDNGKITIG
FT                   FRPEALEVVSENEPNTIPVKLHMVEELGSDAYMYGKLEGGGSLGSGTDANPDDESTDEI
FT                   IIRTAPHAAPPIGSIIHVRIREGAQHNFSKSTGMRLPE"
FT   gene            397923..399245
FT                   /gene="secY"
FT                   /locus_tag="CPFRC_01955"
FT                   /old_locus_tag="cpfrc_00382"
FT   CDS_pept        397923..399245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="CPFRC_01955"
FT                   /old_locus_tag="cpfrc_00382"
FT                   /product="preprotein translocase subunit SecY"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00382"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28175"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599793.1"
FT                   /protein_id="ADK28175.1"
FT                   /translation="MSAIFQAFRDADLRKKILITLALIVLYRIGAQIPSPGVDYASISG
FT                   RLRELTSDSSSVYSLINLFSGGALLQLSIFAIGVMPYITASIIVQLLTVVIPRFEELKK
FT                   EGQSGQAKMDQYTRYLTLGLALLQSSGIVALADRKQLLGAGVQVLMPNAGLWTLIMLVL
FT                   VMSAGAMLVMWLGEIITERGVGNGMSLLIFAGIATRLPSDGANILNSSGGVVFAVVLVA
FT                   VIILVVGVVFVEQGQRRIPVQYAKRMVGRRQYGGSSTYLPLKVNQAGVIPVIFASSLIY
FT                   MPVLITQIINSGSHEVSDNWWQRNVIQYLQTPSSWQYIVLYFVLIIFFSYFYVSVQYDP
FT                   NEQAENMKKYGGFIPGIRPGRPTAEYLGFVMNRLLFVGALYLGIIAVLPNIALDLGVGA
FT                   SSAGSTPFGGTAILIMVSVALTTVKQIESQLLQSNYEGLLK"
FT   gene            399245..399790
FT                   /locus_tag="CPFRC_01960"
FT                   /old_locus_tag="cpfrc_00383"
FT   CDS_pept        399245..399790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01960"
FT                   /old_locus_tag="cpfrc_00383"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00383"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28176"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599794.1"
FT                   /protein_id="ADK28176.1"
FT                   /translation="MRLVLLGPPGAGKGTQAAILSEKLGIPHISTGDLFRANIGEGTPL
FT                   GIEAKQYIDNGKLVPTDVTARMVKSRLEEEDAKDGFLLDGFPRTVEQAEILEGFLEEFG
FT                   TTLDGVINYQVSEDVVVERMLARGRADDNESTIRTRLQVYREETAPLIDHYGEQIIAIT
FT                   AEGTVEDINSRTLEALGK"
FT   gene            399952..400736
FT                   /pseudo
FT                   /gene="map"
FT                   /locus_tag="CPFRC_01965"
FT                   /old_locus_tag="cpfrc_00385"
FT   CDS_pept        399952..400736
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="CPFRC_01965"
FT                   /old_locus_tag="cpfrc_00385"
FT                   /product="type I methionyl aminopeptidase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014318692.1"
FT   gene            401124..403208
FT                   /locus_tag="CPFRC_01970"
FT                   /old_locus_tag="cpfrc_00386"
FT   CDS_pept        401124..403208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01970"
FT                   /old_locus_tag="cpfrc_00386"
FT                   /product="exo-alpha-sialidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00386"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28179"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241243.1"
FT                   /protein_id="ADK28179.1"
FT                   /translation="MTDSHRRGTRKALVTLTAALALTTQGLTAPATLAEEGSTIVPAPI
FT                   DNNGLFDAAPPAPVARGAVGEGKLPDPVTSEFFDSKVIRDVDPAGQRCFRIPAIATAVD
FT                   GTLLVAFDNRYGPDAQSRTWCRDAPYENTKRNSREKQTDIEIYRSHDSGKSFEEGDFIA
FT                   KGTEDPRDLSYTDPSIVVDHETGKIFAVFVRGYDYRFFDATAGVNRGSVEDPIQKRSVQ
FT                   DTVIIESNDNGQTWGNMKLLSELTEKIKVRHKPGQELAGRGRFATSGNGIQLKYGENAG
FT                   RLLFPMSVHYSPNGAGAVANVALYSDDHGATWNVGQGVGGEGETNGDENKLVELSDGRI
FT                   MMNSKSTGSNPSNPRGAERWRSYSEDQGETWSKPEPVIVAPPQHPLQRNTGINVSLIKA
FT                   YPSAPEGSAAARVLLYSAPIDTRIKGEYGQDGRSNGWVMASCDDGRSWTHGRQIEAGRF
FT                   QYSVMTPMADGNIGMVYESGDKERGMTLKFAKFNMAWLGADCLSNKALGITDLPDPALA
FT                   KAIEDAKAATAKAEEATANVLKLTKELEEAELENEELAQALAEAKSAAQDAIAAAEEAN
FT                   ARVKAAEGATIEAEEAAMKAENEAKALAEQLAKVEAELANSQDQAKALAEAKEAAEIAR
FT                   KAAEEALKLEKEKSGKAGGTDNTENKGFWQELLRIFPGFAPIFSFLASIWGGMQKLLAF
FT                   "
FT   gene            403384..404124
FT                   /locus_tag="CPFRC_01975"
FT                   /old_locus_tag="cpfrc_00387"
FT   CDS_pept        403384..404124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_01975"
FT                   /old_locus_tag="cpfrc_00387"
FT                   /product="L,D-transpeptidase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00387"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28180"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523066.1"
FT                   /protein_id="ADK28180.2"
FT                   /translation="MSYKPRHAKQSVARRRIAAMVGTAATSAALLVSQAATSSAQDFGS
FT                   SNLSSSFDQQLQNIGRQTRDGAWDLRNNLRAQADAGLPVDAAAAVKQSVDNAVNFAFPG
FT                   LIQERTAPPVVPAPAPAPVPTPPAFDTGSCPAFARACIDLAGQRSWLQNNGQVSYGAVP
FT                   ISSGRVGHETPKGVFYVNRKIKDEISREFNNAPMPFSVYFTHNGIAFHEGSPQVPSHGC
FT                   IHLNHKDAVTFFNQLQVGDVVYVY"
FT   gene            404422..404640
FT                   /gene="infA"
FT                   /locus_tag="CPFRC_01980"
FT                   /old_locus_tag="cpfrc_00388"
FT   CDS_pept        404422..404640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="CPFRC_01980"
FT                   /old_locus_tag="cpfrc_00388"
FT                   /product="translation initiation factor IF-1"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00388"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28181"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005519800.1"
FT                   /protein_id="ADK28181.1"
FT                   /translation="MAKEGAIEVEGRIIEPLPNAMFRVELDNGHKVLAHISGKMRQHYI
FT                   RILPEDRVVVELSPYDLNRGRIVYRYK"
FT   gene            404834..405202
FT                   /gene="rpsM"
FT                   /locus_tag="CPFRC_01985"
FT                   /old_locus_tag="cpfrc_00389"
FT   CDS_pept        404834..405202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="CPFRC_01985"
FT                   /old_locus_tag="cpfrc_00389"
FT                   /product="30S ribosomal protein S13"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00389"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28182"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_020441897.1"
FT                   /protein_id="ADK28182.2"
FT                   /translation="MARLAGVDLPRNKRMEVALTYIYGIGPARAAQLLKETGISPDLRT
FT                   DNLTDEQVSALRDVIEATWKVEGDLRRQVQADIRRKIEIGCYQGLRHRRGLPVRGQRTK
FT                   TNARTRKGPKKTIAGKKK"
FT   gene            405206..405610
FT                   /gene="rpsK"
FT                   /locus_tag="CPFRC_01990"
FT                   /old_locus_tag="cpfrc_00390"
FT   CDS_pept        405206..405610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="CPFRC_01990"
FT                   /old_locus_tag="cpfrc_00390"
FT                   /product="30S ribosomal protein S11"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28183"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_011075047.1"
FT                   /protein_id="ADK28183.1"
FT                   /translation="MPPKTRSTARRTGRRVVKKNVAQGHAYIKSTFNNTIVSITDPSGA
FT                   VIAWASSGHVGFKGSRKSTPFAAQLAAENAARKAMDHGMKKVDVFVKGPGSGRETAIRS
FT                   LQAAGLEVTSISDVTPQPFNGCRPPKRRRV"
FT   gene            405634..406239
FT                   /gene="rpsD"
FT                   /locus_tag="CPFRC_01995"
FT                   /old_locus_tag="cpfrc_00391"
FT   CDS_pept        405634..406239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="CPFRC_01995"
FT                   /old_locus_tag="cpfrc_00391"
FT                   /product="30S ribosomal protein S4"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00391"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28184"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010119835.1"
FT                   /protein_id="ADK28184.1"
FT                   /translation="MARYTGPATRKSRRLRVDLVGGDMAFERRPYPPGQAGRARIKESE
FT                   YLLQLQEKQKARFTYGVMEKQFRRYYAEANRLPGKTGDNLVILLEARLDNVVYRAGLAR
FT                   TRRQARQLVSHGHFTVNGKKINVPSYKVSQYDIIDVREKSRKMIWFEEAQENLLDAVVP
FT                   AWLQVVPSTLRILVHQLPERAQIDVPLQEQLIVEFYSK"
FT   gene            406379..407395
FT                   /locus_tag="CPFRC_02000"
FT                   /old_locus_tag="cpfrc_00392"
FT   CDS_pept        406379..407395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02000"
FT                   /old_locus_tag="cpfrc_00392"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00392"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28185"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599801.1"
FT                   /protein_id="ADK28185.1"
FT                   /translation="MLISQRPTLTEEYVDSARSRFIIEPLEPGFGYTLGNSLRRTLLSS
FT                   IPGAAVTSVKIDGVLHEFTTINGVKEDVSDIILNIKGLVLSSDSDEPVVMYLRKEGAGV
FT                   VSAGDIEPPAGVEIHNPDLHIATLNEQGRLDIEMIVERGRGYVPASLYAGTNEIGRIPV
FT                   DQIYSPVLKVSYKVEATRVEQRTDFDKLIIDVETKNSIAPSDALASAGKTLVELFGLAR
FT                   ELNTAAEGIEIGPSPQETEYIAAYSMPIEDLNFSVRSYNCLKRQEIHTVGELAECTESD
FT                   LLDIRNFGQKSINEVKIKLAGLGLFLKDSPEDFDPTQLEGYDAATGDYVDTDLEDSE"
FT   gene            407471..407956
FT                   /gene="rplQ"
FT                   /locus_tag="CPFRC_02005"
FT                   /old_locus_tag="cpfrc_00393"
FT   CDS_pept        407471..407956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="CPFRC_02005"
FT                   /old_locus_tag="cpfrc_00393"
FT                   /product="50S ribosomal protein L17"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00393"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28186"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599802.1"
FT                   /protein_id="ADK28186.1"
FT                   /translation="MPTPKKGARLGGSASHQKHILSNLAAQLFEHGAIKTTDAKAKLLR
FT                   PYAEKLITKAKKGSVADRRNVLKAVPNKDVVAYLFNELAPKFENREGGYTRIIKLENRK
FT                   GDNAPMSQISLVLEETVSAEASRATRAAASKEAEKIEEPAAEEAVAETSTDEAAEEK"
FT   gene            408172..409047
FT                   /gene="truA"
FT                   /locus_tag="CPFRC_02010"
FT                   /old_locus_tag="cpfrc_00394"
FT   CDS_pept        408172..409047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="CPFRC_02010"
FT                   /old_locus_tag="cpfrc_00394"
FT                   /product="tRNA pseudouridine(38-40) synthase TruA"
FT                   /EC_number="5.4.99.12"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00394"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28187"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241251.1"
FT                   /protein_id="ADK28187.1"
FT                   /translation="METNQPTVRIRLDLAYDGTHFHGWARQGTSQLRTVQRVLEDSLEL
FT                   ILRHPIQLTVAGRTDAGVHAAGQVAHFDVPAIALDTRSIDGDPRNLVRRLARLLPEDVR
FT                   VHACTLAPEGFDARFSALRRHYVYRLTTHPRGALPTRATDTAHWPKRIDIDAMQAAADV
FT                   LIGLHDFAAFCKHREGATTIRDLQEFTWHDVSTSLEPQLYEAHVTADAFCWSMVRSLVG
FT                   SCLVIGEGKRPEGFVDSLLTETSRSSQVPVAPAKGLSLVGVDYPVDSELLARANTTRAV
FT                   RTAEDISGNL"
FT   gene            409106..410464
FT                   /gene="eccB"
FT                   /locus_tag="CPFRC_02015"
FT                   /old_locus_tag="cpfrc_00395"
FT   CDS_pept        409106..410464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eccB"
FT                   /locus_tag="CPFRC_02015"
FT                   /old_locus_tag="cpfrc_00395"
FT                   /product="type VII secretion protein EccB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28188"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800043.1"
FT                   /protein_id="ADK28188.2"
FT                   /translation="MRMRTDDMAKRITTPHEDVRQRKGIAPATKAQVSGHRFLVRRAEL
FT                   GLLLGDVRMIHDPLGRLRRAIAFGLSAVGLVALGAGALALFSPNPDPGDARILSSQRGD
FT                   LFVRVGEQLHPVTNLTSARLAVEEAATPVKAGDSVLGSKHIAVPIGIADAPSIFNNTSD
FT                   TEPVWQICTSTPGPTESHSPRTTFLINHTTPFEQTPQLEADEALLATSHMGDVVVTAAN
FT                   RRLLPPAETPEGRSIRRRLGIGFETPRWHPEADVLAIIPEAPQFHLPVGNLELFVADGE
FT                   YWLKNDSGVVRITSLQKDILTDLGWELKTVSKTEMTALPDIDLHIAFPDKPLRWQDSDK
FT                   AHTCISVSFTQTDTEPSTSVGITNSAATFASAVELSGESVATHFVGGGGAVAVETGAGV
FT                   HLISEHGLRHQLAHNAVLEHLGIQKVRRASWFLLRLLPAGTTLSKEAALTPLY"
FT   gene            410549..410971
FT                   /locus_tag="CPFRC_02020"
FT                   /old_locus_tag="cpfrc_00396"
FT   CDS_pept        410549..410971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02020"
FT                   /old_locus_tag="cpfrc_00396"
FT                   /product="TIGR02611 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00396"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28189"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241253.1"
FT                   /protein_id="ADK28189.1"
FT                   /translation="MSSMRDAVADKLAQINQHYENLKRHRFGFLVRPTVLILGWIVVIV
FT                   GIITIPFPGPGWLTVFVGIGILSLELHWASGLLAWGVKLYDRFFSWYRVQPKKTCYSLI
FT                   AGTIVAAWIAGIAIVLVLWKLGFVPFLDPLLPILIG"
FT   gene            complement(410992..412170)
FT                   /gene="mycP"
FT                   /locus_tag="CPFRC_02025"
FT                   /old_locus_tag="cpfrc_00397"
FT   CDS_pept        complement(410992..412170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mycP"
FT                   /locus_tag="CPFRC_02025"
FT                   /old_locus_tag="cpfrc_00397"
FT                   /product="type VII secretion-associated serine protease
FT                   mycosin"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00397"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28190"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241254.1"
FT                   /protein_id="ADK28190.1"
FT                   /translation="MPILRFSRLTCALFIISLGIVFCPLGYAQERSCVQAAHASTENIH
FT                   NQAAASQKFRRAHRYATGAGIRVAIIDTGVSPHPRLGPVEDGGSFINDGMRRTGLYDCD
FT                   AHGTTVAGIIATRDGPDGVIGIAPAATIISVKQMSARHNYSPGAAPTASGNLSTLAQSI
FT                   HAAIDHGAHVINISVVSCVRRDTVVDLSDLHTALDRAENANVVVVSAAGNASSSSCEPG
FT                   DHVYPAHLDRVLAVSALHGNGLPTQYSLPSPHPMLSASGHVAAALSHEGDVLSQGTHKD
FT                   REIVPFEGTSFAAPVVAGTASLLRERYPQATAADIRALLYHSVDPMTGAIDPELAVTQV
FT                   FPRDSPPSHPSLVTVTQPSQYGTQGRMIAIIMTSLLLITFTATALLLSRVRP"
FT   gene            complement(412173..413609)
FT                   /gene="eccD"
FT                   /locus_tag="CPFRC_02030"
FT                   /old_locus_tag="cpfrc_00398"
FT   CDS_pept        complement(412173..413609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eccD"
FT                   /locus_tag="CPFRC_02030"
FT                   /old_locus_tag="cpfrc_00398"
FT                   /product="type VII secretion integral membrane protein
FT                   EccD"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00398"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28191"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523068.1"
FT                   /protein_id="ADK28191.1"
FT                   /translation="MIDQDIRLHFRIELSRDESTDLSEDCASPAACVNVDISVPRSSAL
FT                   VEVIPDILSLAGVEVGTTPWQSITASGLRIDASDPLHTTGLPDGAVVLLRPRQASKAPV
FT                   VRDSAETLAHSSKSSLPPRGIAAATELLGIVGCACLIMRMNSIGLPEFRWLILCCLAAL
FT                   AYLWTRNALVLVTFAAFCACAAFFFVVDFPVSEARAPDIAAAVLAANFASIASSVSLHL
FT                   FAFRRPSRATTPFDEKPLGHLRCLSAIISCALSASPVAAVGLLYQSPESQPHGWFLGAA
FT                   SAVIVCSLTAVVLAPTLAVKLAGVQIPRLPSAGEDLSVAYSQISAEHLKYLARKSLLLM
FT                   EGILMGASASATTALLVIGYLSNGNGYACGLCVCVIICSAAHSHRHATGASVWMLWLIA
FT                   LGGIIGLSLAIDVSTHWLAIVSLSVSLCALTASLWAKLLPRFTPVTALWIGRCEALALA
FT                   AVFPLSCQLIGVFSLIRGLG"
FT   gene            413756..417607
FT                   /locus_tag="CPFRC_02035"
FT                   /old_locus_tag="cpfrc_00399"
FT   CDS_pept        413756..417607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02035"
FT                   /old_locus_tag="cpfrc_00399"
FT                   /product="type VII secretion protein EccC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00399"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28192"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522125.1"
FT                   /protein_id="ADK28192.1"
FT                   /translation="MVGTNVSTIQKNDDAKLSEQQFLFKGESSCASATPQKNESNNKAD
FT                   RGIIPQLSEDERLPAPPLPTGSLKPEPVPEAARAQPVPLLKMLMPLAMVVAVIAMVGLL
FT                   VISGGALNPMMLTLPLMMGMSLLMMFSPAPGEDTAEMRRTYLRHLVALREKAIENADAQ
FT                   RAHELYRHPLTCELWSIVGTERMWERLGDASDALEVRIGTGSTALCTPFEISDSGATED
FT                   LDPVCAVSLRSMVQSLSSVHDMPLIIQLQAFRVINILGDAAPDLARAIAAQLCFYHGPE
FT                   AVGIGLVARTETASVYPDAEESWAFIKWLPHHREPQNAQHKIFIVDCAGAETSELDVLD
FT                   IGSWDVIIAVNAHPSSDLGVWAEEEGIVLQADSNLGVITENGFESIGTPESLSNSGALL
FT                   LARLLTRYKRAESENTASSDLRALLKLHSLEGQLDVGSLWEHWNTKSAKNRRLSIPFGL
FT                   NASGKPVVLDIKESAHGGMGPHGLCLGSTGSGKSELLRTLVVGLAATHSPEDLNFVLVD
FT                   FKGGATFLGLDQLPHTSAVITNLAQETVLVERMHDAISGEMNRRQEMLRQAGNFSNVSE
FT                   YTAARQHRQELPPMPALLIIVDEFSELLGQHPDFADLFVAVGRLGRSLHIHLLLASQRL
FT                   DEGRLRGLDSHLSYRIGLKTFSAAESRQILGVPDAHELPNQPGVGFLSTGAGELQRFRA
FT                   SYVSGPMQNLDAENNRSRTVRLWTGWEDPEPQSERTPQNIHAKGKTLVDAIVSASVHAA
FT                   AQQQLRAHRIWLPPLPKTISLSSLAPNQAFLTASVGVIDRPYLQRQDSLIMNFLGQSGH
FT                   AALCGGPQTGKSNALHTIMASLAIAHSTHDLRFYVLDLAGTSLAATVALPHVAGVAHRT
FT                   EVEKVRRIVDEVVSFIDAPEERHTFLVIDGWHVVGQNFEDLLEPLARIASDGLSAHVHL
FT                   LISTPRWTALRPEIRDLIPQRIELKLAESLDSLIDRKAQSKLPLAAGRGLNTDKEHILF
FT                   AFSTPQDLEQAALASARRGDSVVPKLKMLPSLVCVSELTAGLEKQEIPFGIGGKNLSPL
FT                   TWKFQHSSHLLCVGNQGCGKSTLMRAITTGIEAMGKEHARIVMIDHRRAHLGAIHEDML
FT                   AAYSATSQDTERLISDVIVTLRSRLPNSDVTAEQLKNRSWWCGPDIFLLIDDLDILPDG
FT                   CLYPLLELLPHSKDIGLHVVVCRKLGGMQRALYQPFLAELRDQQPTVIILDGDRDEGPI
FT                   FGVRPSQWPPGRGILVERGSNMGVFQIAVAGTCSTTQPDGPQEAGSARANGCGEEEHV"
FT   gene            417600..418655
FT                   /locus_tag="CPFRC_02040"
FT                   /old_locus_tag="cpfrc_00400"
FT   CDS_pept        417600..418655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02040"
FT                   /old_locus_tag="cpfrc_00400"
FT                   /product="type VII secretion-associated protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28193"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522126.1"
FT                   /protein_id="ADK28193.2"
FT                   /translation="MSKSHDLVITVLDTATVFERTEEAFRYDLTGAGIVEGWAIEKIIE
FT                   QAKQLLPQWPAVTIHIIAESKIKEILTECVLEHGAAVTSVAAEEISYIKNDPMEGERLA
FT                   YMREPQLGEPQLDKETKGVRRKTGRARTSVFRRIAGTEKLHPLHGVLVVLVVVVAAVSW
FT                   WAMGKGLKNPSIGASAAHIAEDRELVDKPQNAHTEVTPIPTTSAYPPPSNDVMLHHARI
FT                   QVSLPSSYHLSEKEGMNGMVIAAGDDPDLRILLSIDPMGSADIDAVYAELETMITHDPT
FT                   LTKGQALGVTKPTRLVAYEERPGDGSYARWWSWVDNGHIYSVGCHSKRMSTIPQRAVCR
FT                   KAVESMSLRSF"
FT   gene            418802..419131
FT                   /locus_tag="CPFRC_02045"
FT                   /old_locus_tag="cpfrc_00401"
FT   CDS_pept        418802..419131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02045"
FT                   /old_locus_tag="cpfrc_00401"
FT                   /product="WXG100 family type VII secretion target"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28194"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241258.1"
FT                   /protein_id="ADK28194.1"
FT                   /translation="MSGQFRTEADVMVATASRVDNTNAEVQSELARLRGIVDGVRGSWA
FT                   GSAQASFDNLMQRWDASAGKLRMALQSISDNIRSNATSFDQTEADNKAAFASVGAQGLT
FT                   LITNI"
FT   gene            419145..419426
FT                   /locus_tag="CPFRC_02050"
FT                   /old_locus_tag="cpfrc_00402"
FT   CDS_pept        419145..419426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02050"
FT                   /old_locus_tag="cpfrc_00402"
FT                   /product="WXG100 family type VII secretion target"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00402"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28195"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241259.1"
FT                   /protein_id="ADK28195.1"
FT                   /translation="MIKYGFAAIEGAAGDIQSTSVRISSLLEELKAGIRPMVSTWEGDS
FT                   ALAYQEAQSQWDQAAYELNTILSTISQTVRAGNERMSEINRVAAASWG"
FT   gene            419759..420202
FT                   /gene="rplM"
FT                   /locus_tag="CPFRC_02055"
FT                   /old_locus_tag="cpfrc_00403"
FT   CDS_pept        419759..420202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="CPFRC_02055"
FT                   /old_locus_tag="cpfrc_00403"
FT                   /product="50S ribosomal protein L13"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00403"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28196"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004566874.1"
FT                   /protein_id="ADK28196.1"
FT                   /translation="MSTYHPKSGDITRKWYVIDATDVVLGRLATHAADLLRGKGKPQFA
FT                   PNVDCGDHVIVINADKVHISSNKREREMRYRHSGYPGGLKTMTLGRSLEVHPERVIEES
FT                   IRGMMPHNRLSRASVKKLHVFAGSEHPYAAQKPETYEIKQVAQ"
FT   gene            420199..420732
FT                   /gene="rpsI"
FT                   /locus_tag="CPFRC_02060"
FT                   /old_locus_tag="cpfrc_00404"
FT   CDS_pept        420199..420732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="CPFRC_02060"
FT                   /old_locus_tag="cpfrc_00404"
FT                   /product="30S ribosomal protein S9"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00404"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28197"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004566875.1"
FT                   /protein_id="ADK28197.1"
FT                   /translation="MSDQNVTENFEADAADIAAAVAASEEFTNTIGDVVAPEAEVETAA
FT                   PVLHEGPIQTVGRRKRAIVRVRMVEGSGQFTCNGRTLEEYFPNKLHQQLIKAPLALIDR
FT                   DGQFDIQATLTGGGPTGQAGAFRLAIARALNVYNPADRAALKKAGFLTRDARAVERKKA
FT                   GLHKARRAPQYSKR"
FT   gene            420930..422273
FT                   /locus_tag="CPFRC_02065"
FT                   /old_locus_tag="cpfrc_00405"
FT   CDS_pept        420930..422273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02065"
FT                   /old_locus_tag="cpfrc_00405"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28198"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599819.1"
FT                   /protein_id="ADK28198.1"
FT                   /translation="MTRLFGTDGVRGLANKKLTASLALKLGAAAAEVLTKDNRSGSRRP
FT                   VAVVGRDPRASGEMLAAALSAGMASRGVDVLRVGVLPTPAVAYLTDFYGADMGVVISAS
FT                   HNPMPDNGIKFFSKGGHKLPDSVEDEIEMMMETISDGGPTGHGIGRVIEEAVDAQESYL
FT                   KHLKGAIQQSLEGITVVVDCANGAASEVAPLAYSTAGANVIAIHNHPNAYNINDNCGST
FT                   HIDQVIAAVKEHGADLGLAHDGDADRCLAVDAEGNVVDGDQIMAILALAMKENGELRKS
FT                   TLVATVMSNLGLRLAMKESGINLITTQVGDRYVLEALNAGGYSLGGEQSGHIVLPDHGT
FT                   TGDGTLTGLSLMARMAETGLSLKVLAGAMAVLPQVLINVPVSDKTIIMEHPEVIAALEQ
FT                   ATDALGETGRVLLRASGTEELFRVMVEAAEEETARRIAGELAALVAKI"
FT   gene            422344..422643
FT                   /locus_tag="CPFRC_02070"
FT                   /old_locus_tag="cpfrc_00406"
FT   CDS_pept        422344..422643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02070"
FT                   /old_locus_tag="cpfrc_00406"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00406"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28199"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241263.1"
FT                   /protein_id="ADK28199.1"
FT                   /translation="MFDVLIEPTTAVRIIKGFIRELDSQERKHGQPPEFDPEALGKAFA
FT                   HHGEKISEALWLIHRSNGTRLQRLNAGVTKALADTQKLIDADLMHSASLKASGE"
FT   gene            422678..423821
FT                   /pseudo
FT                   /locus_tag="CPFRC_02075"
FT   CDS_pept        422678..423821
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02075"
FT                   /product="hypothetical protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014400999.1"
FT   gene            423815..424120
FT                   /locus_tag="CPFRC_02080"
FT                   /old_locus_tag="cpfrc_00409"
FT   CDS_pept        423815..424120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02080"
FT                   /old_locus_tag="cpfrc_00409"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00409"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28202"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241266.1"
FT                   /protein_id="ADK28202.1"
FT                   /translation="MVNAEEEFQRRVENLEKQRQAAVNNYADFAKEFRATVARRMEEFE
FT                   RELKKSQEIVEKARQRGEARAAEKFRSDRIDNASSLRGMAPDRGRRGRVKSVLRRV"
FT   gene            complement(424170..425012)
FT                   /locus_tag="CPFRC_02085"
FT                   /old_locus_tag="cpfrc_00410"
FT   CDS_pept        complement(424170..425012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02085"
FT                   /old_locus_tag="cpfrc_00410"
FT                   /product="alpha/beta hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28203"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241267.1"
FT                   /protein_id="ADK28203.1"
FT                   /translation="MADKFSKHLATLSKRGRHRVLVGDLDYAGLPGKIYTPAEGNGLPA
FT                   IVFAHDWLKDISVYHATLRHLASWGFVVAAPNTEKGFSPNHRGFAADIETSLQILTGVK
FT                   LGSGNITVAPGRLGIVGHGMGAGAAVLAAVNRPQLAAIAALYPSQTTPSAELASGNVEA
FT                   PGLILGTEDNALFDYGNAAKLAAHWKGEVAYREIDGTSHNAITEDTFFKLVTGQGRSKA
FT                   TSREKIRGLVTGFLLHRLTNENKYSAFSQPEAESKKITSYWGDALEKRALISAEPESI"
FT   gene            425168..426280
FT                   /locus_tag="CPFRC_02090"
FT                   /old_locus_tag="cpfrc_00411"
FT   CDS_pept        425168..426280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02090"
FT                   /old_locus_tag="cpfrc_00411"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28204"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014401000.1"
FT                   /protein_id="ADK28204.1"
FT                   /translation="MNLLEARIDLAAIAHNTRLIKDKAAAQGAQLMCVVKADGYNHGAV
FT                   EVATVMEENGADQFGVATIGEALALREGGIESSILSWIWSPEQDLGAAITAEIDLAAIS
FT                   LEHVKALVRASESYGKKPVRVTVKVDTGLHRSGVDKQDWRESFCMLRDAENIQVTGVFS
FT                   HFSSADESDSTETEQQERAFLNAIELGRSLGLELPVNHIANSPATLNRPDLYFDMVRPG
FT                   LALYGHEPIPGESHGLREAMSWVGRVTVVKPIARGEGTSYGLTWRAEQDGYLCVVPVGY
FT                   ADGLPRSAQGHLEITIGGRRYPQVGRVCMDQIVVALGENPYGVAQGDEAVILGPTGMTA
FT                   TELATAMGTINYELVCRPCGRTVRVFEHSD"
FT   gene            426432..426926
FT                   /gene="tsaE"
FT                   /locus_tag="CPFRC_02095"
FT                   /old_locus_tag="cpfrc_00412"
FT   CDS_pept        426432..426926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsaE"
FT                   /locus_tag="CPFRC_02095"
FT                   /old_locus_tag="cpfrc_00412"
FT                   /product="tRNA
FT                   (adenosine(37)-N6)-threonylcarbamoyltransferase complex
FT                   ATPase subunit type 1 TsaE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00412"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28205"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241269.1"
FT                   /protein_id="ADK28205.1"
FT                   /translation="MRDSFPSSGERRLELPADTQALAEQLGAALEPGDVLILDGPLGAG
FT                   KTTFTQGLAKGLQVKGRITSPTFVIAREHMSLIGGPTLIHVDAYRLIDETAGAADPIGA
FT                   LDSLDLETELEDAVVVAEWGGDLVEQISDSYLRISIDRTTAHMENPDSEARIIRWEKIV
FT                   S"
FT   gene            427468..429075
FT                   /locus_tag="CPFRC_02100"
FT                   /old_locus_tag="cpfrc_00414"
FT   CDS_pept        427468..429075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02100"
FT                   /old_locus_tag="cpfrc_00414"
FT                   /product="transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00414"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28207"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655091.1"
FT                   /protein_id="ADK28207.1"
FT                   /translation="MLDYLATQPLITLVLILALGLALGKIRLFGISLGAAAVLFVALAL
FT                   STIHPALQLPPLIFQLGLAMFVYAIGLNAGAAFFAEFRHRGWKLTLYVIGLLVVLMGIS
FT                   YALITTFDLGSRAAGAGMFAGAISSTPGMAAMVAILEGIDDSLVAEPVVGYSLAYPGAV
FT                   IGSILVAAIGARVLKVNHTQDAEEEGLVMDPLEWTGVRIGPRITGTIAQLPSIVGEEII
FT                   ATRVVHSDSFHSLADPNDRLFEGMVLVINGTTEALDRAIAKLGAPVEVKIEDTDLEYLR
FT                   VTVSSKHVVGRKISELDTVRSGFIIARLRRGDAEVVPEADDVLHYSDRVRVIAPKNRMS
FT                   EVRRFLGDSERQLADVDLLPFAIGLSLGLLIGAIPIPLPGGNTLSLGFGGGPIVVGLIL
FT                   GAMHRTGPIRWSLPYHANRTISTFGLAIFLAGVGTSAGVGFRHALTDPSSLKLIAAGFV
FT                   VTLASALITAAVCMPLLKLKWDEAMGVAAGVTTNPAIISYLNGQTGTELATRGYATVYP
FT                   TAMIGKIVASQMLLLLLL"
FT   gene            429262..429738
FT                   /locus_tag="CPFRC_02105"
FT                   /old_locus_tag="cpfrc_00415"
FT   CDS_pept        429262..429738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02105"
FT                   /old_locus_tag="cpfrc_00415"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28208"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523074.1"
FT                   /protein_id="ADK28208.1"
FT                   /translation="MNKLARGLFAAIIVAFLVVIIAMIAMAHGRSGTTNKEGALESTLH
FT                   KIGSSNVHVTALSLSDLYGPEWVAGAMICPGATEQSIAQNYGIDTTDLHLNGGQVPEDV
FT                   NYIVMASGDGDIRFEQLNRNEIDVCSVGPQGGFETSSLIPFIKQDGVWKIGTGH"
FT   gene            429856..430530
FT                   /gene="tsaB"
FT                   /locus_tag="CPFRC_02110"
FT                   /old_locus_tag="cpfrc_00416"
FT   CDS_pept        429856..430530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsaB"
FT                   /locus_tag="CPFRC_02110"
FT                   /old_locus_tag="cpfrc_00416"
FT                   /product="tRNA
FT                   (adenosine(37)-N6)-threonylcarbamoyltransferase complex
FT                   dimerization subunit type 1 TsaB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00416"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28209"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523809.1"
FT                   /protein_id="ADK28209.1"
FT                   /translation="MLVLALDTATPDLIVGLVRVPSDTDTGVVVAQRILTDSRQHNELL
FT                   TPTVVEILEESGQKFADIDRIVVGCGPGPFTGLRVGMVTAAAFGDALGIPVHGVCTHDA
FT                   IANQLDGQALVATDARRKEIYWSLYSDGVRTMGPGIVAPTELSIPSRISTVSIPEKLGQ
FT                   LLPGPLRDVPQVNLRPLPECLVAVADFSQTPEPLEPLYLRRPDAKEPAPKPRSSAIPKV
FT                   EI"
FT   gene            430531..431022
FT                   /gene="rimI"
FT                   /locus_tag="CPFRC_02115"
FT                   /old_locus_tag="cpfrc_00417"
FT   CDS_pept        430531..431022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="CPFRC_02115"
FT                   /old_locus_tag="cpfrc_00417"
FT                   /product="ribosomal protein S18-alanine
FT                   N-acetyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00417"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28210"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366541.1"
FT                   /protein_id="ADK28210.1"
FT                   /translation="MFLRELTAADAPRCAELETLLFSEENPWSVEDLRAAINHPHTLYI
FT                   AVVDSLEKGLILGYAGLAMLGPAHDPEFEIHTIGVDPQFQRQGVARLMMDNITFVADRA
FT                   AGPVFLEVRTTNEPAIRLYESYGFERQGVRKNYYQPSGADAYVMMRTPSAVESNEESGK
FT                   "
FT   gene            431024..432079
FT                   /gene="tsaD"
FT                   /locus_tag="CPFRC_02120"
FT                   /old_locus_tag="cpfrc_00418"
FT   CDS_pept        431024..432079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsaD"
FT                   /locus_tag="CPFRC_02120"
FT                   /old_locus_tag="cpfrc_00418"
FT                   /product="tRNA
FT                   (adenosine(37)-N6)-threonylcarbamoyltransferase complex
FT                   transferase subunit TsaD"
FT                   /EC_number="2.3.1.234"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00418"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28211"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522127.1"
FT                   /protein_id="ADK28211.2"
FT                   /translation="MIVLGIESSCDETGVGIIELSPDGSMRILADAVASSMEEHARFGG
FT                   VVPEIASRAHLEAMVPVMRQALDAAGVDKPDAVAATVGPGLAGALLVGASAAKAYAAAW
FT                   DVPFYGVNHLGGHVAVANLEGEELPHSIALLVSGGHSQLLEVQAVGKPMKELGSTLDDA
FT                   AGEAYDKVARLLGLGYPGGPVIDKLAARGNRKAIRFPRGLSRADDLRGEHRYNFSFSGL
FT                   KTSVARYVEKAEREQSVISVEDVCASFQEAVCDVLTHKAILACQDTGAKVLLLGGGVAA
FT                   NSRLRELAAARCQTAGIELRVPRFKLCTDNGVMIAAVAAQLIHEGAPQSGLRIGTDTSL
FT                   EVEIPLVYAAT"
FT   gene            432241..432537
FT                   /locus_tag="CPFRC_02125"
FT                   /old_locus_tag="cpfrc_00419"
FT   CDS_pept        432241..432537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02125"
FT                   /old_locus_tag="cpfrc_00419"
FT                   /product="co-chaperone GroES"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00419"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28212"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010271321.1"
FT                   /protein_id="ADK28212.1"
FT                   /translation="MANVNIKPLEDRVLVQISEAETTTASGLVIPDSAKEKPQEGVVVA
FT                   AGPGRFDGDDRVPMDIKEGDTVVFSKYGGTELKYNGEEYLLLNARDVLAIIEK"
FT   gene            432549..434171
FT                   /gene="groL"
FT                   /locus_tag="CPFRC_02130"
FT                   /old_locus_tag="cpfrc_00420"
FT   CDS_pept        432549..434171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="CPFRC_02130"
FT                   /old_locus_tag="cpfrc_00420"
FT                   /product="chaperonin GroEL"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28213"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241276.1"
FT                   /protein_id="ADK28213.1"
FT                   /translation="MAKLIAFNQEAREGILKGVDTLANAVKVTLGPRGRNVVLEKAFGS
FT                   PTVTNDGVTIAREIDVEDRFENLGVQLVKSVAVKTNDIAGDGTTTATLLAQAVITEGLR
FT                   NVAAGANPVELNRGILAAADKAVEKLGERAAEVASAADIANVATVSSRDAEIGDMVAAA
FT                   MEKVGKDGVVTVEESQSIESYLDVTEGVSFDKGYLSPYFITDTDSQRAELDDPYILLVR
FT                   NKISSLPDFLPLLEKTVEANKPVLIIAEDVEGEPLQTLVVNSIRKTLRAVAVKSPYFGE
FT                   RRKAFMDDLAVVTNATVVDPEVGINLNEAGVEVFGTARRVTVTKDETIIVDGAGTSEAV
FT                   ENRRQQIRREIENTDSSWDREKAEERLAKLSGGVAVIKVGAATETEVSERKLRVEDAIN
FT                   AARAAAQEGVIAGGGSALVQIAKELRVYAEEFEGDAKVGVNALANALSKPAYWIADNAG
FT                   LDGAVVVSKIADLPNGEGFNAATLEYGNLIEQGIIDPVKVTHSAVVNATSVARMVLTTE
FT                   ASVVEKPVEAKPQAGGHHHHHHH"
FT   gene            complement(434268..434549)
FT                   /locus_tag="CPFRC_02135"
FT   CDS_pept        complement(434268..434549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02135"
FT                   /product="WhiB family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910854.1"
FT                   /protein_id="QGW57314.1"
FT                   /translation="MNNTDLLPAPQTQLWDWQLHGACRGTQSEIFYHPEGERGLARRSR
FT                   ERQAKEICSLCPVLRNCRQHALQYAEPYGIWGGLSESERATMLSRRYG"
FT   gene            434849..435439
FT                   /locus_tag="CPFRC_02140"
FT                   /old_locus_tag="cpfrc_00423"
FT   CDS_pept        434849..435439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02140"
FT                   /old_locus_tag="cpfrc_00423"
FT                   /product="sigma-70 family RNA polymerase sigma factor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00423"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28216"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241279.1"
FT                   /protein_id="ADK28216.1"
FT                   /translation="MRMMEEKGLAVAETETELSSLVPRAAGGDSRSLQRVISIIYPKVL
FT                   SYARIRLSGGRHPTPEDVAQEICLAVATSISKFVDQGKPFMAFVYGIASNKVADAHRAY
FT                   SRDVANPTEDVPETEVELETPESFALVAAGSNRVKELLDLLGDKPREIITLRVFVGLSA
FT                   EETAEIVGSTPGAVRVAQHRALATLRKALEQEN"
FT   gene            435442..436323
FT                   /locus_tag="CPFRC_02145"
FT                   /old_locus_tag="cpfrc_00424"
FT   CDS_pept        435442..436323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02145"
FT                   /old_locus_tag="cpfrc_00424"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00424"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28217"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366545.1"
FT                   /protein_id="ADK28217.1"
FT                   /translation="MTERRWARDGVEAAQSVEQLRADDQFLTHLSQGVDPTDGQDPLAR
FT                   LFLDARAEIQTNVPQAPTLAMLGLGSAEEFPTGELAPVTNESVDSSQLIDAPAAKVIEL
FT                   PRRRWNNAFAHALVGAAAATLIIAGGGTAIYNAGEGSALYALNQKFFGQTTNTEAVVAL
FT                   ASKLDQANDLNAKGDKEGARQLLEQARELVNMLNARDRAQAEERIKEAERGSNVAPVPP
FT                   PAEPEASSETVVTTMTTTVTETVTVEPTPARSTSTAPSTDRSATSSTSPVASTPSLTPA
FT                   FELPQPEHSQAH"
FT   gene            complement(436337..436749)
FT                   /pseudo
FT                   /locus_tag="CPFRC_02150"
FT                   /old_locus_tag="cpfrc_00426"
FT   CDS_pept        complement(436337..436749)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02150"
FT                   /old_locus_tag="cpfrc_00426"
FT                   /product="hypothetical protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00426"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28219"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366546.1"
FT   gene            436889..438409
FT                   /gene="guaB"
FT                   /locus_tag="CPFRC_02155"
FT                   /old_locus_tag="cpfrc_00427"
FT   CDS_pept        436889..438409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="CPFRC_02155"
FT                   /old_locus_tag="cpfrc_00427"
FT                   /product="IMP dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00427"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28220"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800061.1"
FT                   /protein_id="ADK28220.1"
FT                   /translation="MTQQRVSTGGDNPDKVALVGLTFDDVLLLPDASDVIPSEVSTSTQ
FT                   LTRNISLNIPIISAAMDTVTESRMAIAMAREGGMGVLHRNLSIEEQAQHVETVKRSESG
FT                   MVTDPVTCSPDMSIAEVDALCARFRISGLPVVDDNGTLLGICTNRDMRFEQDFSIKVSE
FT                   IMTRMPLVVAEEGVTKQQALNLLSANKVEKLPIVDKQGKLVGLITVKDFVKTEQYPHAS
FT                   KDSTGRLLVGAGIGVGEESWTRAGALVDAGVDVLVVDSAHAHSSGVLDMVSRVKKEWGD
FT                   RVDVIGGNLATRSAAKAMIEAGADAIKVGIGPGSICTTRVVAGVGAPQITAIMEASVPA
FT                   HAAGVPIIADGGMQFSGDLAKALAAGASSVMLGSMLAGTAEAPGEIVVVGGKQYKRYRG
FT                   MGSMGAMQGRGLSGEKRSYSKDRYFQADVKSEDKLVPEGIEGRVPFRGSIEAITHQLVG
FT                   GLRASMGYTGSATINDLWNARFVQITSAGLRESHPHHIQQTVEAPNYH"
FT   gene            438437..439579
FT                   /locus_tag="CPFRC_02160"
FT                   /old_locus_tag="cpfrc_00428"
FT   CDS_pept        438437..439579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02160"
FT                   /old_locus_tag="cpfrc_00428"
FT                   /product="GuaB3 family IMP dehydrogenase-related protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00428"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28221"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241284.1"
FT                   /protein_id="ADK28221.1"
FT                   /translation="MRDYVEIGIGREARRTYDLDDIAVVPARRTRSSKDVDTTWHIDAY
FT                   TFKVPFMSHPTDALASPEFVIEMDKQGGLGVINAEGLWGRHEDLDSVIKEIVEAHGQDE
FT                   LDLASFGRATKKLQELHAAELDKDLLTERIAQVRDSGAVVAVRVSPQKCRELAPLLIKA
FT                   GVDLLIIQGTIISAEYVETSGEPLNLKEFIGSIDVPVIAGGVSDYTTALHLMRAGAVGI
FT                   IAGGGSNTNDLALGIDDSLATAIADVAAARRDYLDETGGRYVHVIADGNINNSGQAVKA
FT                   IACGADAVILGEPLARATEAAGKGLFWPSAAAHPRFPRGIVGTVGIIPTTERVSLEVVL
FT                   HGPSANVFGEENFVGGLKRALAKCGYTDLKSFQKVELTIR"
FT   gene            439742..441595
FT                   /locus_tag="CPFRC_02165"
FT                   /old_locus_tag="cpfrc_00429"
FT   CDS_pept        439742..441595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02165"
FT                   /old_locus_tag="cpfrc_00429"
FT                   /product="amino acid transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00429"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28222"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014401007.1"
FT                   /protein_id="ADK28222.2"
FT                   /translation="MTHLVKRDRRLQESPATKHPWWKVMCLTGVDYYSTLGYQPGIAVV
FT                   AAGVLAPIATLVLVAVTMLGAVPVYRRIARESPDGQGSIAVLSHFVHGWKGKFLILVLL
FT                   GFAATDFTITMTLSASDATAHLLHTTSSPWTIPLTIAMLASLALVFYRGFTEAIRVSVV
FT                   LVSVYLFLTFVIVLAGLIRIGSHPSTVENWWHSVLVAHPQPLSIALVALLVFPKLALGL
FT                   SGFETGVAVLPQIDGGAEGRAGRVRAGRKLLLVAASIMSVFLITSSIVVTLLVPAEALT
FT                   GPASGRALAYLAHEQFGPLFGGAYDLVTVVILWFAGASAMAGMINLIPRYLPRYGMAPA
FT                   WVVKTRPMVKVVAVITFAVAIIFRANVDKQSGAYATGVLVLLLSGALAVTLSSAADARR
FT                   KVGPRWKPYAYGLVTLVLGYTTVTNMVVRPEGLKVAFWFIVAIIVVSMASRMRRAFELR
FT                   SPIIAYDEKALRIIDSACGPFAIIAHSLGAADPAEYERKEHEVRTRNHIPDLQSVIFLE
FT                   VGVRDASEFNSALMVTGHVCGDHRILRTEAAAVPNAIAALATDLHHRGNVDLYFSWSPG
FT                   SPVRDMLRYLAIGKGQNAVVVHEIIRRANKDGKPHPHVHLG"
FT   gene            441656..443233
FT                   /gene="guaA"
FT                   /locus_tag="CPFRC_02170"
FT                   /old_locus_tag="cpfrc_00430"
FT   CDS_pept        441656..443233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="CPFRC_02170"
FT                   /old_locus_tag="cpfrc_00430"
FT                   /product="glutamine-hydrolyzing GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28223"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599843.1"
FT                   /protein_id="ADK28223.1"
FT                   /translation="MTQQTPQKHNPVLVVDFGAQYAQLIARRVREAKIYSEVVPHTATV
FT                   EEIKAKNPAALVLSGGPSSVYETGAPSLDPALLELGIPVFGICYGFQAMTHALGGTVAN
FT                   TGNREYGCTELIVDGGILHDGLEKAHKVWMSHGDAVSQAPEGFVVSAHSEGAPVAAFEC
FT                   AEKRMAGVQYHPEVLHSPHGQEVLVRFLTEIAGLEQNWTAANIAEELIQAVREQVGPEG
FT                   RAICGLSGGVDSAVAGALVQRAIGDRLTCVFVDHGLLRAGEREQVEKDFVASTGAKLVT
FT                   VDERAAFLNKLAGVTDPEAKRKAIGAEFIRSFERAVAGVLESAPEGSSVDFLVQGTLYP
FT                   DVVESGGGAGTANIKSHHNVGGLPDDVEFKLVEPLRLLFKDEVRAVGRELGLPEEIVNR
FT                   QPFPGPGLGIRIIGEVTEDRLETLRAADLIARTELTAAGLDDQIWQCPVVLLADVRSVG
FT                   VQGDGRTYGHPIVLRPVSSEDAMTADWTRLPYEVLEKISTRITNEVPDVNRVVLDCTSK
FT                   PPGTIEWE"
FT   gene            443375..443824
FT                   /locus_tag="CPFRC_02175"
FT                   /old_locus_tag="cpfrc_00431"
FT   CDS_pept        443375..443824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02175"
FT                   /old_locus_tag="cpfrc_00431"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28224"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525364.1"
FT                   /protein_id="ADK28224.1"
FT                   /translation="MIIDTYWGKFFGDSADSRTLTQYLGSKSEVVTVEEIFQDFNLDEL
FT                   HGNYTEASLDGAGFHFDSAFQVVLDLSVLILESKKVGRFNLARIGGPHDRMMRIDATSE
FT                   RILPLAIALKHFALSPEDYRLEHIDESDWYELGNLCEEIRAQLDS"
FT   gene            complement(443830..444882)
FT                   /locus_tag="CPFRC_02180"
FT                   /old_locus_tag="cpfrc_00432"
FT   CDS_pept        complement(443830..444882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02180"
FT                   /old_locus_tag="cpfrc_00432"
FT                   /product="PspC domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00432"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28225"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366550.1"
FT                   /protein_id="ADK28225.1"
FT                   /translation="MESMNETLHQMWDARPVRLPREQGSEAKFLGVCEGIGVRYQIDPT
FT                   LVRIFFVLFAFFGGGFLLYLIAWLIMPKYSLVKAPVDLTLHQDDSVKNSKILRSERNTG
FT                   WILILVIFLIIFSSSSSGTAFFRTGYFTSFIVFFLAWYLLHQRTPEPPVGLLQRHPDSS
FT                   GPQVDLSAYSPIEGFDAPLAAPQPPAWDPLETAPFAWDLPEPGPAPQQKKPRNPLIRGL
FT                   AWFAGGLVIVGIIIAAMAGAPERIDDSFGDIDAHPTNAAQLADSYILRAGDIDLDLSRM
FT                   ADLDKPRHVRVQTKIGDVHVRLPQNIRVQVSCGTRIGDKRCSEGLHNPDAQGETLNLRV
FT                   TSGVGDVTVQ"
FT   gene            444987..446147
FT                   /locus_tag="CPFRC_02185"
FT                   /old_locus_tag="cpfrc_00433"
FT   CDS_pept        444987..446147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02185"
FT                   /old_locus_tag="cpfrc_00433"
FT                   /product="PspC domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00433"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28226"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910866.1"
FT                   /protein_id="ADK28226.2"
FT                   /translation="MQQAYPPFYRDRDNNVIGGVAAGLARYFGLSVMQVRIGLAALALL
FT                   NGAGVMVYAALWIFTTSRSFRKESSILSGKTSETSAWAKPTNLLLAIAALAGAFGVSGF
FT                   FGKSVGISSGVVAAFAVIGAGVLLAWLAYDRINSDYAVVMIGVGASLVFAGVLFAAVQW
FT                   QDRQFFGSAVITVVLTLAGVAALVAPFVVRVVQKLNAGQVEKAAADERAEIAARIHDSV
FT                   LQTLALIQKRSEDPEVRRLARGQERELRQWLFSPREDATVFKAIERACGEVEDMFAITI
FT                   SPVIVGEDRPLEASTKSAVLAAREAMVNAAKHSGQDSADVYAECFDELAIFVRDRGPGF
FT                   DLETVDESRHGVRDSILGRVKRAGGDVQIHNSAGTEVAIRMPFKKQ"
FT   gene            446152..446829
FT                   /locus_tag="CPFRC_02190"
FT                   /old_locus_tag="cpfrc_00434"
FT   CDS_pept        446152..446829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02190"
FT                   /old_locus_tag="cpfrc_00434"
FT                   /product="response regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00434"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28227"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241290.1"
FT                   /protein_id="ADK28227.1"
FT                   /translation="MKVFLVDDHSVFRAGVRAEIGGAVEIVGEAGTVSEAVADIDATRP
FT                   DVVLLDVHMPDGGGVAVLRGVTSPARFLALSVSDAAEDVISVIRAGARGYVTKTISGAE
FT                   LIDAITRVHTGDAVFSPRLAGFVLDAFARPDPMGAGVVDSPETDREVEEGKQVSDPIVD
FT                   ALTRRELEVLRLLARGYTYKEIGAQLFISVKTVETHASNILRKTQQSNRHALTRWAHSR
FT                   DLD"
FT   gene            complement(446833..447465)
FT                   /locus_tag="CPFRC_02195"
FT                   /old_locus_tag="cpfrc_00435"
FT   CDS_pept        complement(446833..447465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02195"
FT                   /old_locus_tag="cpfrc_00435"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28228"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241291.1"
FT                   /protein_id="ADK28228.1"
FT                   /translation="MNEHPVSSCSRWKLPAAAFAVALSITGLTACSTDKASAPTDAVDS
FT                   ASTHSDLPSAPASSSNAGLTPLGDANKEAKTQRPEKSESIVTGVRVGHHETFDRVVFNI
FT                   EGSGNPGWFVDYTSSPTQQASGKPIQVRGKTALNVNIDGTLLPFELGKQDPRIGTVQGV
FT                   GNITEVKAAGTVEGRSQFVIGLDAEHPYSVQIVPNPTRVVIDIRSQS"
FT   gene            447644..448516
FT                   /locus_tag="CPFRC_02200"
FT                   /old_locus_tag="cpfrc_00436"
FT   CDS_pept        447644..448516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02200"
FT                   /old_locus_tag="cpfrc_00436"
FT                   /product="sucrase ferredoxin"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00436"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28229"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241292.1"
FT                   /protein_id="ADK28229.1"
FT                   /translation="MVMTDLCSDVHIEPLPGTSRVGDTYVLLEHTGAWSHDILDGKTFT
FT                   AEVSSQLKALDVGLYLIRKPGRAGHVDKPLKTVYLVFGSVGIAETLVVEKAEDICSLDL
FT                   SGPGKNGAVRVEDPILLICTHAKRDACCAIKGRPIAASLCRAFPEAPIWECSHTKGHRF
FT                   APSMVLMPWGYAWGRLNEVASQELYRTARRGELFLPGCRGRGLWEPEGQVAEIAVAEHV
FT                   ASNGEKPQLGQFVWERIDDSSLITEASGGRSWAVSMHEAEVEGVVASCGSPPTTGKAWF
FT                   VDSVVQQRR"
FT   gene            complement(448648..449325)
FT                   /locus_tag="CPFRC_02205"
FT                   /old_locus_tag="cpfrc_00437"
FT   CDS_pept        complement(448648..449325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02205"
FT                   /old_locus_tag="cpfrc_00437"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00437"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28230"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599869.1"
FT                   /protein_id="ADK28230.1"
FT                   /translation="MTTQILAANWSRLGDTFTSAIVDTLIMVSVTLVVGGLLGLALGIL
FT                   LYTTRAGGILHNKFIYTIINILVNFVRPIPFIIMITAFGPLTLAVVGTTIGREAAMFIM
FT                   SIAATFAVARIVEQNLVTIDPGVIEAARSMGASPWKIITSVIVPEALGPLVLGYTFIFI
FT                   AIVDMSAMAGYIGGGGLGDFAIVYGYRAYDWEVTYVATFVIILIVQIAQLFGNWLSKKI
FT                   MRR"
FT   gene            complement(449322..450344)
FT                   /locus_tag="CPFRC_02210"
FT                   /old_locus_tag="cpfrc_00438"
FT   CDS_pept        complement(449322..450344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02210"
FT                   /old_locus_tag="cpfrc_00438"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00438"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28231"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_016829848.1"
FT                   /protein_id="ADK28231.1"
FT                   /translation="MNGTRIEFEDITKVFSSGKKNITALDGVTLTVEPGEILGVIGYSG
FT                   AGKSTLVRMINGLDFPTSGHLRLDGTDIVGMPEKKLRSIRAGIGMIFQQFNLFTSRTAA
FT                   GNIEYPLKLAGVDKQERKKRVDELLTFVGLSDRGGNYPEELSGGQKQRVGIARALANNP
FT                   ALLLADEATSALDPETTHEVLDLLRKVNRELGITIVVITHEMDVIRSIADKVAVMESGK
FT                   VVEYGSVYEVFSHPQTRVAQRFVATSLRNTPDAIESEDLLAHEGRLFTITLSEDSGFFT
FT                   AAAQAKDAGAGIGIVHGGITTLQKHSFGKVTVRLTGPDNVIDSFFDYLSTTTDIQEIQR
FT                   "
FT   gene            complement(450399..451256)
FT                   /locus_tag="CPFRC_02215"
FT                   /old_locus_tag="cpfrc_00439"
FT   CDS_pept        complement(450399..451256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02215"
FT                   /old_locus_tag="cpfrc_00439"
FT                   /product="methionine ABC transporter substrate-binding
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00439"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28232"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836019.1"
FT                   /protein_id="ADK28232.1"
FT                   /translation="MNIRHSIATIAAAAIAATGLVACSSDRIDDSVRIGTTDSTKKAWT
FT                   VWKDKAAEAGIALDVVEFSDFSTPNQALSQNQLDVNLFQHLKFLAEYNVKSGSDLVPVG
FT                   STEIIPLALFWKGHDSLDGIEGNSVAIPNDPTNQARALNVLVAAGLLKLKDGSPDLPAP
FT                   ADIDKEQSKVSVTPVEAASAPAAYGEGKPAVINNTFLDRAGIDAKTTIFQDDPSSAESE
FT                   PYINVLVAKKENKDDPRWQKLIELWHTPEVQDALAEDSKGTSVEVKRSPEELQQILDRL
FT                   QKQS"
FT   gene            complement(451469..452338)
FT                   /locus_tag="CPFRC_02220"
FT                   /old_locus_tag="cpfrc_00440"
FT   CDS_pept        complement(451469..452338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02220"
FT                   /old_locus_tag="cpfrc_00440"
FT                   /product="methionine ABC transporter substrate-binding
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28233"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366558.1"
FT                   /protein_id="ADK28233.2"
FT                   /translation="MKLRRSLAIIAASTLAATGLVACSSDAKDGTTTIKIGTTDSTKKA
FT                   WSAFEDKAKEAGIKLSIVDFSDYSTPNDALNQNQIDVNLFQHLKFLAEYNTGKGADLTP
FT                   IGATEIVPLALFWKDHDSLDGIEGESIAIPNDSSNQGRAINVLVQAGLLKLKHDGIVTP
FT                   APADIDEGASKVKVTPIDAAQTTAAYGEGKPAIINNSFLDRAGIDPKLAVFQDNPESQE
FT                   AEPYINAFVTKADKKDDPNINKLVELWHSPEVQEGVKEDSKGTSVEVKRSPEELQKILK
FT                   RLEEAQGK"
FT   gene            complement(453179..453766)
FT                   /locus_tag="CPFRC_02225"
FT                   /old_locus_tag="cpfrc_00441"
FT   CDS_pept        complement(453179..453766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02225"
FT                   /old_locus_tag="cpfrc_00441"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28234"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241297.1"
FT                   /protein_id="ADK28234.1"
FT                   /translation="MGTTLIDRNAEVCAYGVVTKTVRCGHFSTHSTATFNDGIENGGIA
FT                   HYNSTPHSKPGDSGGPVWLKETKELIGVHYGAQTGYSRVTLLPRKNGKVKLPDDAAIPG
FT                   RDSDMPPITSVPSTSEIADPIIPVEPGIIAPEDIPSSDTDQKTPSTPSHKVSSPGPIIG
FT                   IIAAVAAVFGIAAFGMAQVFGLPGISLLPRNF"
FT   gene            complement(453747..454229)
FT                   /locus_tag="CPFRC_02230"
FT                   /old_locus_tag="cpfrc_00442"
FT   CDS_pept        complement(453747..454229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02230"
FT                   /old_locus_tag="cpfrc_00442"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00442"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28235"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241298.1"
FT                   /protein_id="ADK28235.1"
FT                   /translation="MLNSWKSQVSRAFSARFGRQILVAIMATALISTGHSAVPSAVAVE
FT                   PFRMERTADNKPILRQGDKFRIKWGSRGHKVGTFCTVGYIDQERKLIFSAAHCVGSRRA
FT                   TFHLADWSDLGTLAYMPKDINPLIGGDFIAIDYSKNADRIVVENPYADHLHGDNPY"
FT   gene            454574..455530
FT                   /locus_tag="CPFRC_02235"
FT                   /old_locus_tag="cpfrc_00443"
FT   CDS_pept        454574..455530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02235"
FT                   /old_locus_tag="cpfrc_00443"
FT                   /product="zinc ABC transporter substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00443"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28236"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014401009.1"
FT                   /protein_id="ADK28236.1"
FT                   /translation="MSKLVRGLAAGMVVSLALVGCSSAGNNKDKSHNKLGIVATTTQIC
FT                   DYVKNIDADVNLTCLLAPNASAHEHEMTREQMDALSKADLLLKNGIDLESFLDNAVTSS
FT                   GFAGTTVDTSEGVSVAKWPFPPEEGESQPEFTHDPHIWTSPRNAKIQVENIGKALEKAD
FT                   PDNAAEYKKHVDGYVKKLVDLDKWISESLASVPEPERILFTSHDAFGYFSRDYNVKFIG
FT                   AALSDFNSQQDATADHINSAAAQVRESGTKVIFAENSNSSRSIEAVAKAAGVKLGGELY
FT                   GDSLGPDVSYIQSIVHNVETLVEGWGGKLAEKPASLG"
FT   gene            455612..456370
FT                   /locus_tag="CPFRC_02240"
FT                   /old_locus_tag="cpfrc_00444"
FT   CDS_pept        455612..456370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02240"
FT                   /old_locus_tag="cpfrc_00444"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00444"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28237"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836023.1"
FT                   /protein_id="ADK28237.2"
FT                   /translation="MNTDNTTTRNTDVNSPVLQFDNASFAYGKGPSRNVALQGVTGKLY
FT                   PGEALALIGPNGAGKTTLLKGIVGIVDSFQTIVDRGANNSIGYVPQSADLDLTFPVTAR
FT                   DVVAMGLYNESGWKPTFLRKNPAKDPRVDAALTRVGLLDRASKRFGELSGGQRQRVLIA
FT                   RALVATPKLVLLDEPFNGLDEPNRKELLRIIDAAKREGVAVVVSTHDLLLAEETCDKAL
FT                   LLAGRQIAFGAINDVMTPDLISRAYGGTRG"
FT   gene            456363..457205
FT                   /locus_tag="CPFRC_02245"
FT                   /old_locus_tag="cpfrc_00445"
FT   CDS_pept        456363..457205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02245"
FT                   /old_locus_tag="cpfrc_00445"
FT                   /product="iron chelate uptake ABC transporter family
FT                   permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28238"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241301.1"
FT                   /protein_id="ADK28238.1"
FT                   /translation="MVNELAQLLNIPPYLLRPIILLTVLGIVSGLVGVIVNLRKLEFNA
FT                   EAVVHAVFPGIVAGAVFGGRESIIPYASVVAVVVAVVLTFASRRSEAGTAIVLTSFFSV
FT                   GIVLSLRKGDLSGQLEALMFGRLLESTDKRLGEALIVCAIAILIMVITWRNQIFVAFDR
FT                   LGAKATGVNVVLYDAAINVAIAAVVVSASTAIGTLLVIGYLVIPGAAARLVSTRIRYMV
FT                   PLAMAVGLIGGYIGLWITGVSARISPQAAVALSVVAMYFLALGLSKVGRRTEKSDASC"
FT   gene            457199..458008
FT                   /locus_tag="CPFRC_02250"
FT                   /old_locus_tag="cpfrc_00446"
FT   CDS_pept        457199..458008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02250"
FT                   /old_locus_tag="cpfrc_00446"
FT                   /product="metal ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00446"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28239"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014401011.1"
FT                   /protein_id="ADK28239.1"
FT                   /translation="MLIDVLTVPILELIIVGALCGLVGVFAVLKQRVFFTESVTHATFP
FT                   GAIVGVVILGRDGLYLGALIMCVFMAVAMRWLTRIHGQSSQASAGIILTVSFALGYFLN
FT                   KWFAPLPIRIEGFLAGSVLTVRILDAVIAGVVLVVSVGIVNSFQKHLIYYSFDEMGFRA
FT                   AGGNVKLAESLILGMIVATVVCVIPAIGTILSIALIAAPTAGLLLLVSSPSKLLWLAPM
FT                   VGVIIGLAGLGIAVVFNLSAGGTIAVVAGVFYGVCMSLSSLKSPRTT"
FT   gene            457966..458646
FT                   /locus_tag="CPFRC_02255"
FT                   /old_locus_tag="cpfrc_00447"
FT   CDS_pept        457966..458646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02255"
FT                   /old_locus_tag="cpfrc_00447"
FT                   /product="metal-dependent transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00447"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28240"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014306562.1"
FT                   /protein_id="ADK28240.1"
FT                   /translation="MHVSELPQKSQDYLKNVWDLHEATGKPVPLGELATRMSEKTSTAS
FT                   EAVKKLVARGFLDHERYGGILLTEAGNALATQVVRRHRLIEMFLFDTLGYTWDEVHEEA
FT                   EVLEHALSDRLLERIDAHLGHPTRDPHGDPIPSQEGIVDSIPTRELGEFEIGETVIVER
FT                   IHDRDPDLLRYLAGHGVLPGVSVTIKQPVYPGMSLISVDGKDVPLADASLWAINVTEAE
FT                   ASKG"
FT   gene            complement(458665..459195)
FT                   /locus_tag="CPFRC_02260"
FT                   /old_locus_tag="cpfrc_00448"
FT   CDS_pept        complement(458665..459195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02260"
FT                   /old_locus_tag="cpfrc_00448"
FT                   /product="tRNA (cytidine(34)-2'-O)-methyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00448"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28241"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366562.1"
FT                   /protein_id="ADK28241.2"
FT                   /translation="MHFLERIVDSFQNRSKITFMSAFAHIIFDQPVIPPNTGNAIRMCA
FT                   GTGAHLHLAGPLGFNLEEKNLRRAGLDYHDLAEVSIHENLERCFDSLPHTRIFAFTTHG
FT                   KTHHSDIRWESGDALLFGTEPTGLAEETLVHPRITQLVRIPMLPGRRSMNLSNAAAVAA
FT                   YEVWRQLGYQGGV"
FT   gene            459207..460052
FT                   /locus_tag="CPFRC_02265"
FT                   /old_locus_tag="cpfrc_00449"
FT   CDS_pept        459207..460052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02265"
FT                   /old_locus_tag="cpfrc_00449"
FT                   /product="bifunctional methylenetetrahydrofolate
FT                   dehydrogenase/methenyltetrahydrofolate cyclohydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00449"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28242"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525380.1"
FT                   /protein_id="ADK28242.1"
FT                   /translation="MTAIKLDGKLYRDEIFADLEDRVQTLKEKGIVPGLATVLVGDDPA
FT                   SHSYVKMKHSDCEQIGIRSIRRDLPADISQEELLNVIDELNNDPSCTGYIVQLPLPKHL
FT                   DENAVLERIDPDKDADGLHPVNLGKLVLNEDAPLPCTPNGAIHLLKRFGIEIAGKKVVV
FT                   IGRGVTVGRPIGLMLTRRSENATVVLCHTGTKDLTKETLQADIIVAAAGQPHMLTADMV
FT                   KPGAAILDVGVSRKDGKLLGDVHPDVWDIAGAISPNPGGVGPLTRAFLIRNVVERAELG
FT                   "
FT   gene            460045..460371
FT                   /locus_tag="CPFRC_02270"
FT   CDS_pept        460045..460371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02270"
FT                   /product="DUF3017 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523080.1"
FT                   /protein_id="QGW57315.1"
FT                   /translation="MVKISPLDNPHDIGRKESKIPSGIQYIGLSLFVIAVAISGVYSLT
FT                   EHWRRATFVLGTALLWLAVLRLTCDSKVLGVLSIRSRAFDVMYASAVGGAMVFLSYSID
FT                   SLGS"
FT   gene            complement(460378..461478)
FT                   /locus_tag="CPFRC_02275"
FT                   /old_locus_tag="cpfrc_00450"
FT   CDS_pept        complement(460378..461478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02275"
FT                   /old_locus_tag="cpfrc_00450"
FT                   /product="HNH endonuclease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28243"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241306.1"
FT                   /protein_id="ADK28243.1"
FT                   /translation="MVGFRHTDTSNSVSAFQMSINRQLITFWLHQVPEKEEDFHTQVDA
FT                   LSISMNISRHEAKSGLRVGVMLRNFPKLLSCLQTHWHLDMPRLVILEKHLMAINKNLLP
FT                   QVDSYLCEYFTPQVSGQVIPQKATLSKHIRNYIEGIDPPAAQRPQDQQQRTASFKRGLD
FT                   GYTRLSVTMTDAEACVLQQALKKQPGAELIDSFMNLIDKKITTKVILNVFKGTDGLMRM
FT                   VDGGIIDSSAIDATRVIDADAYTDSYHPTDEIRAAVQLLDGSCRYPNCTVSAQHCDIDH
FT                   VINHDENGPTTPDNLACLCRFHHNFKTEQRVHYSIDENRVATWYFPNGVIKKSQPGGVK
FT                   RPPRFGQSWKKHEEQRMRARRQANRS"
FT   gene            complement(461761..462852)
FT                   /pseudo
FT                   /locus_tag="CPFRC_02280"
FT                   /old_locus_tag="cpfrc_00451"
FT   CDS_pept        complement(461761..462852)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02280"
FT                   /old_locus_tag="cpfrc_00451"
FT                   /product="homoserine O-acetyltransferase"
FT                   /note="internal stop; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28244"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366566.1"
FT   gene            complement(462931..463434)
FT                   /locus_tag="CPFRC_02285"
FT                   /old_locus_tag="cpfrc_00453"
FT   CDS_pept        complement(462931..463434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02285"
FT                   /old_locus_tag="cpfrc_00453"
FT                   /product="hemin receptor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00453"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28246"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800078.1"
FT                   /protein_id="ADK28246.1"
FT                   /translation="MNTSTTSAFKNLYPDVDPTQGLPLNWSERLSITFSCATLAFGAVF
FT                   GDLIIVGAGLIFILFSTIAPAQKTARRIRTEAKNRFPTQPWAENAKSSGRRQILLIVLF
FT                   WVAITAVCIGLFLAAPHISQLLAASIAAAITGILTWFMPGMSPIWRKGSGGRRQARKHM
FT                   RTAA"
FT   gene            463635..465482
FT                   /locus_tag="CPFRC_02290"
FT                   /old_locus_tag="cpfrc_00454"
FT   CDS_pept        463635..465482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02290"
FT                   /old_locus_tag="cpfrc_00454"
FT                   /product="hemin receptor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00454"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28247"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241310.1"
FT                   /protein_id="ADK28247.1"
FT                   /translation="MLKPRKLVLGLMSVAALATAPLSVVFASHAYAAEEQCSFDWGIKQ
FT                   TFRYYMLKGAAGQTGGQWATEGIGFSGSDTGHDGAFNFTPSKARVEGTTATIPFGGLIH
FT                   FKGHDHGGGVYLLDMTLSDWKVVTNGSSAEIKVDYVSYESDMSNTHERGAQITGDDVTI
FT                   ATINLSNYADPSSGSVDLSGTTTLTSEGAKLFIAYQAGETMDDTRGHVRLDGQCSPSIE
FT                   GGNGSGGSTGGKKRALSSIKGNFTGFNKEAMSILSETNDTMNATTIFMDNAGHFLDSLK
FT                   DFETRGTGAGKTNSTTRTTRGSNATAANGQDSGKNRQFLPKTENQTPPSPSQQTAGNTT
FT                   PQTCESDSKGIESATARWGVKKSFQSYITGSIAKGKWSLDQTTHSGGQFVFSGKSGAVD
FT                   VAKRSGKIKFAGGVNFSGHNGILDLRISNIAIGFNGNSGVMYADVRSSDLQGNKSDYGH
FT                   IPLANLSFASLDLSDSKVSGKASATLTKEGAGAFAGFYEAGTELDPVDFDAGLGGSADC
FT                   DSSVAKAGANTATSNGAKKASGTTASAKQGDKDDSEESSIDSQNPQETGYKNGAKNFKI
FT                   RQASDDKDGIDPNMYLLLIVAGFVIAGGSMGRLVLNNPS"
FT   gene            465608..466663
FT                   /locus_tag="CPFRC_02295"
FT                   /old_locus_tag="cpfrc_00455"
FT   CDS_pept        465608..466663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02295"
FT                   /old_locus_tag="cpfrc_00455"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28248"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525386.1"
FT                   /protein_id="ADK28248.1"
FT                   /translation="MNKFVRVAASVACALALVSCGVQGSYDSTKELRESFPTDVKDPRS
FT                   FKGVSEVKNFDDVQPVADSVSPKLPVKLTDADGYEVEVTDVSRILALDIYGTYTKTLEG
FT                   LGLTKNIVGRTVSSTENALKDLPVVTEGGHTINVEAVLNLRPSLVIVDHSIGPRDAIDQ
FT                   IRAAGVTTVVMEPTRTIDSVSEDIKNLGGVVGLNDEAVKLAERSVNEIHSAQEAIKEIA
FT                   PKDPMKMAFLYARGNGGVFFIMGDGTGAKDLIEGLSAVDLAAEHKLSYAEPANAEALAK
FT                   INPEAIIMMSGGLESTGGIDGLLSRPGVAQTTAGKNKRVITIPDGQSLAFGPLTGQTLL
FT                   RTAQALYAPQT"
FT   gene            466647..467699
FT                   /locus_tag="CPFRC_02300"
FT                   /old_locus_tag="cpfrc_00456"
FT   CDS_pept        466647..467699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02300"
FT                   /old_locus_tag="cpfrc_00456"
FT                   /product="iron chelate uptake ABC transporter family
FT                   permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00456"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28249"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655115.1"
FT                   /protein_id="ADK28249.1"
FT                   /translation="MLRKRSTSVRDVFEHRARRRAILFIVLAGLAFVAFVTSLALGQYY
FT                   VPLQDLPFILFNRGDEGLTTSVVWEIRLPRIVLGLLVGACLGVAGTLMQAVFANPLAEP
FT                   SIIGVTSGAGVGAAAVIVFNIGFLGTFTVPVAAFISAVLVTVIIYQLARHQGKVAVVNL
FT                   ILTGIAINAVCNALISFLVYLAPTANREQIVFWQMGSLNGSQWKHVWVVLPIAIAGVLI
FT                   AVRLGRQLDVLALGERAAVHTGIHVSRLRIIAIAASTILTAGAVSFAGLIGFVGLIVPH
FT                   LLRSLVGPENKILLPASALTGAVLIAFADVAARTLIPFADLPIGIFTAIVGGPTFFILL
FT                   RRMLKKGSVH"
FT   gene            467696..468538
FT                   /locus_tag="CPFRC_02305"
FT                   /old_locus_tag="cpfrc_00457"
FT   CDS_pept        467696..468538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02305"
FT                   /old_locus_tag="cpfrc_00457"
FT                   /product="heme ABC transporter ATP-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00457"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28250"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241313.1"
FT                   /protein_id="ADK28250.1"
FT                   /translation="MSKQPAVVVRDLTVAIGEKILLDKVTFEARRGEITGLIGPNGAGK
FT                   STLLAAISGDLERSSGTIDILGHDPATSSPKSLARIRAVMMQDVSVSFEFLVRDVVAMG
FT                   RRPWEGTEKQLFDDPLIDAALAATDAAHLAGRDVITLSGGERARVALSRVLAQQTPVVM
FT                   LDEPTAALDIRHQEQVLGLMRTIARETDVAVIVVLHDLNAAAAYCNRIVCLANGSVAQE
FT                   GNVDSVYTDENLSTVYGWPIHVEKREDDSLFVHPARDQGGKQEADFVALANQAAAATT"
FT   gene            468684..469592
FT                   /locus_tag="CPFRC_02310"
FT                   /old_locus_tag="cpfrc_00458"
FT   CDS_pept        468684..469592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02310"
FT                   /old_locus_tag="cpfrc_00458"
FT                   /product="hemin receptor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00458"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28251"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241314.1"
FT                   /protein_id="ADK28251.1"
FT                   /translation="MFKRLAVPLAATMFAASIAVPQAVASEKCSIEVVGGTLSWGVKHS
FT                   WRSYIQGPIARGKWETAGAVTEKGTNKSGADFAFTFDVDPHASQVTVDTEGKVTSAEIK
FT                   TKTSSLTFTGHGDALQSIMKDPYVSIEGQSVKAGSSYEGYYVEGKEMTSYKASDRTEAN
FT                   KKTGTDTFAAGQLQGWKLDNEKLSFSGKNMKYTPKPLTDAKKNIIEGIDILFMGIYNDE
FT                   YKPEIDDVNVELTVKKDCVIKQNQASGVAKGNSSKDASLGDFPKIWSIVLGVAGLAATV
FT                   AILFQVLVKSGLLRNLPFIQK"
FT   gene            complement(469660..470974)
FT                   /pseudo
FT                   /locus_tag="CPFRC_02315"
FT   CDS_pept        complement(469660..470974)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02315"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523085.1"
FT   gene            complement(471157..473367)
FT                   /locus_tag="CPFRC_02320"
FT                   /old_locus_tag="cpfrc_00461"
FT   CDS_pept        complement(471157..473367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02320"
FT                   /old_locus_tag="cpfrc_00461"
FT                   /product="NADP-dependent isocitrate dehydrogenase"
FT                   /EC_number="1.1.1.42"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28254"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599896.1"
FT                   /protein_id="ADK28254.1"
FT                   /translation="MAKIIYTRTDEAPLLATYSLKPVVEAFASTAGIEVETRDISLAGR
FT                   ILSQFPEFLTEDQKVDDALAELGELAKTPEANIIKLPNISASVPQLKAAVTELQSQGYK
FT                   LPNYPDSPSTEEEKDIRARYDAVKGSAVNPVLREGNSDRRAPIAVKNFAKKHPHRMGAW
FT                   SADSKTNVVTMESNDFRHNEKSVIMPDNDTLTIKLVTDNGEKVLKDGLKVLKGEVVDGT
FT                   FISARALDEFLADQVKRAKDEGVLFSAHLKATMMKVSDPIIFGHVVRAYFADVFAKYGE
FT                   QLEAAGLNGENGLAAIYSGLESLPNGAEIKAAFDEALESGADIAMVNSAKGITNLHVPS
FT                   DVIIDASMPAMIRTSGHMWNKNDEEQDTLAVIPDSSYAGVYQTVIADCKKNGAFDPTTM
FT                   GTVPNVGLMAQKAEEYGSHDKTFKIEANGTVQVVSSAGEVLIEHNVEAGDIWRACQAKD
FT                   APIQDWVKLAVTRSRLSGMPAVFWLDPERAHDRNLAALVEKYLADHDTEGLDIHIMSPV
FT                   EATQFSIDRIRRGEDTISVTGNVLRDYNTDLFPILELGTSAKMLSVVPLMAGGGLFETG
FT                   AGGSAPKHVQQLVEKNHLRWDSLGEFLALAESLRHFANTEGNTKAGILADTLDRATETL
FT                   LNEGYSPSRKAGEIDNRGSHFFLTKFWAKELSIQSEDADLAATFTPVAEALETHSEDIA
FT                   DALLAVQGAPADLGGYYHPDDAKTTAVMRPVASYNDIISSIK"
FT   gene            473620..474849
FT                   /locus_tag="CPFRC_02325"
FT                   /old_locus_tag="cpfrc_00462"
FT   CDS_pept        473620..474849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02325"
FT                   /old_locus_tag="cpfrc_00462"
FT                   /product="MFS transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00462"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28255"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800084.1"
FT                   /protein_id="ADK28255.1"
FT                   /translation="MQKMMRRPIPRQTDISEQRRLATMIALALGTFGLGITEFVTMGLL
FT                   NQIAADFSVSEDTAGHVIAAYALGVMIGAPLITALTGMIPRRRLLLILTFAFVAGNALT
FT                   FFASSFSVLIVARVIAGLPQGAFFSVASLAVASMAPEGQRGRSLAFVGMGLPLATVLGV
FT                   PAAQALGHATSWHAAYLLVTIVGVVTLGLLWFLMPHMTKMKPTSPLTELGALARGQVWA
FT                   SLLIGSVGFGGMFAVYTYISWTMTQQAGLQENLMWLVLMAYGIGMIAGNWLGGRLSDWS
FT                   VEYGIFWALIAIVVTLAGFFFTSHNAVLATINFGLIGLSGSLLIPSLQIRLMDVAGQAQ
FT                   TLAAALNQSALNIANAAGAQFGGIVIAAGYGYSAPALAGAALGIAAIILWIPAHIFRMR
FT                   AEQKPTASAS"
FT   gene            complement(474846..475616)
FT                   /locus_tag="CPFRC_02330"
FT                   /old_locus_tag="cpfrc_00463"
FT   CDS_pept        complement(474846..475616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02330"
FT                   /old_locus_tag="cpfrc_00463"
FT                   /product="MerR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00463"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28256"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800085.1"
FT                   /protein_id="ADK28256.2"
FT                   /translation="MNELTIGEAAEFLGITTRALRHWDTIGLLEPQWRNHSDYRLYTEE
FT                   DLTKAFTILVYREAGLSLKTIQNILEEPSTEKEHLQRQLKLLKQEIFRKESAILSVEKL
FT                   LRGETSMTPQDFANAFSHDWSENYADYRDEAESRWGESEEWAASQSKVRSMSTNDWQNA
FT                   QASDAAFVSELHSAWQAGVRPGSAAADRIVALHREQIDQWYESSLSKQLILAQMYVSDD
FT                   RFAAHYQGLAPYLLELVRDAAQRGGVDVDNPSWV"
FT   gene            475686..476585
FT                   /locus_tag="CPFRC_02335"
FT                   /old_locus_tag="cpfrc_00464"
FT   CDS_pept        475686..476585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02335"
FT                   /old_locus_tag="cpfrc_00464"
FT                   /product="exodeoxyribonuclease III"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00464"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28257"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910896.1"
FT                   /protein_id="ADK28257.1"
FT                   /translation="MQITTVNVNGIRAAVKERSETNKGMLPWLDGSGSDVVLLQEVRAS
FT                   EKDTLTALAPALDAGWHYVGAPAAAKGRAGVGILSRSELFDVHVGIEGFEDSGRYIQAT
FT                   LHDGTDDVTVGSLYLPSGSAQTEKQDEKYRFLDVFEPFLEQAAKDHKYMVIGGDWNICH
FT                   RREDLKNWKTNRKKSGFLPDERAFMDSVFGTFPDAASQVEDAGQWAGAVDYASDGKRKP
FT                   ALNPQWFDVARRLHPQDAPYTWWTYRGQAFDTNAGWRIDYQAATQAMLDRAEKTWVDKA
FT                   EAYDLRWSDHSPLSVIYH"
FT   gene            476672..476851
FT                   /locus_tag="CPFRC_02340"
FT                   /old_locus_tag="cpfrc_00465"
FT   CDS_pept        476672..476851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02340"
FT                   /old_locus_tag="cpfrc_00465"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28258"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241321.1"
FT                   /protein_id="ADK28258.1"
FT                   /translation="MRVKSLIAMVVGLVLFVGAHFMIGAYDVSSMLWSIIMGVGGAMAV
FT                   GGLVGALCKEPRKQ"
FT   gene            477021..478049
FT                   /gene="trpS"
FT                   /locus_tag="CPFRC_02345"
FT                   /old_locus_tag="cpfrc_00466"
FT   CDS_pept        477021..478049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="CPFRC_02345"
FT                   /old_locus_tag="cpfrc_00466"
FT                   /product="tryptophan--tRNA ligase"
FT                   /EC_number="6.1.1.2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00466"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28259"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836042.1"
FT                   /protein_id="ADK28259.2"
FT                   /translation="MTESKAVKKQRVLSGIQPTADSYHLGNYLGALKQWIDLQDGYDAF
FT                   YFIPDLHAITVDQDPKELRQRTIAGAAQLLALGIDPEKSTLFVQSHVPEHAELGWIMTC
FT                   LTGFGEASRMTQFKDKSAKRGADRTSAGLFTYPMLMAADILLYRPQLVPVGEDQRQHLE
FT                   LTRTLAERFNSRFKKTFVVPEGIIPEGAAKIYDLQDPTSKMSKSGTNPKGLINLLDEPK
FT                   VSIKRIKSAVTDSDGEIRYDKANKPGVSNLLVIQSALTGKSIDDLVAGYQGQGYGALKT
FT                   DTADALEAFVTPLKAKYDMYMSDRAELERVLALGASKAREVASRTLADAYERIGFLKVG
FT                   KE"
FT   gene            478185..479270
FT                   /locus_tag="CPFRC_02350"
FT                   /old_locus_tag="cpfrc_00467"
FT   CDS_pept        478185..479270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02350"
FT                   /old_locus_tag="cpfrc_00467"
FT                   /product="inner membrane protein YhjD"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00467"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28260"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241323.1"
FT                   /protein_id="ADK28260.1"
FT                   /translation="MPTVSTSTRQDKHKTDEYGIERSNADEPGFVDKYRAKWSWFDHIM
FT                   RMNERYGEEGGNQYSAGITYFSVLSMFPLLMLIMAIAASMLAQRPDLLAQLQEKIVASV
FT                   DGSIAETLTKILDTAIAQRGAMFGIGGLTALWSGLGWMSNLRYGASKMWCYPVTGENFF
FT                   KAKLQDLLGLVGLIFAFMVAFGVTAIGSSGLTERLLVVVSLDKVPGIFLLTFAVSILLG
FT                   LIANFCVFLWMLKYLPRGEVPMKSAVRASIIGAVLFEVFKQLAAQFFSNALNNPAGATF
FT                   GPIIGVMVLFYFVWRILMYCSAWAATTEESLAIAKLDVPAPAVIRVREEVRVSNDKGKG
FT                   IGIGVATGAVAAAIVAALRKK"
FT   gene            complement(479368..480582)
FT                   /locus_tag="CPFRC_02355"
FT                   /old_locus_tag="cpfrc_00468"
FT   CDS_pept        complement(479368..480582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02355"
FT                   /old_locus_tag="cpfrc_00468"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00468"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28261"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241324.1"
FT                   /protein_id="ADK28261.1"
FT                   /translation="MKVSSTIAALTASSFTLAFVLTPAALADPTPRSSAPNTNNCEYAL
FT                   TPPPAETTSEQLKPGQTSPTPRPTVINEYRGGCGVTKAKGFNEPANTASAWMVFDLDNG
FT                   DVIATKDPHGRYRPASVIKALLALVALDELNLKAKVKITAEDANQEGSAVGYVDGVEYT
FT                   NEQLLYGLLLNSGNDAAHALAQRLGGDNKTLEKVNALAHSLGTVDTYAASYSGLDAPGM
FT                   STSAHDLALIYSHAWKNPTFAKMVATEHIELPGNAATPTFQVWNDNGLFLNDEHGIGGK
FT                   TGYTDDAHHTFVGAKNIDGRRLAAVILDTTVEQGRPWQQAQKLIDAAYAVPRGEKVGNL
FT                   KETSIPSQPSPSELPTPPTPEEGDAPSRDRNHAPVLVIGGATLGLVVLGILTWFLGRKK
FT                   HDRKA"
FT   gene            480618..481508
FT                   /locus_tag="CPFRC_02360"
FT                   /old_locus_tag="cpfrc_00469"
FT   CDS_pept        480618..481508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02360"
FT                   /old_locus_tag="cpfrc_00469"
FT                   /product="adenosine deaminase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00469"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28262"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241325.1"
FT                   /protein_id="ADK28262.1"
FT                   /translation="MYDTPDFRTEFKILQPELLHAMPKIILGDAGDAAYLNARIRELGD
FT                   DTVAYYECTVPLDSADAAIAAAESAPFPVGIVLDLDDKPAPLKQLKNPVVLACRTSNPG
FT                   TARVLRENLIAYDFVGPLEHQIHAGATRILHGIELFDDFCVTDGDLKPGRLSAWVLDRR
FT                   IPVLTNPSEDLNSGDISDLSDHPLPLMHKLGFQAAPALLSTDRMLELVEHFDYSIEDLY
FT                   SLTMTAVFVSYAPEFVRSQLIESTIAPFFASLGDEYGGEAEDVEVGKESSILSQPPLEL
FT                   VTEMGIDLKDLGFNQ"
FT   gene            complement(481570..482805)
FT                   /locus_tag="CPFRC_02365"
FT                   /old_locus_tag="cpfrc_00470"
FT   CDS_pept        complement(481570..482805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02365"
FT                   /old_locus_tag="cpfrc_00470"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28263"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836044.1"
FT                   /protein_id="ADK28263.1"
FT                   /translation="MANKGIVPVKLSLTEGDFYTLWAPEWREHGAVWQAFLGKGDDLYV
FT                   FSSPEEVLLFLESGAKHDLSDHPKWNSFNAGAANRVVPTARQEFDIVGTPQLLSERPSY
FT                   DNVSAVARNFKIARSLGDVTGTTDILVFFSSHSILSNPERGVDHFAGEGGLGEWSAIGR
FT                   VILSNWGMVVDSLDKLITVKDLTTESAAIDDAASRIKDAEEAARIAREKAEEQKKAEAE
FT                   KVDPYDTTPWAAAGIDPIKISIDGRTLYTLRTYVEAQPVFLGKFGEIFTFSSSKALLRW
FT                   LVEHEDHDLAKVSTWEDLMVPLNAGELDVTVHADNVYSFNGLVRDINSSVEAVDTAQMG
FT                   RAYELLADAADWAADDSLNSYFLANPRMQDYISYMLGSSEVSGYTPTPPFDDHAEGWKE
FT                   LEAMLTKRFSKF"
FT   gene            complement(482826..483715)
FT                   /pseudo
FT                   /locus_tag="CPFRC_02370"
FT   CDS_pept        complement(482826..483715)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02370"
FT                   /product="NlpC/P60 family protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800090.1"
FT   gene            complement(483712..483981)
FT                   /locus_tag="CPFRC_02375"
FT                   /old_locus_tag="cpfrc_00472"
FT   CDS_pept        complement(483712..483981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02375"
FT                   /old_locus_tag="cpfrc_00472"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00472"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28265"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366579.1"
FT                   /protein_id="ADK28265.2"
FT                   /translation="MRIDPDHARTLIAQLANDAASLVPIAHSVGASLPELGSFFAAYNS
FT                   CLDAFMARSTAQCTRAEILVDKALHSLEAVENADTSLAFSLETL"
FT   gene            484046..484681
FT                   /locus_tag="CPFRC_02380"
FT                   /old_locus_tag="cpfrc_00473"
FT   CDS_pept        484046..484681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02380"
FT                   /old_locus_tag="cpfrc_00473"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00473"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28266"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004567014.1"
FT                   /protein_id="ADK28266.2"
FT                   /translation="MEITIVDHPLAASRLSIMRDKRTNNAGFRAALADLGAMLIYEASR
FT                   SLEVENFPMSTPVADTQGIRLQDPPIIVPIIRAGLGMVDPALSMIPDAQVGFLGLARDE
FT                   ETHEPVPYLEALPADLSGRTVFCVDPMLATGGSLLHAIKLLADRGATDITAVCMVSAQA
FT                   GVDALAGSGLPCRLVTATIDPELNENAYIVPGLGDAGDRLYGPRNIDL"
FT   gene            484883..485320
FT                   /locus_tag="CPFRC_02385"
FT                   /old_locus_tag="cpfrc_00474"
FT   CDS_pept        484883..485320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02385"
FT                   /old_locus_tag="cpfrc_00474"
FT                   /product="helix-turn-helix domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00474"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28267"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800092.1"
FT                   /protein_id="ADK28267.1"
FT                   /translation="MVNGWQQWPSFGHALSVRLRTLRKMRGLSQDRLAELSDVSRNQIS
FT                   NLERNENSVTKSADPTMSTVYRLARALHVPPAVLLPAATDIVQDICKDNAADLGVDLVW
FT                   PAAPEDTLAFDIQHLYGLRMGENPRFVDPSGPKATPGDATG"
FT   gene            complement(485343..486944)
FT                   /locus_tag="CPFRC_02390"
FT                   /old_locus_tag="cpfrc_00475"
FT   CDS_pept        complement(485343..486944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02390"
FT                   /old_locus_tag="cpfrc_00475"
FT                   /product="phospho-sugar mutase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28268"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800093.1"
FT                   /protein_id="ADK28268.1"
FT                   /translation="MSLRFGTAGVRAPVGPASNQMNVGNVTKFTSAVAMWLAEQAAASP
FT                   TPHARTYPQDLIKGIGDVFHDDAAPLRVAVGYDARYGSHAFATTTAEVFAGAGFEVFLM
FT                   PMPAPTQLIPWLIRKWELDGGVQITASHNPAADNGYKVYCHNGRQLIDASARSIEAIYD
FT                   GIDDSSQIPRVSVRPSSDLLRRYIDDAVSTIIPAQADLLRVNSDRANLRVAFTAMHGVG
FT                   GRTLQVCLQAAGFAQVFPVRSQLYPDPTFPTVDFPNPEEPTAVAALLEHGEAVDADVLI
FT                   ALDPDADRCAVGIRTEHGTLRMLRGDELGPLLAARLVPNWSPEDAIPQPVVATTTVSSQ
FT                   LLSVMAKDRGWLYQETPIGFKNLAAAAASAAQDGGIAYACEEANGVAPDLHRVGDKDGV
FT                   VTALVACAWAAELKGLGLGLHSALHDLYRQYGYFTGTQIAVRTIDPAELVSDWVANPPE
FT                   QLAGLAVTATQLPEIRGLKLSGSNEDASIRAIVRASGTESKVKMYLEVSQATSVEQAEE
FT                   LLAQLCDEMRSRALRF"
FT   gene            487222..488418
FT                   /locus_tag="CPFRC_02395"
FT                   /old_locus_tag="cpfrc_00476"
FT   CDS_pept        487222..488418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02395"
FT                   /old_locus_tag="cpfrc_00476"
FT                   /product="amidohydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00476"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28269"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241332.1"
FT                   /protein_id="ADK28269.1"
FT                   /translation="MATSISEHVNAWIADHQEEVIGWRRHLHRYPELSHMEFATTDFIA
FT                   KTLISYGLSPIRFPTTGLMVNVGPNTEEKVAFRADIDALPISEQNDLDYASLNAGVMHA
FT                   CGHDVHATIALATACALASAELNIGVRVIFQPAEEVMDGGAPDVIGYGALEGIANIFAI
FT                   HAEPKLKVGYVGVRTGAITSASDVVEVHVTGPGGHSSRPHLTVDVVYALSKLVVDLPGL
FT                   LSRRVDPRTGTVLVFGSINAGYAPNAIPESGSVTGTIRTADITVWRTMGELLRELIPQV
FT                   LMPTGCEVSIVHHKGVPPVLNDDVATALLADVACSIDPNAVVQAPQSSGGEDFSWYLEH
FT                   VPGSMARLGCWDGIGEPGDLHQADILIDERCIAVGVKLFGSVVDRYNHNAELFSQPSR"
FT   gene            488558..489967
FT                   /locus_tag="CPFRC_02400"
FT                   /old_locus_tag="cpfrc_00477"
FT   CDS_pept        488558..489967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02400"
FT                   /old_locus_tag="cpfrc_00477"
FT                   /product="NAD(P)H-quinone dehydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00477"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28270"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599920.1"
FT                   /protein_id="ADK28270.2"
FT                   /translation="MLTRIVIIGGGPAGYEAALAGAKYGADITIIEDRGLGGAAVINDC
FT                   VPSKSFIAGANIKTDLRRADDMGLNKGIGEANLLLDALNARVQALAGEQSGDIRRSVIN
FT                   QGVRVLDGRGSFDDYNPKQTLHYIKAELNDGTVETIECDLVLVATGATPRILPGAQPDG
FT                   ERILTWRQLYDLKDLPDHLIVVGSGVTGAEFVSAFAELGVKVTMVASRDRILPHDDADA
FT                   ADTLESVLAERGVSLEKHARVDSVSRTEDGGVCVRTSDGREIFGSHALMAVGSIPNTKD
FT                   LGLEKIGVEMTRSGHICVDRVSRTNVPGVYAGGDCTDLFPLASVAAMQGRIAMYHALGE
FT                   GVKPLRLKTVSTAVFTRPEIAAVGVTQHQIESGDVNARTVILPLETNPRAKMRSLRHGF
FT                   VKMFCRRHSGIVIGGVVVAPTASELILPIAVAVTNQLTVSDLAESFAVYPSMSGSITEA
FT                   ARQLVSHDDLE"
FT   gene            490491..493916
FT                   /locus_tag="CPFRC_02405"
FT                   /old_locus_tag="cpfrc_00478"
FT   CDS_pept        490491..493916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02405"
FT                   /old_locus_tag="cpfrc_00478"
FT                   /product="pyruvate carboxylase"
FT                   /EC_number="6.4.1.1"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00478"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28271"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523090.1"
FT                   /protein_id="ADK28271.1"
FT                   /translation="MHHSTQKTATHHPTSFSKILVANRGEIAVRAFRAAFETGASTVAV
FT                   YPMEDRNSFHRSFASEAVLIGEGGSAVKAYLDIDEVIRAAKQTGADAVYPGYGFLSENA
FT                   RLARECAENGLTFIGPPPSVLDLTGDKSAAVAAAREAGLPTLTETEPTDDPKELAILSK
FT                   DQVYPLFVKAVAGGGGRGMRFVEKPEDLEKLAAEASREAAAAFGDGRVYAERAVINPQH
FT                   IEVQILGDAEGNIVHLYERDCSLQRRHQKVVEIAPAQHLDPDLRDKICADAVAFARHIG
FT                   YMGAGTVEFLVDEDGNHVFIEMNPRIQVEHTVTEEVTQVDLVKSQIMIAAGATLEQLGL
FT                   RQEDIHTEGAALQCRITTEDPNNGFRPDTGTITAYRSPGGAGVRLDGAAMLGGEISPNF
FT                   DSMLVKMTCRGADFETAVARAQRALAEFVVSGVATNIGFLRALLREEDFQSKRIATGFI
FT                   ADHPWLLQAPPADDEQGRILDYLADVTVNKPHGIRPAVVNPVEKLPVESKGKLPRGSRD
FT                   RLLQMGPVEFARALRKQDALAVTDTTFRDAHQSLLATRVRSNTLIDAARHVARLTPELL
FT                   SVEAWGGATYDVAMRFLHEDPWERLDHLREAMPNINIQMLLRGRNTVGYTPYPDSVCAA
FT                   FVNEAARSGVDVFRIFDALNDVSQMRPAIDAVLNTGTTVAEVAMAYSGDLTNPKEKLYT
FT                   LDYYLNLAEQIVDSGAHILAVKDMAGLMKPAAATKLVTELRKNFDLPVHVHTHDTAGGQ
FT                   LATYWAAAAAGADAVDGASAPLSGTTSQPSLSAIVAAFDNTYRSTGLSLDAVGSLEPYW
FT                   EAVRKLYAPFESGTPGPTGRVYLHEIPGGQLSNLRAQATALGLADRFELIEDTYAAVNE
FT                   MLGRPTKVTPSSKVVGDLALYLVGAGVDPKDFAADPQKYDIPDSVIAFLRGELGTPPGG
FT                   WPEELRNKALSGRKESKDTLAELPAEEAAALADQATVRGTLDRLLFPKPAQEFSEHRRQ
FT                   FGDTTKLGDAEFLYGLVEGKETVIHTADNNVPMIVRLDAVGEPDEKGMRNVVCNVNGQI
FT                   RPILVRDRSVESITASAEKADTANVGHVAAPFSGVVTVTAEPGANVAAGDPVAVIEAMK
FT                   MEATISATKDGTIERIVMTQPTKVEGGDLLLVIS"
FT   gene            complement(493987..495444)
FT                   /locus_tag="CPFRC_02410"
FT                   /old_locus_tag="cpfrc_00479"
FT   CDS_pept        complement(493987..495444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02410"
FT                   /old_locus_tag="cpfrc_00479"
FT                   /product="DHA2 family efflux MFS transporter permease
FT                   subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00479"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28272"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241335.1"
FT                   /protein_id="ADK28272.1"
FT                   /translation="MATSSQRIPEPSQAHVSSKPRVGLILGVVVVAAMIMILNETVLSV
FT                   ALPSIMADFGVTADVVQWLATGFLLTMSVVIPATGFLLQRFTTRMNFLTAVGLFILGTL
FT                   MCAIAPVFWVLVAGRIVQAMGTAIVLPLLMTMTITLVEPAKRGTMMGINSIVISVAPAF
FT                   GPTLSGFILNSLSWHWLFWVVIPVAGAVFILGFIVVTNVQDVSRVPFDIASLALSALAF
FT                   GGIIYGFSTIRELVDAHWPPAAVFLIGLTSLAFFVRRQLRLAQSGRALLDMSPFTIRNF
FT                   VLSTIVLMLGLTALLGMVNVIPIYLQEGIGVSALTTGLALLPGGLFQGLVSPFIGRIYD
FT                   RVGPRPLVIPGAVFMFVSMVVATLMFTAEASVMIVVVVHCLFCVGLAFVMTPLMTVSLS
FT                   SLPSRLYGHGSAIVNTLQQLGGAMGTAVMIGIMTIVAMRSTAAPAIAQSEGTTTAFVAG
FT                   TVFAGLILVTSLFITPVTVKVHVSKTE"
FT   gene            complement(495555..495941)
FT                   /locus_tag="CPFRC_02415"
FT                   /old_locus_tag="cpfrc_00480"
FT   CDS_pept        complement(495555..495941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02415"
FT                   /old_locus_tag="cpfrc_00480"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28273"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836054.1"
FT                   /protein_id="ADK28273.1"
FT                   /translation="MEPTDINGGRFYARPLHNDDRIDDTPAIRLIDAHFDVDQAHHRWH
FT                   DNSMYSWAVCEQTNIDMIALAVLHLTTTEHGLSGILDIAPAGDPARELPNDPILDQKTV
FT                   GDGVHEIRGPIERWCEAHGITLTR"
FT   gene            complement(496058..497833)
FT                   /locus_tag="CPFRC_02420"
FT                   /old_locus_tag="cpfrc_00481"
FT   CDS_pept        complement(496058..497833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02420"
FT                   /old_locus_tag="cpfrc_00481"
FT                   /product="ATP-grasp domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28274"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599932.1"
FT                   /protein_id="ADK28274.1"
FT                   /translation="MSVEQKKITKVLVANRGEIAIRVIRAARDAGIPSVAVYAEPDAEA
FT                   PFVSLADEAFALGGQTSAESYLVVEKILDAARKSGANAIHPGYGFLSENGDFAEAVIEA
FT                   GLIWIGPSPQSIRDLGDKVTARHIALKADAPMAPGTKEPVKNAAEVVAFAEEHGLPIAI
FT                   KAAFGGGGRGMKVAYTMDEVADLYESATREAVSAFGRGECFVERYLDKARHVECQVIAD
FT                   QHGNVVVAGTRDCSLQRRFQKLVEEAPAPFLTDQQRTSLHESAKRICREAGYYGAGTVE
FT                   YLVGADGLISFLEVNTRLQVEHPVTEVTTGLDLVREQFRIAEGHELHIKEDPTPRGHAF
FT                   EFRINGEDAGSNFMPAPGKITKYVEPSGPGVRMDSGIVEGSVIGGQFDSMLAKLIVYGE
FT                   TRDEALQRARRALSEYVVEGMPTVLPFHRHIVENPAFVGNDSGFDVYTKWIEEEWDNPI
FT                   PAYVDPADVAEDEEATPSQKVVVEIDGRRVEIALPGDLALGGAGGVKKKAKKRRAGGSK
FT                   AAVSGDAVAAPMQGTVIKVNVEEGAEVAEGDTVVVLEAMKMENPVKAHKSGTVTGLVAA
FT                   AGEGVTKGQVLLEIK"
FT   gene            complement(498078..498956)
FT                   /locus_tag="CPFRC_02425"
FT                   /old_locus_tag="cpfrc_00482"
FT   CDS_pept        complement(498078..498956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02425"
FT                   /old_locus_tag="cpfrc_00482"
FT                   /product="sulfurtransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00482"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28275"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366587.1"
FT                   /protein_id="ADK28275.1"
FT                   /translation="MPAPYDPHPLFQDYAHPEKLVSASWLSARLGTKGLRVVESDEDSL
FT                   LYDIGHIPGAVRIDWAKDLNNKTIRDYITGEDFAALMSAKGIARDDTVVIYGDKSNWWA
FT                   AFTLWIFELFGHEDVRILNGGRDAWMAEERDTSYAVPEYPATDYPVIKRADHPDRIYVQ
FT                   ELLEKLGTPKLIDVRSPEEYNGTADADSPSSGVLRRGHVPTAVNIPWEKSVHPNSRFRS
FT                   AEELSALYAEIPKDAETVVYCQVGDRAAHTWFVLKHLLGYDFVRNYDGSWAEWGNMVKM
FT                   PIATGDEPGQV"
FT   gene            499675..500753
FT                   /pseudo
FT                   /locus_tag="CPFRC_02430"
FT                   /old_locus_tag="cpfrc_00484"
FT   CDS_pept        499675..500753
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02430"
FT                   /old_locus_tag="cpfrc_00484"
FT                   /product="Cj0069 family protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00484"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28277"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800100.1"
FT   gene            501044..503158
FT                   /locus_tag="CPFRC_02435"
FT                   /old_locus_tag="cpfrc_00485"
FT   CDS_pept        501044..503158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02435"
FT                   /old_locus_tag="cpfrc_00485"
FT                   /product="acyltransferase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28278"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523092.1"
FT                   /protein_id="ADK28278.1"
FT                   /translation="MAAGTTQQSKAKATKYRFDLDGLRGIAIAFVVIFHVFVGRVSGGV
FT                   DVFLLLSGYFFLGSQLRYATKPNASLNPWWPVWRTIRRLFPALLVTLMSTILAVHLWIL
FT                   ELRTTNLSDQLLACIGYFQNWELATQGAAYGAASSTTSPLQHLWSMAVQGQFYLMAIAF
FT                   AWVLAVGIKLMHRRRRVVTTLRLAAGIPLILVTIGSFGYAVYLHWQDQSLNYYSTWSRL
FT                   WELSLGAVLVLYAEKLRLTQRLSVAFTYLGLLMVVSTGLLFDGAALFPGPAALFPLGGA
FT                   TLVILGGGQGASWLSNRFMLWLGKIAYPLYLWHWPILIVSTAYLGEKRPSVALGLGVVV
FT                   VSILLAQITHVFIEEPFKQHAKRPVSLEGRSRAAVASLSTPSGSIRAVAGLCVATLCGT
FT                   AVWIPSVWQEEIDRVSGTQLNPTLYPGAAALKGVRVPNVPFEPDPFVLANTLSPAWTDG
FT                   CISLLGDDPEVIANDKLGPDHCLYGDIHAKKVAYLVGGSHAEQWMAAWDEIGKQHGIKI
FT                   VPFVRQGCPIYEEEKDDVFSQECTTFNQKVIERIKEDRPNLVISNSTRPLLEKGHSQDE
FT                   VPQSYPTFWEFLKKEKIPFIGLRDNPWFVLAEGEGWMVSQCVENGGSIEECGLPRSQVY
FT                   ADTDPSQKFFTTDSMLSVDTADWFCPDDFCPAVIGNIYVYRDGNHISDAYALSLVPLLW
FT                   AQIGTFVGKV"
FT   gene            complement(503196..503612)
FT                   /locus_tag="CPFRC_02440"
FT                   /old_locus_tag="cpfrc_00486"
FT   CDS_pept        complement(503196..503612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02440"
FT                   /old_locus_tag="cpfrc_00486"
FT                   /product="DUF3151 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00486"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28279"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241342.1"
FT                   /protein_id="ADK28279.1"
FT                   /translation="MTQFNDMLAPPPVMLPEDEAAAEPEITAAVVLRHPASPLAWALLA
FT                   ESRLDAITTTDADALAAAYAFARTGYHRSLDRLRAHGWKGWGPVPYSHEPNRGVLRAIA
FT                   ALARASQLIGDQSEYDRCRQMLSDADPESVATLL"
FT   gene            complement(503617..504246)
FT                   /locus_tag="CPFRC_02445"
FT                   /old_locus_tag="cpfrc_00487"
FT   CDS_pept        complement(503617..504246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02445"
FT                   /old_locus_tag="cpfrc_00487"
FT                   /product="septum formation inhibitor Maf"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00487"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28280"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366591.1"
FT                   /protein_id="ADK28280.1"
FT                   /translation="MRIVLASASPSRRAILRSAGVDPIIDPAEIDEDSLLEQCQGQQPE
FT                   DIVAQLATAKAHAVASRHPGDVVIGGDSMLLLDGKLQGKPHTVERTIQRWLEQRGRTAH
FT                   LITGHCIINGAAGGASTSYQHVETSVTKIRFAPASDSDIEAYARTEEPLQCAGAFTLEA
FT                   LGGWFIDAIDGDPSSVIGLSLPVVRRALYSFGLNVSDFWNIQILEE"
FT   gene            complement(504266..505168)
FT                   /locus_tag="CPFRC_02450"
FT                   /old_locus_tag="cpfrc_00488"
FT   CDS_pept        complement(504266..505168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02450"
FT                   /old_locus_tag="cpfrc_00488"
FT                   /product="ribokinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00488"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28281"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525408.1"
FT                   /protein_id="ADK28281.1"
FT                   /translation="MLKTVAVIGSINADLSVRVHRPPTPGETVLGMDSSISPGGKGANQ
FT                   AVAAALQGAKVVFIGAVGKDSYAEPAMELLRASSVSLEHVSAVDGPTGSAVITVSDDGE
FT                   NSIIVIPGANAAVDAAYVAKNAEAIAGADIVLLQGEIPADGFLEAIKAATGRIVVNLAP
FT                   VISVDREALLKADPLMANEHEANLILEQLGSSISSDDPHELAQELLAQGFASVVLTLGS
FT                   KGALVADPQASVIVPSPKVTAVDTTGAGDAFAGAFVAQLLSGASSVEAAQHAVRVAAYA
FT                   VQYRGTQVSYPNAGAELPR"
FT   gene            complement(505236..506270)
FT                   /locus_tag="CPFRC_02455"
FT                   /old_locus_tag="cpfrc_00489"
FT   CDS_pept        complement(505236..506270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02455"
FT                   /old_locus_tag="cpfrc_00489"
FT                   /product="substrate-binding domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00489"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28282"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241345.1"
FT                   /protein_id="ADK28282.1"
FT                   /translation="MEAPRTPSTSYPRRRRQSTTLKDIAAETGFSISTVSRALAHNPVI
FT                   PEPTRTIVAETAKRLNYRPNAQAKALRNQKTNLIGVLLPNICNPYFNTLAFEIQQAARA
FT                   KGYSTILSNTDESPSVLNGALDTMNSQQVDGIIVVPHIQSAEKITELANAGVPIVAADR
FT                   SVLGSSVPSVTSDPLPAMKEAIRLLSLNNHAKIGYLAGPQDTSTGRVRLEAITSIKEDL
FT                   RIPSPDVYFGGYHYDAGRAGTLELLDRGVNSILTGDMMMAVGALSAIYSRKLKIGKDVA
FT                   LIGFDNAAVFTLQESPLTVIDQQVETIGQKAFELLYSIMKNDTMPDSVVVPTVLKVRDS
FT                   HTLT"
FT   gene            complement(506450..506698)
FT                   /locus_tag="CPFRC_02460"
FT                   /old_locus_tag="cpfrc_00490"
FT   CDS_pept        complement(506450..506698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02460"
FT                   /old_locus_tag="cpfrc_00490"
FT                   /product="acyl-CoA carboxylase subunit epsilon"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28283"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910923.1"
FT                   /protein_id="ADK28283.1"
FT                   /translation="MSDTSTTTAEAAPAKKPFLTVVKGNPDNVQVAAITTVIASLAQDA
FT                   EKAAAKDRDRNLWGNVEERLQRPTTYNPTAFRNVSFY"
FT   gene            complement(506800..508431)
FT                   /locus_tag="CPFRC_02465"
FT                   /old_locus_tag="cpfrc_00491"
FT   CDS_pept        complement(506800..508431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02465"
FT                   /old_locus_tag="cpfrc_00491"
FT                   /product="methylmalonyl-CoA carboxyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28284"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_006769581.1"
FT                   /protein_id="ADK28284.1"
FT                   /translation="MTAATINGQGASAPDLTTTAGKLADLRSRLAETVAPMGPASIEKV
FT                   HAAGKKTARERIEYLLDDNSFVEVDALARHRSKNFGLDAKRPVTDGVVTGYGTIDGRKV
FT                   CVFSQDGAVFGGALGEVYGEKIVKIMDLAIKTGVPLIGINEGAGARIQEGVVSLGLYSK
FT                   IFYRNTLASGVIPQISLIMGACAGGHVYSPALTDFIIMVDKTSKMFITGPDVIKTVTGE
FT                   EVTQEELGGAHTHMSTSGTSHYTASDDADALDWVRDLVGFLPSNNRAEAPREAADLMVG
FT                   SIQENITESDLELDTLIPDSPNQPYDMKDVISRIVDDGDFFEVQEHYAGNIIIGFGRVE
FT                   GRSVGIVANQPTEFAGCLDIKASEKAARFIRTCDAFNVPIIEFVDVPGFLPGTSQEYDG
FT                   IIRRGAKLLYAYSEASVGKITVITRKSYGGAYCVMGSKDMGADIVLAWPTAQIAVMGAS
FT                   GAVGFIYRKELKNAAANGQDVVALAKEYEKEYEETLVNPYMAAERGYVDAVIPPSETRG
FT                   QIIEGLRLLDRKVINMPAKKHGNIPL"
FT   gene            complement(508693..510324)
FT                   /locus_tag="CPFRC_02470"
FT                   /old_locus_tag="cpfrc_00492"
FT   CDS_pept        complement(508693..510324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02470"
FT                   /old_locus_tag="cpfrc_00492"
FT                   /product="methylmalonyl-CoA carboxyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00492"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28285"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599940.1"
FT                   /protein_id="ADK28285.2"
FT                   /translation="MTLSSPFVDVAALKDMTTTAGKIADFKARRAEAGQPMGTKALDKV
FT                   KQAGRLTARERLDYLLDEGSFIETDQLARHRTFDFGMHKKRPVTDGIVTGWGTIDGREV
FT                   CIFSQDGTVFGGALGEVYGEKMIKIMKLAVATGRPLIGLYEGAGARIQDGAVSLDLIAQ
FT                   TFYHNINASGVVPQISVIMGSCAGGNAYSPALTDFVVMVDQTSKMFVTGPDVIKTVTGE
FT                   IISQEELGGANTHMSAAGNSHFTAANDEEALDFVQDLVSFLPSNNRSVTPREDYDQEAG
FT                   SIEDNLTPDDLRLDHIIPDSPSIPYDVRSVIESLTDDGGYLEIQADRAENVVVAFGRIE
FT                   GESVGFVANQPTQFAGCLDIDASEKAARFIRTCDAFNVPIVMLVDVPGFLPGAGQEHNG
FT                   ILRRGAKLLYAYGEATVPKITVTMRKAYGGAYCVMGSKGLGADVNLAWPTAQIAVMGAA
FT                   GAVGFLHRRELIAAAENGDDVVALSEALEREYEDHMLNPYLAAERGLIDAVILPSETRG
FT                   HISRNLRLLKNKHVQRPARKHGNIPL"
FT   gene            510600..511445
FT                   /locus_tag="CPFRC_02475"
FT                   /old_locus_tag="cpfrc_00494"
FT   CDS_pept        510600..511445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02475"
FT                   /old_locus_tag="cpfrc_00494"
FT                   /product="biotin--[acetyl-CoA-carboxylase] ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00494"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28287"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241350.1"
FT                   /protein_id="ADK28287.1"
FT                   /translation="MDKDAAQSALVESDGGSRDSRTPLNVEWLREQLVVDGPFASILHS
FT                   ATTGSTNTDLVAAAHEGAPAWTVFLTEHQTLGRGRMGRRYEAPAGAQLTLSVLIRPPRE
FT                   SVFRLGTMPLATGLALIDALKGAEGVGLKWPNDLLREGRKLCGILAEAVSLGEEPAVVI
FT                   GLGLNTSLTREELPVPHTTSLELEGIPYERNELAVRVLTALHRRLRQWEDNDPTLMAEY
FT                   RQVCTSIGADVRVVLSENEELLGVAESVSDAGLICVRDSQGELHELMAGDVTHLRLQDK
FT                   "
FT   gene            511446..511916
FT                   /locus_tag="CPFRC_02480"
FT                   /old_locus_tag="cpfrc_00495"
FT   CDS_pept        511446..511916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02480"
FT                   /old_locus_tag="cpfrc_00495"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28288"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800108.1"
FT                   /protein_id="ADK28288.1"
FT                   /translation="MARVRVLPDEIVRVDVTRSLVSLIYPVCELLLITGVCWMLIGYLD
FT                   RDPQDSVQLRNAVVGLWAALALWRFALPVLRARKERVIVTDQRVILRAQGIMGVSESIP
FT                   LRAVRHVGRKRKNISLAVSGYQRPIMLINVAKAKHVVASIEEGMNQGRGYWG"
FT   gene            511970..513175
FT                   /locus_tag="CPFRC_02485"
FT                   /old_locus_tag="cpfrc_00496"
FT   CDS_pept        511970..513175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02485"
FT                   /old_locus_tag="cpfrc_00496"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide
FT                   synthase"
FT                   /EC_number="6.3.4.18"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00496"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28289"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366597.1"
FT                   /protein_id="ADK28289.1"
FT                   /translation="MTHSNGNPAAHAPDMPILCVIGDGQLARMMHTEAIELGQSIRVLA
FT                   SSHDSSAAQVTADVIIGDYTNLDDLRRVVAGSNAVTFDHEHVPSEHLRTLIAEGYNVQP
FT                   QPDALLNAQDKLVMRTRLKEMGAPVPPFAPITSVEDARAFWESVDGQVCVKARRGGYDG
FT                   HGVWFPDSAMELEELVDKLLSAGTPLMGEKKVQLVRELSAMVARTPSGEAQSWPVVESV
FT                   QTDGICTEAVAPAPGLGEELEHQCRELSIRIATELGVTGALAVELFETRGEDGQSEIFV
FT                   NELAMRPHNTGHWTQDGCVTSQFEQHIRAVLDYPLGATDLTAPVTVMANILGAATDPAQ
FT                   PMGERVAEVMRRFPNAKVHLYGKTYRAGRKIGHVNLTGTDVETTRADARLAAQYLAHAT
FT                   WA"
FT   gene            513216..513716
FT                   /gene="purE"
FT                   /locus_tag="CPFRC_02490"
FT                   /old_locus_tag="cpfrc_00497"
FT   CDS_pept        513216..513716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="CPFRC_02490"
FT                   /old_locus_tag="cpfrc_00497"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide mutase"
FT                   /EC_number="4.1.1.21"
FT                   /EC_number="5.4.99.18"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00497"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28290"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014319882.1"
FT                   /protein_id="ADK28290.1"
FT                   /translation="MSPLVGLIMGSDSDWPTVQPAAETLAEFGIPFEVGVVSAHRTPEK
FT                   MLAYAKSAHTRGLKAIIACAGGAAHLPGMVAAATPLPVIGIPRALKDLDGMDSLLSIVQ
FT                   MPGGVPVATVSIGGAKNAGLLAVRILSAGDPALTEKMVAYQDAMREEVEQKDANLKRQL
FT                   MGE"
FT   gene            513722..514189
FT                   /locus_tag="CPFRC_02495"
FT                   /old_locus_tag="cpfrc_00498"
FT   CDS_pept        513722..514189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02495"
FT                   /old_locus_tag="cpfrc_00498"
FT                   /product="YdcF family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00498"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28291"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522798.1"
FT                   /protein_id="ADK28291.1"
FT                   /translation="MSADCRKESTILTLGSKVRGAEPGHVLLWRLQHALELSQQTSGPV
FT                   VVSGKGEAAVMGDWLVRHGLDPHRLIIEPEATSTNENLENAHALLPETHTWIVVTSDFH
FT                   KLRTLAWARHLGIPITVSSAVTKPPFRVRNFVREIFALPHSLLRIAWRRVA"
FT   gene            complement(514251..514454)
FT                   /locus_tag="CPFRC_02500"
FT                   /old_locus_tag="cpfrc_00499"
FT   CDS_pept        complement(514251..514454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02500"
FT                   /old_locus_tag="cpfrc_00499"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00499"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28292"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241355.1"
FT                   /protein_id="ADK28292.1"
FT                   /translation="MKPRDTQPQETRKKLVRDSVLGFVGFFAFLSLVQAVVNLFQPQPS
FT                   LWPAFLALILVIATIALWRAWR"
FT   gene            complement(514494..515330)
FT                   /locus_tag="CPFRC_02505"
FT                   /old_locus_tag="cpfrc_00500"
FT   CDS_pept        complement(514494..515330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02505"
FT                   /old_locus_tag="cpfrc_00500"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28293"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525421.1"
FT                   /protein_id="ADK28293.1"
FT                   /translation="MNHKIRATLGNYIGVVFILIWGLAPFYWMLITALRNKDYTFETTP
FT                   WPTHVTLENFRDALSTDKGNDFLGAIINSLLVGLATTILAVLVGVFTAYALARIEFRGK
FT                   GIVTGVVLAASMFPGIALVTPLFQLFGNLGWIGTYRALIIPNISFALPLTIYTLVSFFR
FT                   QLPWELEEAALVDGATRSQAFRHVLLPLAAPALFTTAILAFIATWNEFMLARQLSTTAT
FT                   EPVTVAIARFSGPSAFEFPYAAIMAAGSLVTIPLIIMVLAFQRRIVSGLTAGGVKA"
FT   gene            complement(515327..516368)
FT                   /pseudo
FT                   /locus_tag="CPFRC_02510"
FT                   /old_locus_tag="cpfrc_00501"
FT   CDS_pept        complement(515327..516368)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02510"
FT                   /old_locus_tag="cpfrc_00501"
FT                   /product="ABC transporter permease subunit"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28294"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_006769568.1"
FT   gene            complement(516591..517850)
FT                   /locus_tag="CPFRC_02515"
FT                   /old_locus_tag="cpfrc_00502"
FT   CDS_pept        complement(516591..517850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02515"
FT                   /old_locus_tag="cpfrc_00502"
FT                   /product="extracellular solute-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00502"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28295"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836070.1"
FT                   /protein_id="ADK28295.2"
FT                   /translation="MNVSKTGASLAATALFASAALAGCSSDSSAPAPQNTDGRGPITFA
FT                   MGKNDTDKVIPIIEKWNSSHPEEKVTLKELAGETDDQRETLVQSLQAGNSDYDVMALDV
FT                   VWTADFAANQWLAPLKDDLKVDTSGLLKATVESATYNGTLYALPQNTNGQLLFRNTEIV
FT                   PEAPTTWKDLTASCEAAKAKHVDCLTTQLKQYEGLTVNTAGFIEGWGGHILDDSGAPAV
FT                   DSEDSKAGVQALVDAYKDGSISKNSISATEEETNLAFVAGETAYAINWPYMYTNAAEAT
FT                   SAVKGKFEVSPLVGKDGVGVSTLGGYNNGINVNSKNKATARDFIKFIVNEDNQKSFADN
FT                   SFPPVLASIYDDESLVAKYPYLPALKKSLENAAPRPVSPFYPAISKAIQDNAYAALKGD
FT                   KNVEEATKDMRAAIQNASKK"
FT   gene            complement(518009..518686)
FT                   /locus_tag="CPFRC_02520"
FT                   /old_locus_tag="cpfrc_00503"
FT   CDS_pept        complement(518009..518686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02520"
FT                   /old_locus_tag="cpfrc_00503"
FT                   /product="TIGR03089 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00503"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28296"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800113.1"
FT                   /protein_id="ADK28296.2"
FT                   /translation="MELLRNLLSSDPAAPRLTVYNESTGARLDFSAQTLDNWAAKVANM
FT                   MREELDLDQGSLISLDLPASWQCVAIVLGAMAAEIEVEFCPIEQAQGAVAFVAPERIDA
FT                   SPAFPGDVVLVTQDPFGRGVVECEGTVPDGMIDFGPTVRFYGDQFFEPGTRIEESVDKQ
FT                   VYAELPSGSRALSTGWTTFAEMQRTVLAPLAVGGSAVVVTGVASDQRLEAIGRAEKATM
FT                   RLS"
FT   gene            complement(518803..520371)
FT                   /locus_tag="CPFRC_02525"
FT                   /old_locus_tag="cpfrc_00504"
FT   CDS_pept        complement(518803..520371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02525"
FT                   /old_locus_tag="cpfrc_00504"
FT                   /product="LytR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00504"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28297"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523097.1"
FT                   /protein_id="ADK28297.1"
FT                   /translation="MTDKYRRNRDIQAPPSVMPDTKQMGPRPVKIFLALISSIVLVISG
FT                   AGYFTIGKLGNTVASAGNLSLGGDKGMKEAADGATDILLVGSDSRTDAQGNPLSPQEIE
FT                   LLHAGDEENDNTDTIMVIRIPNDGSSATAISIPRDTYVHDNNLGNLKINGVYKNYKDKE
FT                   ATKLLSEGIGDRKTLDERSKQAGRQALISAVSDLTGITVDHYAEVGLLGFVLLTEAVGG
FT                   VEVCLNNSVKDEYSGADFGAGRQTLKGGQALAFVRQRHGLPRGDLDRIVRQQAFMASLV
FT                   NKVLSSGTLTNPQKLADMGKAVERSVVIDQNWDVMSFANQLQNLAGGNVRFNTIPVTSI
FT                   DGTGDYGESVVTVDVQQVHKFFDQLLNGGPKEEPSSQTSSESAAPTARQNITVDVLNAT
FT                   TTSGLAAEVAGYLKTKGHTIAETGNAPQGLYSHSQILATDPESEDAKRLSQELGNIPVV
FT                   QHNGLDLNSYVVVAASDYAGPKSTESATSTSTTTSVVGQPGADEGQAIVSPEIDAGGNG
FT                   PRCVN"
FT   gene            520488..521438
FT                   /locus_tag="CPFRC_02530"
FT                   /old_locus_tag="cpfrc_00505"
FT   CDS_pept        520488..521438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02530"
FT                   /old_locus_tag="cpfrc_00505"
FT                   /product="glycosyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28298"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014732909.1"
FT                   /protein_id="ADK28298.1"
FT                   /translation="MNKSVADIDSQICPTKLKRVTTTDAKPIAVITVTFSPGDHLAAFL
FT                   DSVSGATVRGAYTVLADNGSTDGTPQAAAKERDNVEFFATGGNIGYGSAINAAARHLKD
FT                   KRLNGDIEPEFFVLANPDVVFDKGSIDVMLECAQRWPQAGAVGPYIRQSDGSAYPSARA
FT                   IPTLSNGIGHALFGAVWPNNPWTKAYKDDADMSTERTAGWLSGSCLLVRWDAFDAIGGF
FT                   DERYFMYMEDVDLGDRFGRAGFDNVLCPSSFITHAVGHAAGKHPEKMLPAHHESAYRFQ
FT                   ADRHPHAWQLPIRVVLKLGLQARAFVAVASAKLKK"
FT   gene            521613..522701
FT                   /locus_tag="CPFRC_02535"
FT                   /old_locus_tag="cpfrc_00506"
FT   CDS_pept        521613..522701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02535"
FT                   /old_locus_tag="cpfrc_00506"
FT                   /product="NTP transferase domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00506"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28299"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366605.1"
FT                   /protein_id="ADK28299.1"
FT                   /translation="MTTTTLRGNTDAVILVGGKGTRLRPLTVSTPKPMLPTAGVPFLSH
FT                   LLARIKAAGIKHVVLGTSFKAEVFEEYFGNGEDLGLEIEYVVEDKPLGTGGGIRNVYEK
FT                   LRADTVMVFNGDVLGGTDLGGILDAHHEKQADLTMHLVRVPDPRAFGCVPTDQDGRVSA
FT                   FLEKTEDPPTDQINAGCYVFRRELIESIPADRVVSVERETFPKLLEEGRRVFGYVDNAY
FT                   WRDMGTPADFVRGSSDLVRGIAPSPLLDGRTGESLIDESAGVKDGALLLGGTVIGRGTE
FT                   VGAGCRLDDTVVFDGVTIEPGAVIEDSIIAHGVRIGANARIKGCVIGEGAQIGARCELL
FT                   NGLRVWPGVEIPTAGIRFSSDA"
FT   gene            complement(522899..523201)
FT                   /locus_tag="CPFRC_02540"
FT   CDS_pept        complement(522899..523201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02540"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366606.1"
FT                   /protein_id="QGW57316.1"
FT                   /translation="MMFTYASAYARKSRQLTTRHIDSQHTHAELAGYVQPYKKTMQRIT
FT                   YLKFNTPTQDVVNPKTVFPVQKMNFPSSQTSRVTSFTQHISRGRGSGVLDIVSLI"
FT   gene            523229..523519
FT                   /locus_tag="CPFRC_02545"
FT                   /old_locus_tag="cpfrc_00507"
FT   CDS_pept        523229..523519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02545"
FT                   /old_locus_tag="cpfrc_00507"
FT                   /product="WhiB family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00507"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28300"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241363.1"
FT                   /protein_id="ADK28300.1"
FT                   /translation="MASNAAPRTRTPLELTLDDLFGAVEQEWQEQALCAQTDPEAFFPE
FT                   KGGSTREAKRICQACAVRDECLEYALEHDERFGIWGGLSERERRRLKRDIG"
FT   gene            complement(523623..524078)
FT                   /locus_tag="CPFRC_02550"
FT                   /old_locus_tag="cpfrc_00508"
FT   CDS_pept        complement(523623..524078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02550"
FT                   /old_locus_tag="cpfrc_00508"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00508"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28301"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910944.1"
FT                   /protein_id="ADK28301.1"
FT                   /translation="MDYRLNRDRHGRGLRGPTFPTAVPRYRSRRSLFDAAVLEAYAPIQ
FT                   QSFAQQLANLDIAVDTVPRMRLNLDAALLPDEVAADGPIPLGRVIPAGIDHLGRPTRAR
FT                   IVLFRMPIEQRTNSTQERQELLTMVLTSLVANYLNVSPTDIDPDFQW"
FT   gene            524173..524574
FT                   /locus_tag="CPFRC_02555"
FT                   /old_locus_tag="cpfrc_00509"
FT   CDS_pept        524173..524574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02555"
FT                   /old_locus_tag="cpfrc_00509"
FT                   /product="DUF3499 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00509"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28302"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241365.1"
FT                   /protein_id="ADK28302.1"
FT                   /translation="MDVNQFRRCSRPGCGKPAVATLTYAYAHSTAVVGPLAPNSDPHSW
FT                   DLCEFHASKITAPLGWELLRVDAVDDDDEDLTALAEAVREAGRTTSGLIDSNQDFGVNH
FT                   PVHRAQRKQVSKNTKRGHLSVVPDPEDDC"
FT   gene            524761..526140
FT                   /locus_tag="CPFRC_02560"
FT                   /old_locus_tag="cpfrc_00510"
FT   CDS_pept        524761..526140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02560"
FT                   /old_locus_tag="cpfrc_00510"
FT                   /product="phosphomannomutase/phosphoglucomutase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28303"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366609.1"
FT                   /protein_id="ADK28303.1"
FT                   /translation="MRTRESVTKVIKAYDVRGVVGVDIDADFIREVGSAFGHLMRNEGA
FT                   TKVAVGHDMRPSSPELTQAFADGLTAQGVDVVALGLTSTDQLYYASGVMDCPGAMFTAS
FT                   HNPAEYNGIKMCRSGARPVGQETGLGAIIDMLVEGVPAYDGKPGAITQKDTLADYGSFL
FT                   RELVDLSGIRPLVVAVDAANGMGGHTVPEVFAGLPLDVKPLYFELDGTFPNHEANPLDP
FT                   KNLVDLQKFTPEVKADIGLAFDGDADRCFVVDENGDPVSPSAICAIVAERYLAQHPGST
FT                   IIHNLITSKTVPEVIAENGGVAVRTRVGHSFIKAQMAEHGAAFGGEHSAHYYFSEFFNA
FT                   DSGILAAMHVLAALGGQDKPLSELMKEYSRYAASGEINSRLASAEEQAERTQAVLDAFA
FT                   DRTESVDRLDGVTVELQGTKAWFNVRASNTEPLLRLNVEAPTAEEVDALVTEILGVIRQ
FT                   Q"
FT   gene            526278..527264
FT                   /locus_tag="CPFRC_02565"
FT                   /old_locus_tag="cpfrc_00511"
FT   CDS_pept        526278..527264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02565"
FT                   /old_locus_tag="cpfrc_00511"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28304"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366610.1"
FT                   /protein_id="ADK28304.1"
FT                   /translation="MNTQEIFHDSESAAVPTHSYDPEAVAFYDIAHEGAQLRVVAEFVR
FT                   SGGLDAVQGTQPRSVVVVTTEAIATHSAHVSIALHAPLKVPVIVTAELPRYVGPLDIVI
FT                   VATERSSSEHLSQALTTAMRRGCMVILVSASGGMLHKDAAQEAIVVPSLPLIEGPSPLR
FT                   IIAVVMAVLALLEQDQERTATVLEESASHVDAEIMQCSPEYGENANRARQLAQITGHII
FT                   HTGTTASAVAVANLIAVLWTSYGKESTSLPATELGAALGRFSYAVKDIFFDPELDKAPT
FT                   GQSLKTIAWCEPEPDAWERTEHIDAGSTGTPLRMIARGFAATAFISS"
FT   gene            527320..528477
FT                   /gene="manA"
FT                   /locus_tag="CPFRC_02570"
FT                   /old_locus_tag="cpfrc_00512"
FT   CDS_pept        527320..528477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="CPFRC_02570"
FT                   /old_locus_tag="cpfrc_00512"
FT                   /product="mannose-6-phosphate isomerase, class I"
FT                   /EC_number="5.3.1.8"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00512"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28305"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836074.1"
FT                   /protein_id="ADK28305.1"
FT                   /translation="MQLLSPSAQAYAWGSRTLIQNLRGEEQGTSPIAELWYGAHPGGPS
FT                   KIGDESLAEHIAAAPEQQLGHRVHSEFGERLPFLLKILAADQPLSLQAHPSLEQAQEGF
FT                   ARDNEQGIQLGAHNRNYKDDNHKPELLIALTEFHAMAGFRPLAKTLEMLRFLDCEELER
FT                   YIAMVVDNPLKESDSLRALFTTWITIPTANRRDLIVAVVSSAKEKAESAPEWMSAALKN
FT                   IVLLNEQYPGDVGVLGAILLNYVVLQPGEAIYLDAGNLHAYVRGLGVEIMANSDNVLRG
FT                   GLTSKHVDVPELVRVLKFASLENPIVEAESGVYPVPINEFAIKRIDLDKTAEKIAHDGP
FT                   AILLCTAGTVEVGGVTLNPTQALWLSAADAEVEARGQGQLFVATV"
FT   gene            complement(528547..529314)
FT                   /locus_tag="CPFRC_02575"
FT                   /old_locus_tag="cpfrc_00513"
FT   CDS_pept        complement(528547..529314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02575"
FT                   /old_locus_tag="cpfrc_00513"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00513"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28306"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241369.1"
FT                   /protein_id="ADK28306.1"
FT                   /translation="MDNTYTRRFLLFIAAGTTLAIAIGILVWKLGSPQTTASNATSDAG
FT                   PQKLEEAAVTSSASVAPQPQSSAPAPADSSPQEDPYVVRTQYPIAPNRVPHVRHDPLMP
FT                   PNAHLGSGKPRPPTTTVAVPTTPQEQTTIAIPEIDTPTLDDPAEETPQNQSSQPHPPTV
FT                   PVSEGSSANPAQSTEKPDQNTSSTSTEPSPAPTEIITEPTAPLVDPSTVQKMLGSAGTL
FT                   LSPQEEPHPTAAKETEPKPEAPAQNTEKVVLQP"
FT   gene            529937..530290
FT                   /locus_tag="CPFRC_02580"
FT                   /old_locus_tag="cpfrc_00515"
FT   CDS_pept        529937..530290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02580"
FT                   /old_locus_tag="cpfrc_00515"
FT                   /product="DUF4259 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28308"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910950.1"
FT                   /protein_id="ADK28308.1"
FT                   /translation="MSTWEREIFSEEVNVDFLDELNDLDSDDVVEAVRDACVLATGTGR
FT                   VSEDEQLNGLAAATIAAIWAGAPFSDGDLVSTYPFIREYIGEGDEALHESAAKLLEEAD
FT                   TEEDLEAFLEALS"
FT   gene            530482..531921
FT                   /locus_tag="CPFRC_02585"
FT                   /old_locus_tag="cpfrc_00516"
FT   CDS_pept        530482..531921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02585"
FT                   /old_locus_tag="cpfrc_00516"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00516"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28309"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910951.1"
FT                   /protein_id="ADK28309.1"
FT                   /translation="MTSFDFKVKDLSLAEAGRHQIRLAEYEMPGLMQLREEYREEQPLA
FT                   GARITGSIHMTVQTAVLIETLVALGAEVRWASCNIFSTQDEAAAAVVVGPEGTVDNPQG
FT                   VPVFAWKGETLQEYWDCVHKIFAWPGDQLPNMILDDGGDATMAVIRGQQYEQAGVVPPG
FT                   EEGDSDEYQAFLEMLRATLESDPGMWTAIASSVKGVTEETTTGVHRLYHFAEEGVLPFP
FT                   AMNVNDAVTKSKFDNKYGTRHSLIDGINRATDMLMGGKNVLICGYGDVGKGCAEAMAGQ
FT                   GARVKVTEADPINALQALMDGFPVVTVDQAISEADIVITATGNMGIISFEQMLKMKDHA
FT                   VLGNIGHFDNEIDMASLLHRNDVSRVTIKPQVDEFTLPNGNAIIVLSEGRLLNLGNATG
FT                   HPSFVMSTSFADQTIAQIELFQNDGRYRNEVYRLPKILDEKVARIHVEALGGEITELTK
FT                   EQAEYIGVDVAGPYKPEHYRY"
FT   gene            531921..532541
FT                   /locus_tag="CPFRC_02590"
FT                   /old_locus_tag="cpfrc_00517"
FT   CDS_pept        531921..532541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02590"
FT                   /old_locus_tag="cpfrc_00517"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00517"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28310"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014401029.1"
FT                   /protein_id="ADK28310.1"
FT                   /translation="MIIAIEGIDGAGKNTLVRALVEKLDARVLGFPRYQDSIHAHLAQK
FT                   ALYQEMGDVSDSIYAMALLFALDRREIAEELRSYKGSEDVILLDRYVSSNAAYSAARAQ
FT                   DWNLVAWVSHLEFEEFGLPTPDIQVLLNTSPEVAAQRAAKREEQDQDRSRDCYETDSSL
FT                   QVRTSDAYARLAEEKRFSPWIVAQPGDSVDDVALKIIQTLGTM"
FT   gene            532680..533357
FT                   /locus_tag="CPFRC_02595"
FT                   /old_locus_tag="cpfrc_00518"
FT   CDS_pept        532680..533357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02595"
FT                   /old_locus_tag="cpfrc_00518"
FT                   /product="response regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00518"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28311"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241374.1"
FT                   /protein_id="ADK28311.1"
FT                   /translation="MPQKILVVDDDPAISEMLTIVLEAEGFNTVAVTDGALAVETFNRE
FT                   EPDLVLLDLMLPGMNGIDICRLIRQNSTVPIVMLTAKTDTVDVVLGLETGADDYITKPF
FT                   KPKELIARLRARLRRTDDAPADVIEISDLAIDVPGHVVSRGREVIQLTPLEFDLLLELA
FT                   SKPGQVFTREELLQKVWGYRNASDTRLVNVHVQRLRAKIEKDPENPQIVLTVRGVGYKT
FT                   GQE"
FT   gene            533471..535045
FT                   /locus_tag="CPFRC_02600"
FT                   /old_locus_tag="cpfrc_00519"
FT   CDS_pept        533471..535045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02600"
FT                   /old_locus_tag="cpfrc_00519"
FT                   /product="HAMP domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00519"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28312"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800125.1"
FT                   /protein_id="ADK28312.1"
FT                   /translation="MMILAFVLVSFVTQRLINTKLDIANSEIDRARVSVEQQIKATGAS
FT                   SSMQVRLNSARAALVNKVASAEDQAVYEPVILVNNPDGSVIASPEGYRIPERLRSFVDQ
FT                   RQVSYQFATIDRANGTTYKALIIGTPTNSDIPNTQVYLVMSMESDEATLALLRGLFSGA
FT                   AIVLVVLLVGITWLLTQQVITPVRSASRIAERFSSGHLRERMVVDGEDEMARLAMSFNS
FT                   MAESLSKQIAQLEEYGNLQRQFTSDVSHELRTPLTTVRMAADMIADGSEDLSPGVKRAS
FT                   ELMVRELDRFEALLADLLEISRHDAGVADLAENNLDIRACINAAWQQVEHLAQELGIEV
FT                   RFDIPAEPVNLVGDSRRIERVLRNLLANAIDHANGKPVDVHCAVTEDAVAVAVVDHGVG
FT                   LKPGQEELVFNRFWRADPSRVRHSGGTGLGLAISREDAVLHGGTLAAAGVLGHGTMFLL
FT                   TLPLIPRSDITTTPIELVAPGFSTPEGLEASGDAVLTVEEGLAEKSLGQDAHQKEDTEE
FT                   RLGKQNG"
FT   gene            535038..536774
FT                   /gene="lpqB"
FT                   /locus_tag="CPFRC_02605"
FT                   /old_locus_tag="cpfrc_00520"
FT   CDS_pept        535038..536774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqB"
FT                   /locus_tag="CPFRC_02605"
FT                   /old_locus_tag="cpfrc_00520"
FT                   /product="MtrAB system accessory protein LpqB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28313"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655148.1"
FT                   /protein_id="ADK28313.1"
FT                   /translation="MARVARLGLAIGLVGVLVSACTTLPSSSDPQAIRGFDVSSSTEQQ
FT                   APIAGQEPDLLLRDFYEANTNPSQRYKHARGYLTDAASERWSPGTSVLVLDGIDINSSA
FT                   NSSASRRVFDVRGNIVGSLEEGGSYVSKNESYSTTITLERVNSEWRIAELPDQIVVQRN
FT                   ELWNHYDPKQLYFFDTSGSTLVADRRWVFKDSSASRNSVESALITLMVGGPSRNLTPGV
FT                   VNEVPSGASFAGLSNGFYQFTGMSGLGQDEIRRISAQFVWTLALSGSAGPFKFAFDGVP
FT                   IKSERRDSEELTVDDFAEYNPQAGASVSTEIYALTNGSLRSVVGGQAAPVAGSYGAVHD
FT                   IESVAISNKDKVTAAVRAVGSGDKKKSSLLLGTVGGNYSEVLSAKTMTKPTFEPGASSL
FT                   WTVQDGRKIIRLARSSSGGDIVETEVSMDGLAESASGISMLQLSRSGVRAAMIIGGRVY
FT                   IGIVSRPNAGERRITNIHEVMPAIQDTAVSLDWDSNGSLIVGTSSSEAPVWVIAQDGSI
FT                   ATKLSAGNIVAPVVSVASNSSTRYITDARVALELPNSDSATVYWREVQGLEGGRSVIVV
FT                   PR"
FT   gene            536796..537401
FT                   /locus_tag="CPFRC_02610"
FT                   /old_locus_tag="cpfrc_00521"
FT   CDS_pept        536796..537401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02610"
FT                   /old_locus_tag="cpfrc_00521"
FT                   /product="ComF family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28314"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241377.1"
FT                   /protein_id="ADK28314.1"
FT                   /translation="MWEFLFPQACMGCGKPGLRMCEECKEEWSRAPQRVTTLTDPHVPV
FT                   WSLGEFGGVRRRTIINFKERGRTDAVRYLGPVVAAAVEHLAALGEVEEDIVLLPAPTRM
FT                   RAAQQRGGDPVELMCRASGLRTERVLWHRPSVADSVGLDVSQRRSNLSGNVFLTGVPSC
FT                   AVLIVDDVITTGATLAESVAVLTSANVKIRGALGLSNV"
FT   gene            537539..538201
FT                   /gene="raiA"
FT                   /locus_tag="CPFRC_02615"
FT                   /old_locus_tag="cpfrc_00522"
FT   CDS_pept        537539..538201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="raiA"
FT                   /locus_tag="CPFRC_02615"
FT                   /old_locus_tag="cpfrc_00522"
FT                   /product="ribosome-associated translation inhibitor RaiA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00522"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28315"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241378.1"
FT                   /protein_id="ADK28315.1"
FT                   /translation="MTTPTGNNETLSPDVQVSITGRNVEVPEHFAERVNTKLAKIARLD
FT                   PTLTFFHVELQHEPNPRRAEQSDRIQITATGKGHIARAEAKEDSFYAALETALARMERS
FT                   LRKVKARRSISLSGHRAPKGAGETAAELVHEAETARADSQYDHDPYADSVEEVLPGRVV
FT                   RHKEHPSTPMSVDDALSEMELVGHDFYMFVNEETGRPSVVYRRHAFDYGLISLAKED"
FT   gene            538356..540899
FT                   /gene="secA"
FT                   /locus_tag="CPFRC_02620"
FT                   /old_locus_tag="cpfrc_00523"
FT   CDS_pept        538356..540899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="CPFRC_02620"
FT                   /old_locus_tag="cpfrc_00523"
FT                   /product="preprotein translocase subunit SecA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00523"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28316"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836081.1"
FT                   /protein_id="ADK28316.2"
FT                   /translation="MFGLSKMLRVGEGRAVKRLKKIAEDVIDLEPQFSELSDDELKAKT
FT                   KEFQDRIAAGETVDDLLLEAFAVAREASWRVLGQKHYLVQVMGGAALHFGNVAEMRTGE
FT                   GKTLTCVLPAYLNALEGKGVHVVTVNDYLAKRDAEWMGRVHRWLGLEVGVILANMQPTE
FT                   RRAAYNADITYGTNNELGFDYLRDNMVRSLDELVQRGHHYAIVDEVDSILIDEARTPLI
FT                   ISGPVDGSSQWYSVFAQITPRLTRDIHFEVDERKRTVGIKEEGVAYVEDQLGIENLYAP
FT                   EHSQLVSYLNNAIKAQELFTRDKDYIVRNGEVLIVDDFTGRVLDGRRYNEGMHQAIEAK
FT                   ENVEIKNENQTLATITLQNYFRLYDKLAGMTGTAETEASELHQIYKLDVIPIPTNRDNQ
FT                   REDMTDLVYKTQEAKFAAVVDDIAERVAKGQPVLVGTTSVERSEYLSRLLQRRGVKHSV
FT                   LNAKFHEQEAQIVAQAGLPGAVTVATNMAGRGTDIVLGGNPDIIADINLRERGLDPVET
FT                   PEEYEAAWDEELAKVKNRGERLAEEVREAGGLYVLGTERHESRRIDNQLRGRAGRQGDP
FT                   GTTRFYLSMRDELMVRFVGQSMENMMNRLNVPDDVPIEAKMVTNSIKGAQASVENQNFE
FT                   MRKNVLKYDEVMNEQRKVIYSERREILESADIAENIQKMIDDTIGAYVDGATANGYVED
FT                   WDLDALWNALESLYGPSMQAQELIDGTEYGSAGELSESDLRAAVLEDAHKQYAELEENV
FT                   SAIGGEAQMRNIERMVILPVIDQKWREHLYEMDYLKEGIGLRAMAQRDPLVEYQKEGGD
FT                   MFNAMKDGIKEETVRQLFLLRKQFQAPAVDETVEA"
FT   gene            complement(540912..541343)
FT                   /locus_tag="CPFRC_02625"
FT                   /old_locus_tag="cpfrc_00524"
FT   CDS_pept        complement(540912..541343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02625"
FT                   /old_locus_tag="cpfrc_00524"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00524"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28317"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300520.1"
FT                   /protein_id="ADK28317.2"
FT                   /translation="MLVPIPGLSYLKTFTADATPQSSSSSYAPTDFKRLQLPDYVYKES
FT                   KSLVFMALNAAFGIRSITPLCHEQFGDQVHRLIAARRRSMPAVRGRIVMEALHLRPRGQ
FT                   LIDALGSANINNKHIGYLAQFLPLDETTRRLRMRSLRVI"
FT   gene            541500..541910
FT                   /locus_tag="CPFRC_02630"
FT                   /old_locus_tag="cpfrc_00525"
FT   CDS_pept        541500..541910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02630"
FT                   /old_locus_tag="cpfrc_00525"
FT                   /product="HAD-IA family hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28318"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599989.1"
FT                   /protein_id="ADK28318.1"
FT                   /translation="MRGLIVDYVGVLDGPVEDQRRWRNLLSAARANGIGTAVLSNDPGG
FT                   PGADPIRVLQTQGIVDAVILSGEIGAEKPEEAAFQAAADAIGLPMRDCVMVDDSILNVR
FT                   AAVECGLVGVFYQQFDRTVVELSGLFGLSGDF"
FT   gene            541910..542416
FT                   /locus_tag="CPFRC_02635"
FT                   /old_locus_tag="cpfrc_00526"
FT   CDS_pept        541910..542416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02635"
FT                   /old_locus_tag="cpfrc_00526"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00526"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28319"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800129.1"
FT                   /protein_id="ADK28319.1"
FT                   /translation="MRVYVPATFSLLKELSEQGEISARSGYGFAVTPALREFYTSGDED
FT                   EIAHSAFEDAALASIRLLAVGDEEKFPYRRVVISADIADESVSLEPELGESVVKLSPSS
FT                   VSLDSVAAIHVDVQSSEDATAKAIEAIDEADLGVEDAELIVGDALDNFLAWYDPSELGA
FT                   LVELL"
FT   gene            542605..543663
FT                   /locus_tag="CPFRC_02640"
FT                   /old_locus_tag="cpfrc_00527"
FT   CDS_pept        542605..543663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02640"
FT                   /old_locus_tag="cpfrc_00527"
FT                   /product="2Fe-2S iron-sulfur cluster binding
FT                   domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00527"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28320"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910961.1"
FT                   /protein_id="ADK28320.1"
FT                   /translation="MARDRLASLRGVLKRFTTPLLPDDYSVLVNPLWSTRELRGQIQEV
FT                   HRDRDVVHLSIVPGWGVETDFHAGQYIGIGVEIDGRFVWRSYSLTNAPDPHARTLKITV
FT                   RAVEKGKLSNHLVGSVRPGTTIRLLAPAGDFHLSEPVPSKLAFLAAGTGITPIISMLRT
FT                   MAERKQLERCHAVLVYCVHDSTQLLFDQELTRLEQENPQLEVIRRITAREGRLTPQDYE
FT                   QVVPDITSRAIFACGPSRMLDQAHAWAEERGITITSERFTIDRASDAQGGMITFGDRGN
FT                   IQADGATTLLEAGEKSGVNLPFGCRMGVCHTCVRPLLEGHAQNLVTGETHEPGSRVRTC
FT                   VCVAAGDLTIGV"
FT   gene            543680..544954
FT                   /locus_tag="CPFRC_02645"
FT                   /old_locus_tag="cpfrc_00528"
FT   CDS_pept        543680..544954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02645"
FT                   /old_locus_tag="cpfrc_00528"
FT                   /product="acyl-CoA desaturase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00528"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28321"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836083.1"
FT                   /protein_id="ADK28321.1"
FT                   /translation="MAIDNIQAYSHLSDEDIAEIGKRLDAIKLEVTESLGERDVAYIRR
FT                   LIRAQRALEVAGRISLIFAGNKKCWWAGTAFLSIAKILENLEIGHNVLHGQWDWMNDPE
FT                   IHSTTWEWDIVCPSSQWMHSHNYVHHTYTNVLGMDHDVGYGVLRVTRDRKWTPLHAFQP
FT                   VINPVLATMFQWAVGYYDVELGKFFSQRTTWEGTKEKFWETTSKAVRQVSRDYILYPAL
FT                   AGRNYPRAVAANALANFTRSVWAYAVIFCGHFPDETETFTKEQFKNEDRNQWYLRQMLG
FT                   SANFHGGKLLTLMSGNLNYQIEHHLFPDMPSNRLAEVGKKVRALCAEYDLPYNIDSFPV
FT                   QLFKVQKTLLKLALPNKYLVASPDNAPEVRSNRAFTENPSIERQLGVDSSGKRVGLKTG
FT                   LRLLKQVRPGIRDVIRAYSGRSTRK"
FT   gene            complement(544965..545981)
FT                   /gene="rsgA"
FT                   /locus_tag="CPFRC_02650"
FT                   /old_locus_tag="cpfrc_00529"
FT   CDS_pept        complement(544965..545981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsgA"
FT                   /locus_tag="CPFRC_02650"
FT                   /old_locus_tag="cpfrc_00529"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00529"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28322"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910963.1"
FT                   /protein_id="ADK28322.1"
FT                   /translation="MARRSSAHRWDESDVRVRPSKGSRPRTKDRPRHDDALFGMVVTKD
FT                   RGRWGVVLDSADPAADPIVCMRAREMGRTAVEVGDRVGVVGDTSGRPGSLARIVKLEER
FT                   TSVLRRTADDTDPYERIVVANAHRLLIVCAVADPPPRAGFVERALVAAFVGNLQPILCL
FT                   TKSDLADPTQFAEEFSSLNVPVVVCGIDDPIAPVQELVTNSVTATIGHSGVGKSTLVNR
FT                   LVPDAFRETGTVSGVGKGRHTSTQAVALRLPGGGWIVDTPGIRSFGLAHVDADAVVGVF
FT                   EDLSAATENCPRGCTHAGPPADPECALDQFDADSPTGRRVIAVRKLLASLRTNTEWD"
FT   gene            complement(545981..547255)
FT                   /gene="aroA"
FT                   /locus_tag="CPFRC_02655"
FT                   /old_locus_tag="cpfrc_00530"
FT   CDS_pept        complement(545981..547255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="CPFRC_02655"
FT                   /old_locus_tag="cpfrc_00530"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28323"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014732912.1"
FT                   /protein_id="ADK28323.2"
FT                   /translation="MCVLWDAPTVTAPVSAVVTVPGSKSMTNRALVLSALADSPSHIKG
FT                   ALHSRDTDLMTRALQALGTDVRSHDSSSLVVNPVPLHGGTVDCGLAGTVMRFVPPVAAL
FT                   AQGTTEFDGDPQARTRPMNQILDALRGIGVQVHGDALPFSISSSETPHGGSIDIDASSS
FT                   SQFVSGLLLAAPCYRDGLTVRHIGGKLPSIPHIEMTVDMLRSAGVQVDDSSENQWTVHP
FT                   GGISGRTWEIEPDLSNATPFLAAAAVTGGTVTIPGWPQRTTQAGDSIRSILSSMGCDVS
FT                   FITYNGSNALQVTGPSDGLNGICLDMSDIGELTPTVAALAALAATPSELSGIAHLRGHE
FT                   TDRLKALSDEINRIGGHCEELADGLRITPRPLRAGTWHSYADHRMATAGAIVGLVVPGI
FT                   RVENIATTAKTLPDFENIWSAMVSD"
FT   gene            547276..547944
FT                   /locus_tag="CPFRC_02660"
FT   CDS_pept        547276..547944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02660"
FT                   /product="SOS response-associated peptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523108.1"
FT                   /protein_id="QGW57317.1"
FT                   /translation="MRYMCGRFVLCTTDEQLLQVPGFAAVHAPMGLPAPRYNIAPTQKI
FT                   AVLRAGSTPHEAVIEPARWGLLPSWKQDDSGPPLFNARAETVTEKPSFRAAFASRRCLI
FT                   PLDGYYEWHNKQPYWITTGSVVWVAGLWDSGAQQLSATMITTDSRPPLDRVHHRMPRFL
FT                   SEDEFTMWLQGSPDQAASLLIPGDASAFSLTPADKAVGNIRNDYPELIGLNVDKLPIDE
FT                   "
FT   gene            complement(547903..548406)
FT                   /gene="ybaK"
FT                   /locus_tag="CPFRC_02665"
FT                   /old_locus_tag="cpfrc_00532"
FT   CDS_pept        complement(547903..548406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="CPFRC_02665"
FT                   /old_locus_tag="cpfrc_00532"
FT                   /product="Cys-tRNA(Pro) deacylase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00532"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28325"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300523.1"
FT                   /protein_id="ADK28325.2"
FT                   /translation="MSKKKHSAATPALAVLASSDVDYKVSSFEGGTEHFGDHAAAALGV
FT                   EPERIFKTLVVDLTAGKGPKRQLAVACVPVTSQLSLKKVAAALGASKATMADPHDASKS
FT                   SGYIPGGISPLGQKTVLPTVIDETAILFDTIFVSAGRRGLDVELSAESLASLVDGKLVD
FT                   VQAD"
FT   gene            548454..549125
FT                   /locus_tag="CPFRC_02670"
FT                   /old_locus_tag="cpfrc_00533"
FT   CDS_pept        548454..549125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02670"
FT                   /old_locus_tag="cpfrc_00533"
FT                   /product="sigma-70 family RNA polymerase sigma factor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00533"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28326"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241389.1"
FT                   /protein_id="ADK28326.1"
FT                   /translation="MATKTTELGKRFEAEALPLLDQLYGGALRMTRNPADAEDLVQETY
FT                   IKAFQAFASFKEGTNLKAWLYRIMTNTYINSYRKKKRQPVQSSAEDVTDYQLLATASHD
FT                   STGLESAEVEALKNLPNQRIAQAMNELSEDYRMVVYYADVEGLAYKEIADIMETPLGTV
FT                   MSRLHRGRKQLREALKDVAHDHGIGVSETASSENEASAASHSSETMDIAAGNHKVGKAK
FT                   A"
FT   gene            549125..549406
FT                   /gene="rsrA"
FT                   /locus_tag="CPFRC_02675"
FT                   /old_locus_tag="cpfrc_02111"
FT   CDS_pept        549125..549406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsrA"
FT                   /locus_tag="CPFRC_02675"
FT                   /old_locus_tag="cpfrc_02111"
FT                   /product="mycothiol system anti-sigma-R factor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_02111"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28327"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241390.1"
FT                   /protein_id="ADK28327.1"
FT                   /translation="MSEKGSLDCGCNCEDLHVHMYALLDRELTEVECARLNAHIAQCPE
FT                   CAEMIAAEESLRRLLKKCCCGPAPASLREKISYSIQIERTTIITQREF"
FT   gene            complement(549645..549905)
FT                   /locus_tag="CPFRC_02680"
FT                   /old_locus_tag="cpfrc_00534"
FT   CDS_pept        complement(549645..549905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02680"
FT                   /old_locus_tag="cpfrc_00534"
FT                   /product="WhiB family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28328"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_599996.1"
FT                   /protein_id="ADK28328.1"
FT                   /translation="MDWRHEAICRDEDPELFFPVGNSGPALAQVAAAKVVCNRCPVTSQ
FT                   CLAWALETGQDAGVWGGMSEDERRALKRRKNRGRGRARISL"
FT   gene            550520..550942
FT                   /locus_tag="CPFRC_02685"
FT                   /old_locus_tag="cpfrc_00535"
FT   CDS_pept        550520..550942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02685"
FT                   /old_locus_tag="cpfrc_00535"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28329"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366625.1"
FT                   /protein_id="ADK28329.1"
FT                   /translation="MNKNIQFPPRPVLYGGWIAAIQSLIGIAYAVLLIVREAAGYNDAS
FT                   IVYESDGANTWVGYGTAVFFIIVFGAVLAGAIMMNRGKRWGRGPVIMLQILLLPIAYYM
FT                   FSGGAFVFSVITALTAIAALALLFSPRAVDWAARNY"
FT   gene            complement(551009..551866)
FT                   /locus_tag="CPFRC_02690"
FT                   /old_locus_tag="cpfrc_00536"
FT   CDS_pept        complement(551009..551866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02690"
FT                   /old_locus_tag="cpfrc_00536"
FT                   /product="hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00536"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28330"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241393.1"
FT                   /protein_id="ADK28330.1"
FT                   /translation="MRHRLFKAGAAILAFIATLPAAVTPAYAHASTHNAVIFGDSVVAN
FT                   PELIRYVATWLKIPTTTPPTERGECPTSPHNFGVLAAQRLGLRADNYACAGAVGVGDKS
FT                   LLSASRRSVSLQIDQAAAQRTLNRNTKRVFISLGFNDTYSQLARGRTDHQIRHDFAAKM
FT                   TREVARIRKLAPHARIQFIGYPRITENNSVCLFHVGNNLHDYTFAPEVAHLERLAQEME
FT                   QDAAAASGAEFVNLKGATKNNHMCAPDNQRMWSGIIDGTAGHTNLPFHLNDRGHKYVAD
FT                   FLAK"
FT   gene            complement(551971..553176)
FT                   /locus_tag="CPFRC_02695"
FT                   /old_locus_tag="cpfrc_00537"
FT   CDS_pept        complement(551971..553176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02695"
FT                   /old_locus_tag="cpfrc_00537"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00537"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28331"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241394.1"
FT                   /protein_id="ADK28331.1"
FT                   /translation="MTKSLRKTRKDLIAATIIAGISITGVSIVWATAPVNNVTYSPAAQ
FT                   PLVVSETPPVPVHSLTPQWETPADQLTTKPIIAAGLVMSYDGHSVNAIDPATGAPVWSY
FT                   ARTEKLCSLGQAWSSVVLTFHTGRGCGDVVSLDAASGTYKATRSASASDVVVPISSNDA
FT                   VGTVSSERVELWRSDLVRTVEYGDVPIKQEANQQPHEDCEISSALSRKTLLGVTEKCEE
FT                   AWWLRLQKTVPEDSRVPEITRDIHISGENARIVAIGQEAAAVFVESPHPRIDSFNANGE
FT                   LTASIQVPLADASAWDHGPSVADLPHHITWFDGHRLYLFNPSSLHVEHIIDNVLGTGVA
FT                   INNKLYVPVFNGIAVINWETGVAESVLEVDRGTYNGLVSLGLAGNHVVEKRGDHLVGLA
FT                   LS"
FT   gene            complement(553173..554498)
FT                   /locus_tag="CPFRC_02700"
FT                   /old_locus_tag="cpfrc_00538"
FT   CDS_pept        complement(553173..554498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02700"
FT                   /old_locus_tag="cpfrc_00538"
FT                   /product="DEAD/DEAH box helicase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00538"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28332"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241395.1"
FT                   /protein_id="ADK28332.1"
FT                   /translation="MSVSTHKPTFAELGVAAEIVDALSEQGITHTFAIQELTLPIALDG
FT                   RDIIGRARTGMGKTLGFGVPLLDRVFDAADVAELDGTPRALVVVPTRELAQQVGEDLER
FT                   AARRTPVRVTTVYGGRPYEEQIQVLTAGVDVVVGTPGRLIDLHQQGNLTLDHVAILVLD
FT                   EADEMLDLGFFPDIEKLLGALKHQHQTLLFSATMPGPVLTLARTFMSRPIHIRAEEVNA
FT                   SHTHASIEQVVFQAHRMDKTAITARALQAKERGKTIIFTRTKRTAAELAEDLAGRGFRV
FT                   AGVHGDLGQAARELSLGMFRNGRVDILVATDVAARGLDIDDVTHVINYQTPDAPMTYVH
FT                   RIGRTGRAGHTGTAITLVGYDELIKWKLISDELGLDTPAPPQWFSTSPELFDALSIPET
FT                   AGETVGQPLKVAGSSRSTIKSRRTGNQRSTDAKPTTRRHRRR"
FT   gene            554781..555008
FT                   /locus_tag="CPFRC_02705"
FT                   /old_locus_tag="cpfrc_00539"
FT   CDS_pept        554781..555008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02705"
FT                   /old_locus_tag="cpfrc_00539"
FT                   /product="DUF3107 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00539"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28333"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241396.1"
FT                   /protein_id="ADK28333.1"
FT                   /translation="MDIKIGFSDSPRELVVSSRETQDEVVARVSEALANDSGLLTLTDE
FT                   NGNRYLVRNSQISYVEVGNSNTRTVGFSGA"
FT   gene            555011..555901
FT                   /locus_tag="CPFRC_02710"
FT                   /old_locus_tag="cpfrc_00540"
FT   CDS_pept        555011..555901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02710"
FT                   /old_locus_tag="cpfrc_00540"
FT                   /product="DUF3152 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28334"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241397.1"
FT                   /protein_id="ADK28334.1"
FT                   /translation="MKTPHEESFFVRFARDYGWRAYAIPVLAVITVWVLVDVFVARPSD
FT                   QKPTEKPVSESTEQVSETRQPPLKGPNPADQEQPKIAATELPPGADFTQKGEGTYRVVG
FT                   APGAKAGQGKEKKFTYVIEIENGIKSEVFGGDDAFAAVIDATLTNPKSWAHDEKFAFEH
FT                   IANSPDADPDLRIQLSSVDTTHGLCGHNISMETSCFYSDGNRVVINESRWIRGAIPFQG
FT                   DLGAYRQYLINHEVGHGIGYASHEPCGGNGELAPIMMQQTLSLSNTELSKIDATEAYKD
FT                   DGAVCAANPWPYPFG"
FT   gene            555970..556809
FT                   /locus_tag="CPFRC_02715"
FT                   /old_locus_tag="cpfrc_00541"
FT   CDS_pept        555970..556809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02715"
FT                   /old_locus_tag="cpfrc_00541"
FT                   /product="TIGR02569 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28335"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366630.1"
FT                   /protein_id="ADK28335.1"
FT                   /translation="MDFTALPPHVRNVFHAPDEPARAMGAAWDYGWKVGSVVFSQVAHP
FT                   VRAAWSSRIREKLQPEGVRIVRPIKSTDGRFINAGWRASSFAPGILTRRVDETVAAALR
FT                   LDLALSTVEVPASFKDVDDTDVFSIADHIAWHASPTSAIDLQDSVPRHLTAINIMPKVE
FT                   LLLREIDAPNQVVHADMFATTLYAGVQAPTVTDVMGVARPNGYTAAISIIDALCVGAVD
FT                   EGIIGRFSHVPHLDQLLLRALAYRTAVHALHPDATSNTGTNLEWVAKTVMSKVSVTL"
FT   gene            556813..560001
FT                   /locus_tag="CPFRC_02720"
FT                   /old_locus_tag="cpfrc_00542"
FT   CDS_pept        556813..560001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02720"
FT                   /old_locus_tag="cpfrc_00542"
FT                   /product="AAA family ATPase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00542"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28336"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655153.1"
FT                   /protein_id="ADK28336.1"
FT                   /translation="MNLSATSETPLTKDVHKVPGQEPTPAVGYLDSQRAAFKQPPTPQV
FT                   RIVSADHHVETHNWENDLFKSQTGIWRLIGSAGSGVSTLIMDTVAERLRRGEDPSNILV
FT                   IAASKEGATRLRTGIAARLSGESYTAAATMVRSVHSLAFALLRSLSGEDLRLITGAEQD
FT                   AVIRELLQGHNEDSEAAQIWPQETRDALGFVGFARGLRDFLLRAVERGLSPEDLERLGN
FT                   TYHRPMWKAAGAFLREYEQTMALGGAKSLSASELVSTVLEYHIPDQGWRTVIVDDAQHL
FT                   DPKSAQLIGELLRYAEFGIIGGDPEQSVFHFRGASPEFLTKYPAEHQLMLKTTRRLPET
FT                   TARIVENQGQHFEYVADKIRRAHLIDGVPWDDIAVIVRSTGLIAPIRRALLAAGVPVQV
FT                   DPTDIILSEQRIVASMILAVRAIHGELNNRELEDLLLGPIGGADSVTLRRLYRGLRKVE
FT                   MSRGGSRRAIELLKILISPRPSEEQNDLIGEAEEVLSERELQILERTRRVLLRGAQPGS
FT                   VEEVLWAIWHETGLANHLQAVSLRGGAAGSQADRDLDAAMALFDAAGDWVERRPTAGIV
FT                   SFMRHIAEQELPTGVRDRRQIRTQAVQLLTAHAALGQQWHTVIVAGVQEGSWPSLGETG
FT                   TLFGQEELTDLIDSGIEPNTIVMRSKDRLDEERRLFHVAKSRATHRLYITAVEDPASND
FT                   VAEPSRFIEELDPSFFQQQSQENEASYADLSVPLAPKDTGLEDYIRLLSVPAMVAELRR
FT                   EVRNSDSPQRRRDQAARQLARLASAGVPGAHPEEWWGEGGPSTDQPLQQRSISPSLIEQ
FT                   GLTCPLRARLDAVIEGEETPFQMLKGSLAHAYAEAIARGVESETAKELTTEAFLRLLNA
FT                   PAWQQETEKAAWIRMIERLEEWITVSAARYELVGVETSVNTKIAEGITIRGRIDRIERT
FT                   QDGAYRIIDYKTGTRGLSAKEVADHKQLMAYQLALSKGKLSDTGDVISGNDEESLIVDQ
FT                   AVLVYPGSTTKKIKTCEQATKTPEELQEFADLLPPLIQNLTGPSLMAVVNDGCSNCSII
FT                   NICPAQPEGRMTPA"
FT   gene            559998..563222
FT                   /locus_tag="CPFRC_02725"
FT                   /old_locus_tag="cpfrc_00543"
FT   CDS_pept        559998..563222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02725"
FT                   /old_locus_tag="cpfrc_00543"
FT                   /product="AAA family ATPase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00543"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28337"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800136.1"
FT                   /protein_id="ADK28337.1"
FT                   /translation="MIDPIELSRLLKQKFPPTPQQAAVIGAELEPMLVVAGAGAGKTET
FT                   MAARVVWLVANNIANPDRILGLTFTRKAAQQLSQRIRGRLEQLAGMDALRDIDPSGELS
FT                   YKLEAIAPTVSTYDSYAGSLIREYGLLLPVEPTSRLITETELFQIAYDIVINYSGSLDT
FT                   QTQPVNATEKLLSLVSEIDNHIVSPQDIVEETDAFLSVLDDVEAASKRGLNQILIGWKQ
FT                   RQIIRKQMLPMVAMLKQHLAYNNLMTFGEQMSLAARLAEENPQVGASQRDRYSVVLLDE
FT                   YQDTGHAQRVLLRSLFSGAAVTAVGDPMQSIYGWRGATSANLERFREDFALGEEPAQKR
FT                   ELTVSFRNPPEVLQLANEVSREVLGAPDNPRRTVQPLSSREGAPHGEVTLGFFPSAEKE
FT                   REFVADQLAEAYKNRGESFTAAVLVRKKRHSAPIALELQSRGVPVEIVGLSGLIDIPEV
FT                   ADLIAIAAMLIRPQDTKSALRILAGPHVGLGAADILALADRAANLAGRGKAEREEKKTD
FT                   PLERLEQIIAETLPKAPESVVGLAEAVADLDVPREEGAATRYSDEGLRRLQLLASELRY
FT                   LRTHSLGHSLPDLFADIERVFGIRTEVLQREDPHSDGAPGTVHLDRFAEVISDFARVPN
FT                   ATLSQFLDYLELSRSQGDGLEPGEVQVRSDRVQILTVHKAKGLEWQIVSVMHADSSTYK
FT                   TTTSTWLSNESAVPSALRGDAREDDSLVGAPVWYIDSAESPADLKKQGEAHIAEFRAVE
FT                   EEENARLFYVALTRAEERVLVTASTDITKASPPGPYAHLDMLRTKFPDCVVEWFDGESD
FT                   DALEPPLPEIGVFPQELRPEGADAVKAAMVDLPELIEDGELFERWEQEVTALIEEHHQL
FT                   STPVVPVELGLELTASDIVNLSQDPQAFARRRRRPVPFKPNSYAKRGTAFHQWLENRFG
FT                   ATALLDADELPGIDDALDGTELETLKARFLDSEWADRTPEYVEHPFEVSIGEHIVRGRM
FT                   DAVFRDADGRWIVVDWKTGQPPTEAAERRSVSLQLAVYRLAWARLQGVDPSEVQALFHY
FT                   VGRNFSYRPSELPDEASLARMLALNV"
FT   gene            563259..564338
FT                   /locus_tag="CPFRC_02730"
FT                   /old_locus_tag="cpfrc_00544"
FT   CDS_pept        563259..564338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02730"
FT                   /old_locus_tag="cpfrc_00544"
FT                   /product="Ion channel protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00544"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28338"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366633.1"
FT                   /protein_id="ADK28338.1"
FT                   /translation="MPLTNRDAGRYLGDEGLTELPEHTLLNVIRIPGNPLISPVRLIAR
FT                   RFGYALVLILLVALIVYFDKGGYSEHLTFIDALYYSAVSLSTTGYGDITPVTQGARLLN
FT                   IIIITPLRLTFVILLVGTTLSVLTEESRRAWKIQRWRKRMRNHTVVIGYGTKGRSAVSA
FT                   LLADGVSPKEIVVVDTDPVALETANTVGLVTVNGSATKSEVLKLAGVPKAKAVVVAPNI
FT                   DDTAVLVTLSVRELAPSAWVVASVRESENQHLLEQSGADSVVISSETAGRMLGLATVTP
FT                   SVVEMMEDLLSPDEGFSVAERPVGEDEVGANPRHLADIVLGVVRSGELYRIDSPEAETV
FT                   EPSDRLLYIRRVFSEDVSD"
FT   gene            564394..565053
FT                   /locus_tag="CPFRC_02735"
FT                   /old_locus_tag="cpfrc_00545"
FT   CDS_pept        564394..565053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02735"
FT                   /old_locus_tag="cpfrc_00545"
FT                   /product="NUDIX domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28339"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014401039.1"
FT                   /protein_id="ADK28339.2"
FT                   /translation="MLSSQWPGAPAFNVTDQLLVQRVDPEVVDSVTGTATRLYTSWVTR
FT                   AIAVLRNREVMVYDPTSGERLEYNAPTIGQTLGGKEVFPRIDPAVIGLITSESDEYVLV
FT                   GENSHRCGYFSLIAGYLGMGETFEQALTREVWEETGRRISHISYVKSQSWPYSGAIMVG
FT                   MTAQTTDMDAVVQPDGELKEIRWITRKEIIQGTIQLPAPGSIAHDMMWDWVKKHDD"
FT   gene            565046..567097
FT                   /locus_tag="CPFRC_02740"
FT                   /old_locus_tag="cpfrc_00546"
FT   CDS_pept        565046..567097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02740"
FT                   /old_locus_tag="cpfrc_00546"
FT                   /product="AAA family ATPase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00546"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28340"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241403.1"
FT                   /protein_id="ADK28340.1"
FT                   /translation="MIDLNELDSDQRAAASAPRGPVAILAGAGTGKTRTITYRIANLID
FT                   RGMASPNRVLAVTFTRRAAGEMRHRLGVMGVGGVQAQTFHSAAMRQLSYFWPQVAGNLP
FT                   WKLLDNKFPLVGKAARSVGIETTTENVRDLLGEIEWAKATLITPDRYVEHVKDRKIPAA
FT                   ADKIAQVYRRYEQAKTTSEGMLLDFDDLLLHTAGAIENSTAIAEEFREQYRTFVVDEYQ
FT                   DVTPLQQRVLDAWLGERDDITVVGDANQTIYSFTGATPNYLLGFSRKYPHATVVKLQRD
FT                   YRSTPQVTDLANTVIGKARGRVAGTRLQLEGMRPPGPDPEFCTFDDEPAEARAVASRIK
FT                   ELLDKGVAASEIAVLYRINAQSAVFEQALADAGIVYQVRGGGEFFQRAEIRQAMSQLVR
FT                   VAQRTGTESIRGSALETLVRSSLAPLGLTPEEPEGTQARERWQSLDALAELTVELTQAT
FT                   PDLDIQGLLEQLNQRASAKHPPTMQGVTLASLHAAKGLEWDAVFLVGLVDGTLPITHAL
FT                   KGGEPHIEEERRLFYVGVTRAREHLVCSWAKARQEGGRATRKRSRFFDGIVEEPIHAAV
FT                   PPRTKRSRRCRVCGSPLSTSAENVMGRCVDCPSGVGEEVFETLKAWRLDMAKEGGVPAY
FT                   IVFTDATLHAIAEACPTTTDELLKISGIGQMKAEKYGSSLLEVLAQFH"
FT   gene            complement(567091..567942)
FT                   /locus_tag="CPFRC_02745"
FT                   /old_locus_tag="cpfrc_00547"
FT   CDS_pept        complement(567091..567942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02745"
FT                   /old_locus_tag="cpfrc_00547"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00547"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28341"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523828.1"
FT                   /protein_id="ADK28341.2"
FT                   /translation="MNTGGNVVLSPSNQVLARTEGIQFGLDSAHAGIFPAPRELIDALV
FT                   PILRSLREPRAKVQVISELTSAGLHPVAARGLMEDLLAHGVLRQQSTPYASAVIGDDPL
FT                   ANAISNLLKGAGVSVLRSTHFPISEDFMEHVHRRTLVIVCNPKESCVEDRINTHGFLLP
FT                   VALIDAHGMIGPVRIAGSGPCLACSDLYRTDADPEWPALRTQSLLSSHSFSAEPHLITA
FT                   TAAHAIFVIQSLLSEQNNVYSAASQSVIPGDSFKISAFEVERLPRLSTHPRCPFCWDLQ
FT                   RQ"
FT   gene            567977..568492
FT                   /locus_tag="CPFRC_02750"
FT                   /old_locus_tag="cpfrc_00548"
FT   CDS_pept        567977..568492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02750"
FT                   /old_locus_tag="cpfrc_00548"
FT                   /product="DUF45 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00548"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28342"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523113.1"
FT                   /protein_id="ADK28342.2"
FT                   /translation="MPRKNTPELPVEVIRSKRRVRTVSARLIDGRVQIRIPESMSKNDE
FT                   QRVIAEMSAKVKRKTQSTADSNEQLFQRAQYLNRRYLDGKANLGSIKWVTNQRRRWGSC
FT                   SQSTGEIRISHRLKEVPDYVLDSVIIHELVHTFIHSGHSKEFWEWADRAPYAERAKGFL
FT                   EAMQRVSG"
FT   gene            complement(568560..569948)
FT                   /locus_tag="CPFRC_02755"
FT                   /old_locus_tag="cpfrc_00549"
FT   CDS_pept        complement(568560..569948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02755"
FT                   /old_locus_tag="cpfrc_00549"
FT                   /product="hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00549"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28343"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241406.1"
FT                   /protein_id="ADK28343.1"
FT                   /translation="MNTNGFGFSFNFGGNGDDDNNGRNNNPFGAGGLGDMLNQFGQMLS
FT                   GMGSTMNSPEGQGAVNYALAERIARQQIGSSTAVSDNDTAAVEEAVRLVEIWLDDATIL
FT                   PASGNTVAAWDASLWLEQTLPMWKRLVTPVAENMAQAQVDSLPEEAREMVGPMMQIMNQ
FT                   MSGMNFGMQLGHALGDLATQTIAGTDFGLPIAPTGVTALLPANLRKETSGLKIEDREVI
FT                   VYLSAREAARQRLFKHVPWLRERLVSSVEEYAAGLVIDTSHIEEAMRDLNLESGDPAAI
FT                   QNAMEQLQGLDMSPRITSRNSHAASRLETLLALIEGWVEIVVTEAMGNRIPSTAALNEA
FT                   WRRRRATGGSAEQAFAKVVGIEFAAPKVAEARELWRRVGVAVGTELRDHVWDHPDFLPT
FT                   AEDLESSAEFIDALLDDSSGSDFDPIAEITKLEEMLASEGENPESKENPKPEDDTDDQD
FT                   PKKS"
FT   gene            570030..571085
FT                   /locus_tag="CPFRC_02760"
FT                   /old_locus_tag="cpfrc_00550"
FT   CDS_pept        570030..571085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02760"
FT                   /old_locus_tag="cpfrc_00550"
FT                   /product="PDZ domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28344"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241407.1"
FT                   /protein_id="ADK28344.1"
FT                   /translation="MKRRLSTLTLGALPIVVLGTLVTIDHVPGTDIDLTVPYAAEGPGP
FT                   TFNTLGQIDGQDIVEIDGAEIDKTRGNLNMTTVSIRSGMTLAQAFSRWLFTDDTLIPLE
FT                   RVYPKNKTPDQVNQENQLAFSTSEASATIAAMNHLGRPVETEVAGIVEESAAQGILHEG
FT                   DVIVEIDGTAVGGPKQVREAVRKKNVDDTVTITYQRDGKKHDATVKLGKNPSDPKIPFL
FT                   GVSMAAKPADGITVNYHLKDIGGPSAGLIFSLAVVDKLSGGELNGGKFVAGTGTIDDDG
FT                   TVGPIGGIAHKVQAAKDAGAELFLAPAKNCSEAVSRNHDGMTIVSVDSLEDAIKQMDAY
FT                   NSGGEYTTCKE"
FT   gene            complement(571102..571806)
FT                   /locus_tag="CPFRC_02765"
FT                   /old_locus_tag="cpfrc_00551"
FT   CDS_pept        complement(571102..571806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02765"
FT                   /old_locus_tag="cpfrc_00551"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28345"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523115.1"
FT                   /protein_id="ADK28345.1"
FT                   /translation="MLSLTALRMPLNIRVFRRSACALALCGLLGVTACGNDRDDPAQAA
FT                   TETSSESAAETTTPTASSARETSQSVGTGTVDAGTAETSSEKTKKNPNLEKARKQFAAL
FT                   APKDFFDQFDSCDANGVQNSMACSGEKIGQFQFFKSDSKAASTTQLLTELRSSRVVEDT
FT                   GRRVVGWSTLGSTAVITVVDNDEGLVMQQMVSTDEKDPAEQIYALGLAQRPQAESSAME
FT                   TPTHTEPAKAKS"
FT   gene            complement(571851..572354)
FT                   /locus_tag="CPFRC_02770"
FT                   /old_locus_tag="cpfrc_00552"
FT   CDS_pept        complement(571851..572354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02770"
FT                   /old_locus_tag="cpfrc_00552"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00552"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28346"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910986.1"
FT                   /protein_id="ADK28346.1"
FT                   /translation="MSTPDYPIQALNKAMLEAVDFIHAEGWDASPTLFALVPAELVGSA
FT                   LPEEDDSPLALVVQDNLPEHIQPGSEELGDYISRVSWPSQVIGAVLAQEIIFRDSSDPA
FT                   AGPRPARLFSGVLQGDHELTLLQMRPSEEELEARGPFAADEIELRGGPGVAPGVIAALR
FT                   MTLD"
FT   gene            572496..575462
FT                   /locus_tag="CPFRC_02775"
FT                   /old_locus_tag="cpfrc_00553"
FT   CDS_pept        572496..575462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02775"
FT                   /old_locus_tag="cpfrc_00553"
FT                   /product="membrane protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00553"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28347"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523830.1"
FT                   /protein_id="ADK28347.1"
FT                   /translation="MANGLTPPSPSIGRPPKLFTRIVVLLVILGALVPTAIGLYTNWLW
FT                   FGEVDFRGVFNKVILTRIVLFVVFALVAGIITWIAGWLTYRGRPDELDVLDLEGPIPQY
FT                   RAVVERSVKRFLTIIPIVIALVAGFLGQQNWQTVQLFLNRQSFGVSDPQFGMDYGFYAF
FT                   MLPALRLGLGTVSILVAVAFLLSLIGHYLLGSIRIGNQAAGVRGSISSYARVQLSVTAG
FT                   LWMLLKVASYWLDRYDLLNNRHETFTGGSYTDINAVLPAKIVLLVIAAVVALCFFLVVV
FT                   LKDLRIPAAATVLMVVSAVSIGSIWPLMVERFSVSPNRAEKESEFISRNIQATRFAYGI
FT                   TDDQVTYLNNWGAQGPNSDKVASDSATVSNIRLLDPEIISPTFTQQQQLRNFYGFPKSL
FT                   AMDRYVIDGELRDFVVAARELDPNALQENQRDWINRHTVYTHGNGIVAAQANQVDEVAR
FT                   DVGSARGGYPVYTVSDLQSTDAEAKELGIVVKEPRTYYGPVIASARDGADYAVVGSDQG
FT                   NPVEYDTDSSTYTYKGKGGVNIGNLFNRLAFAVRYQELNLVLSDRVNKNSKLLFNRDPR
FT                   ERVHNVAPWLTTDSTTYPAVIDGRIKWIVDGYTTLSSLPYSERTSMTEATTDTTAQVGN
FT                   SAQRIVTDNVGYIRNSVKAVVDAYDGSVDLYEFDEQDPVLKAWKGIFPGSVKPKSEISE
FT                   SLMNHLRYPEDIFKVQRKMLARYHVDDARDFFTNDRFWSVPSDPSASEGQQNIAQPPYY
FT                   VVAADPHTKKPSFQLITPFRGLQREYLAAHMSVSSDPDNYGKITVRVLPTDTLTQGPKQ
FT                   AQDTMMSSDQIASDRTLWRDTNDLFNGNLLTLPVGDGEILYVEPLYSQRKDQASAFPKL
FT                   LRVLVSYQGKVGYAPTISEALSQVGIDPKAAQDLGEARNLGKVPKKDDANKDQSNQKES
FT                   PKPSAPATGTGAAGEAIQKINDALKALETAKGKSNEEYGRAIDQLDKAVQDYRHTIGG"
FT   gene            575589..575665
FT                   /locus_tag="CPFRC_02780"
FT                   /old_locus_tag="cpfrc_t017"
FT   tRNA            575589..575665
FT                   /locus_tag="CPFRC_02780"
FT                   /old_locus_tag="cpfrc_t017"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:575623..575625,aa:Met,seq:cat)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            complement(575673..575882)
FT                   /locus_tag="CPFRC_02785"
FT   CDS_pept        complement(575673..575882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02785"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_002551115.1"
FT                   /protein_id="QGW57318.1"
FT                   /translation="MVNRVIKKQLGEVLGISGATAGRKVRGEISWSLAELFSVAELLDI
FT                   SVHDLIPHQAKAPEKHESPLRRGG"
FT   gene            575881..576702
FT                   /locus_tag="CPFRC_02790"
FT                   /old_locus_tag="cpfrc_00554"
FT   CDS_pept        575881..576702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02790"
FT                   /old_locus_tag="cpfrc_00554"
FT                   /product="Abi family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00554"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28348"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014401043.1"
FT                   /protein_id="ADK28348.2"
FT                   /translation="MSKKMTTRQHARQLTRQALAQKVAHQSGLEPMKFHYFLGYARNFR
FT                   ELYFDGKLPGRKTPDRVFRLIDVDAKVSEVLYSGIRNAEWLLRHYLVQEYCERFESRGS
FT                   FLDFENYLNLGDDYTNDHLARGLMNDILDYSETYVVEQLAEVAKALKCPPPKRCDVSNW
FT                   EHCKNLSEDLALWSVVDSFSLGRLVKLIQRCDSTADDKQRIWRKIAADMDIPAGRFGVG
FT                   MESLRSLRNLVSHQSRLWLRPTTNTVSKKGQFHKKIGRCHRNPYPFGVPIG"
FT   gene            576859..577845
FT                   /locus_tag="CPFRC_02795"
FT                   /old_locus_tag="cpfrc_00555"
FT   CDS_pept        576859..577845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02795"
FT                   /old_locus_tag="cpfrc_00555"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28349"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522366.1"
FT                   /protein_id="ADK28349.1"
FT                   /translation="MPLKRLNRTVQFWRIVDARDNQPLEKDYDWAAIFGDLYGKTSPLL
FT                   FEADLEGRKFLGQVVTLGDKITELLHHELTDVFGSKGSCQHFGVILAGDKDYVPNQQNK
FT                   QSGVQQPVGLNEGWDAVDNSFVWHLAFGNMFAILLESQSSGRANRYAAWLTRFLRQSGI
FT                   ISDQQVSYEAIPVIDGDVVDRARKAKGIKAVSLRTSLGRASSANNPVNRIFASHSNYHD
FT                   VDIEIKITTRPGRSRQEDEQENLEWFRENLGDLTEFSKAVVKTVDSKGTIDELNLLKER
FT                   LSRKQHITLDTSKSAADAINKDSVFPAIVEAFVKNYRDLQGLKDDGR"
FT   gene            577865..578323
FT                   /locus_tag="CPFRC_02800"
FT                   /old_locus_tag="cpfrc_00556"
FT   CDS_pept        577865..578323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02800"
FT                   /old_locus_tag="cpfrc_00556"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00556"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28350"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300535.1"
FT                   /protein_id="ADK28350.2"
FT                   /translation="MSSVTKHVGLSCLFFGVVCLALGIAINSAKAEVLASALTNLAAVS
FT                   GIASGLSFAALSIFTLNGTYQEKVLKYVGNTVRGTLFYMLFVVMLVSVFSGISVIWADS
FT                   SWIRIVFPILVFLVVEPFYITFRITYTAYEWESEPTRPDPMDSKYIKK"
FT   gene            complement(578621..583567)
FT                   /locus_tag="CPFRC_02805"
FT                   /old_locus_tag="cpfrc_00557"
FT   CDS_pept        complement(578621..583567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02805"
FT                   /old_locus_tag="cpfrc_00557"
FT                   /product="DEAD/DEAH box helicase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00557"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28351"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522367.1"
FT                   /protein_id="ADK28351.2"
FT                   /translation="MASFEQVLDQLRDNQPQGKYGIAFEKLMVNFFRMAPTLAEQFDEV
FT                   SRWGDWRYNGGKPDTGIDIVAKRKEDGSWVAIQAKFYQESTSIQKRHIDSFFEASGQSF
FT                   ETEQGREHFSHRYIISTTDKWSKNAEEALANQMIPTSRIGRADISGAPVDWDVVFPGSE
FT                   IEVKLTRKEPFKPRKHQAEAIEKALEGFNAHDRGKLIMACGTGKTFTSLRLAEQFAHKN
FT                   GGRARVLFLVPSIALLSQTLREWTAQATVSMRSFAVCSDTKAGRQAEDIASYDVEIPVS
FT                   TDGKTLAEAFETGKRSKGLHVVFSTYQSLPAVHEAQQQGLADFDLVICDEAHRTTGVTL
FT                   AGQDASNFVKVHDPAYIKAEKRLYMTATPRLFDDTVKGKAADHFAELASMDDEAIYGPE
FT                   FHRLGFGEAVERGLLTDYKVLVMTVDESVAAEALAHSPSELLNLTTASAIIGAWNALAK
FT                   RSGTLQGKKGGFGADDQPMRRTVAFAKDIKHSRQIAESFPALIAAHQELLHQNAVNVEP
FT                   SLVDATLHHVDLSVTAQHVDGTMNALERSGKITWLEADFPSDESRVLTNARCLSEGVDV
FT                   PGLDSVIFFNPRNSMVDVVQSVGRVMRKAEGKDYGYIILPVAVSPGVSPAQALNDNARF
FT                   KVVWQILNALRAHDDRFNAKVNSLALNEGSTEELPIVVDHLENPKDKLDKDDTRPAEDQ
FT                   PGEDPTHDPAQQIALFSLEKWQEAIYTKLVDKVGTRTYWEDWADDVATIAQSHIVRISK
FT                   LIDGADPQLAAEFEAFVAGLRANLNDSITKDEAISMLSQHLITAPVFDALFEGHSFSEH
FT                   NPVAQVMQRMMDALEAAHLDTETESLEKFYDSVRVRASEVSSASGKQQVIKELYERFFQ
FT                   KAFKKQADSLGIVYTPVEIVDFILRAADDVSRRHFGRGLSDEGVCILDPFAGTSTFTVR
FT                   LLQSGLIRPEDLARKYANEIFVTEIMLLAYYVSAVNIETTYNALRAEAAQRGGEPEPEY
FT                   VPFKNIALADTFQIHEDGDIPDLNIFRENNDTIERQKAAPINVVIGNPPYSAGQKSAND
FT                   LNANLKYPSLDARIAETYAAKSTATNKNSLYDSYLRAFRWATDRIGDQGVVAFVSNGGW
FT                   IDGNTGDGVRLSMAEDFTDLYVFNLRGNMRNSDWRSEGGQIFGAGSQTTIAIFVAVKDS
FT                   SRKGFRLSYAQTPDAAPREEKLELISTSTVGTLEWRVIEPNVHGDWLNQRSEDFATWPV
FT                   IGEKKGTSTTFFRTFSAGLQTNRDAWVYSFTSTELDLKVKQIEQNYAEALDKIQDGQSA
FT                   PQLFATEPSLVDPKKSKWSSSLQSQLERRQPLRKSGSVMNSLYRPFCAQHVYFDEQLNH
FT                   RRYQLPTMFPTPAHRNVGFYIPAASSAARGFNAIATELVPDLCLSGSGSGQFFPRFTWD
FT                   PTEDDGGLFGRGGVDKQSFEESAYGEIGEVVEGYRRVDNITVEIKMLYREALGGDITGD
FT                   DIFHFMYGKLHDPAYRNAYATDLKKMLPHIETPATREEFDRFVRAGAELLTLHIGYETV
FT                   EPWPLDVKVKGDEDARETWRVAKMRWAKRKDPETGKNVNDVTSLIYNRQITISGIPEQA
FT                   DEYMLGSRSAVAWLIDRYQVKTDKASGIVNDPNDWADEVGNPLYIVELIGRVVRVAMET
FT                   VRIVEGLDEG"
FT   gene            584321..584617
FT                   /locus_tag="CPFRC_02810"
FT                   /old_locus_tag="cpfrc_00559"
FT   CDS_pept        584321..584617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02810"
FT                   /old_locus_tag="cpfrc_00559"
FT                   /product="DUF2249 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00559"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28353"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800145.1"
FT                   /protein_id="ADK28353.1"
FT                   /translation="MKSQLSLNETSTQPHAGACGCHFQQAELPTLDARAIVPRLRHAAI
FT                   FGALESLTPGEAMGFIAPHNPVPLLQQIGDKYGDGVEVSYLSEDPWTLKFTRV"
FT   gene            584686..585738
FT                   /locus_tag="CPFRC_02815"
FT                   /old_locus_tag="cpfrc_00560"
FT   CDS_pept        584686..585738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02815"
FT                   /old_locus_tag="cpfrc_00560"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28354"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014401045.1"
FT                   /protein_id="ADK28354.2"
FT                   /translation="MGLNAALLLLGVPAPVESETLSNNHGLIMTLGFMGTVIALERAQA
FT                   LHQPWAYLAPGLLGSGGLALGFGASWLGHTLLLEGTLALLLVYALLFKRAPLPLVAVQG
FT                   LSAVWAFIAAALALTLPTADLIVPLAAFIVLTIAAERAELAQLAMGPKAIPTLVLLSAL
FT                   LSAGVAAHLLWAYKGAHLYGVAQAIIAMWLLRDDVVRIFIRARGLRRYNASALLSGYTW
FT                   LTLAGLIWAAGGGHIGTASYDAVIHCTFLGFGVSMIMAHAPIIFPTVIGRPLPYTPWFY
FT                   LPLAALHGGMVLRIAGDFSGQGIAWQIGGSITVIAMLIFVILAAMTVLFNRRDQQQPQT
FT                   PQTCEKKVQQ"
FT   gene            585735..588383
FT                   /locus_tag="CPFRC_02820"
FT                   /old_locus_tag="cpfrc_00561"
FT   CDS_pept        585735..588383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02820"
FT                   /old_locus_tag="cpfrc_00561"
FT                   /product="multicopper oxidase domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00561"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28355"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800147.1"
FT                   /protein_id="ADK28355.2"
FT                   /translation="MNQPKMPPNRSGRRSSLRDFVVIGWLVALFAVIFVHRWVPEAMWL
FT                   MIHLVLLGALTHSAMVWSEYFAHTLLRTGQGAQEKKNQNRRILILVAGTLMVFIGVPAG
FT                   QWWLVVAGGVLIASAVIWHGAYLYRQLKKALPARFQIVVHYYVAASFMLPIGVFLGVLM
FT                   ARNPEEPWYGQFLMAHIAVNFLGWIGLTVVGTLVTLWPTMLRARMDERAEKLATRALPV
FT                   LLLGIAVIVGATLLGAMKMALAGLVVYFAGLVIWGIALGKPLRAKGLREFAPASVLAAM
FT                   FWAVVGLVWVGIILATSTNWAQVTAALPLIGGVFAAGFAIQLLFGALTYLMPSVMGGGT
FT                   RVVHAGQSALHKWTTFRILVPNVALALWLVVSASWVKVALSVVGVLVLAMFVPLLVIAG
FT                   KRCAAMLRDKSTGAALPEFDVPATWSWNGVVAAVAVIVLSVTAGVAVDPGAAGFQPHGG
FT                   TNSSGTGVMATGQDTRVEVTIEGMHFVPSRIEVPTGNRLIVEFKNTGSDVHNLVVGDAR
FT                   TPRLAPGESHTLEAGVISHDVEAFCSVAGHRQMGMVLDVVAVGALAGNSMTGGDHAGHT
FT                   PMSTGQIQNVPGAKLQDHIDPKLPKLGSERVHKHRFEATEVPNEVAPGLWQTRWTFNGK
FT                   SVGPTLHGRVGDVFEITLVNNGSMGHSIDFHAGALAPDLPMRTIAPGEELVYRFKATRA
FT                   GIWMYHCGTMPMTSHIAMGMHGAVVIKPEGLPEVDHEYVLTQSEIYLANKARSAGEAQE
FT                   LDSKKLAEERPDRVVFNGIANQYDQQPFRVKVGQRVRFWVLDAGPNRALSFHVVGGQFD
FT                   TSWTEGYYTLNRGVSADGATDGGAQVLPLLPAQGGFVELTFPEAGHYAVVNHVMIDAER
FT                   GAHGIVEVTDR"
FT   gene            588676..589350
FT                   /locus_tag="CPFRC_02825"
FT                   /old_locus_tag="cpfrc_00562"
FT   CDS_pept        588676..589350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02825"
FT                   /old_locus_tag="cpfrc_00562"
FT                   /product="trypsin-like serine protease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00562"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28356"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523833.1"
FT                   /protein_id="ADK28356.1"
FT                   /translation="MYPSLKERSSVKMKMHTRVAIALFGSFIAASTLAGTATADESNGP
FT                   IKNGSFIEVFNGDTRIGSCSATVIEKGSLLTAGHCGHVGAKVRIRDKEIGFVDSSGLRQ
FT                   GYDIIHVTLNPGIKVVPMKADLGYTPKTGDRVSKDGWRSLHTEGTVKDPEIKEVKSRES
FT                   INAPVDGQTFTVSTWTADLVSLQGDSGGAVTHNGKVVGLVKGGPNDEVTTYSLGGCPSV
FT                   FA"
FT   gene            complement(589688..590344)
FT                   /locus_tag="CPFRC_02830"
FT                   /old_locus_tag="cpfrc_00563"
FT   CDS_pept        complement(589688..590344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02830"
FT                   /old_locus_tag="cpfrc_00563"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00563"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28357"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655164.1"
FT                   /protein_id="ADK28357.1"
FT                   /translation="MVNKKDLPEPPSVSSEAPQPPEALPEQQIFLYPNDKEVKITPLGT
FT                   TLKFGETANVVTEDSEGRYLVWAVTAHDGVPLPLEKVSLLNTNESNEVSHFMCYAYDVE
FT                   FLGAVSKGSDDPLALSGLADAEHAAVIAPTLVPATASGDNALHLNGGADKACGIPDSSR
FT                   IPTSESLLKVNRVYARGNIGVITKNQDSANNKHAQSVRFDWDQSGEKSRDSLYWN"
FT   gene            complement(590553..591920)
FT                   /locus_tag="CPFRC_02835"
FT                   /old_locus_tag="cpfrc_00564"
FT   CDS_pept        complement(590553..591920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02835"
FT                   /old_locus_tag="cpfrc_00564"
FT                   /product="DUF1624 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00564"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28358"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655165.1"
FT                   /protein_id="ADK28358.1"
FT                   /translation="MTSQISTQHHTSDAITRPQPGPACVRPIWNGEAEVLPQPYSPPPE
FT                   PEIRPSRWNKELAFGSSADPRRIIGIDSARGFALIGMIAVHVLPAYNKYTDQPTLIWQL
FT                   FGGNSSALFALLAGVTIALLTGGNMPHSGRELRRDQISLAVRAVIVFALGLALDEIRLP
FT                   VSNILAYYGLLFLLSIALVSLRIRTLFILSGVFIIAGPLAIFAVNSWGHYTTTLNPSFS
FT                   SLINLPVDTIITLFVGGTYPVVTWMAYICVGIALGRMNLHWLITQTRLIAIGAVAAIMG
FT                   FLLSTFLIDYVGGFSQLYYHTDNYDVEDILRVIDFGPEIHLPTDTWWWLAINGPHVNTP
FT                   FSLLTSLGTAILALGSFLVITRMIKNLFIPLIAAGSMTLTLYVSHILLMATFKESTEAL
FT                   PTLWFMVHVLGALLFGTAWQLARGRGPLEEVVSKISKRVSRAFLPAQPKTVSDTEN"
FT   gene            complement(591954..595952)
FT                   /locus_tag="CPFRC_02840"
FT                   /old_locus_tag="cpfrc_00565"
FT   CDS_pept        complement(591954..595952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02840"
FT                   /old_locus_tag="cpfrc_00565"
FT                   /product="AMP-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28359"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241422.1"
FT                   /protein_id="ADK28359.1"
FT                   /translation="MGKPAPSDDRTYAIYGVDTIPEPRTLVDIFSDTVISYPNATALIG
FT                   TNESLTYSELAERVEKQIERLAALGVGRGARIGIRVPSGTTDLYIAILATICAGAAYVP
FT                   VDWDDPDSRANTVWEEANVTAVYGAELSLDLRGNTLAPVKACEPTIADDAWIIFTSGST
FT                   GKPKGVAVTHRSAAALVDAEARMYLVNDPLGPQDRVMAGLSVAFDASCEEMWLAWRYGA
FT                   ALVPAPRDIVRSADELGKWITKNEITAVSTVPTLASFWPTESLAAVRLLIFGGEALPVE
FT                   LVNRLAAPGRELWNTYGPTEATIICSGHLMEPMTDKEPVRIGRPVPGWELAIVDPETGD
FT                   PVRWGETGELLVTGVGLGRYLDQEKDAQAYAPLESLGWERAYRTGDLVVADQKGIIFAG
FT                   RADDQIKFGGHRMELGEIDRALASVPGVAAAAKQTTTAGSDVIIGYVVPEEDEGKPVTI
FT                   DLHKARTHLATVLPGGIAPTLCIVDELPMKTSGKVDRKALPWPLPDSRDSVEALPEQLR
FT                   WLADQWIDQLGPVPIEADSNFFDLGGSSVAIAKLAIALRKSHPALDIGALYDNPTLSSM
FT                   AAYVDTLHNDTEQRPLPKKIPWWSGIIQFLIVCGIYTVNVARYIVGSVFVVWALGFFFS
FT                   AAWVPTVPFWPICIGMIVLFSTPGKILQAALVARIATFGIRPGDYPRGGWTHLRVWSAE
FT                   RFLAYLRLDAILDTPSTPLLFRLFGCKVGKGTTLAAFPPVTGLATIGENSVLENEVDIN
FT                   GHWIEGDTFYVRDITIGDRVRVGMRTFVSPGSRIGDDVEIIPGSCVTGTVAEGRCYSGN
FT                   PLSDNGPSKTTWPSQTPKEAIAEGTVTGLGFLSHHLLYMFGLLLQSLLPVLAVLPATFL
FT                   ILPTVVDNFRYQEVFLILAAWTPFFAILTVACWLALVIITVRLCSLLIRPGYYPVHSST
FT                   GWALWMTHTLLQKTLTSTYFVYAGWLTPAFLRLLGARVGKDTEISTVETIPHLTAIGDR
FT                   CFLADHSMCTSARYNNGWVHVGTTVLGDGSFVGNSGIVGPDHDLPAESLVAVLSSTPER
FT                   PGKGTSWLGRSTRQIPRAHIDADVQRTFNPSDRLKVARAFVELFRLLPVIVAAYLDLLI
FT                   VWLGTLAYMSGGRGWGGIQAVLLWSFPIVLGAGIIASIVPIIMKWLLIGRFTAGHRTLF
FT                   STFVWRGELTDNIAELLAVPSLIRMSLGSPLYNWWLRLMGTHIGRDVWCETWWLPEFDL
FT                   ITLSDRCTINRGTVLQTHLFHDRVMALETVTMGTGSTLGPNSFILPGSSIGDRATIGPG
FT                   SLILRQDAIPNDSVWSGNPVSYVADPKSITDFDSTSQNTLPQEAVLIG"
FT   gene            complement(596437..596619)
FT                   /locus_tag="CPFRC_02845"
FT                   /old_locus_tag="cpfrc_00566"
FT   CDS_pept        complement(596437..596619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02845"
FT                   /old_locus_tag="cpfrc_00566"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00566"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28360"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241423.1"
FT                   /protein_id="ADK28360.1"
FT                   /translation="MNIGRLKTPPADYLGLPHPIKQPDDISVLWPFFSPPTPDHKQEKK
FT                   AFRPALIPIFTDLGK"
FT   gene            597123..597401
FT                   /locus_tag="CPFRC_02850"
FT                   /old_locus_tag="cpfrc_00567"
FT   CDS_pept        597123..597401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02850"
FT                   /old_locus_tag="cpfrc_00567"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00567"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28361"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241424.1"
FT                   /protein_id="ADK28361.1"
FT                   /translation="MKIRKITLTVTGAAMLAGVASAQASTYSPEPHSKEWCHNTFGDGQ
FT                   HDLCNYYNWATDAARILRQNGEDQAKDYQSAADEALRRLYEEQKRGL"
FT   gene            597783..599222
FT                   /locus_tag="CPFRC_02855"
FT                   /old_locus_tag="cpfrc_00569"
FT   CDS_pept        597783..599222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02855"
FT                   /old_locus_tag="cpfrc_00569"
FT                   /product="amino acid permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00569"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28363"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800154.1"
FT                   /protein_id="ADK28363.1"
FT                   /translation="MAHTDSSFLTADQEGYKTTLGSRHIQMMALGSAIGTGLFMGAGGR
FT                   LATAGPSLVLAYLICGFFAFFILRAVGELVLYRASSGAVVSWTREFMGERAGFVVGWVY
FT                   FMMWALTGIADTTAIAIYLKFWNLFSDVPQWTLALAALVIVLLLNLISVRVFGEMEFWF
FT                   AMIKIAAICLFMAVAIFFVVTGRVVVDQPAGLANILDHGGVFPTGFLPLIVVISGVVFA
FT                   YFGIELIGTAAGETKDAEKEMPKAVNSVIWRIIVFYCGSVLLLALVLPYTAYSAGVSPF
FT                   VTFFDSIGVPSAGTIMNLVVITAALSSLNAGLYSTGRTMRTMARAGTAPEALGAFNKRG
FT                   VPFGGIALNSAVVLVGVVINYLVPGKAFDIALNMTAICVVINWAFTIVCHMQMIKKVEE
FT                   RPAFRMPWAPVTNWLTLGFLAVIVILIASGSWDGFLTVVASVCMTPLFVLGWLATRGQV
FT                   EKRREEHTRANDIKQESVIEV"
FT   gene            599527..601008
FT                   /locus_tag="CPFRC_02860"
FT                   /old_locus_tag="cpfrc_00570"
FT   CDS_pept        599527..601008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02860"
FT                   /old_locus_tag="cpfrc_00570"
FT                   /product="methylmalonyl-CoA carboxytransferase subunit 5S"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28364"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014316507.1"
FT                   /protein_id="ADK28364.1"
FT                   /translation="MSPRKIGVTEVALRDAHQSLFATRMAMEDMVDACEDIDKAGFWSV
FT                   ECWGGATFDACIRFLNEDPWERLRTFRKLMPNSKLQMLLRGQNLLGYRHYEDLVVDKFV
FT                   EKSKENGMDVFRVFDALNDPRNLEHAMRAVKKVDGHAQGTICYTVSPLHTVEGYVELAG
FT                   RLLDMGADSIALKDMAALLKPQPAYDVIRGIKETYGEDTQINVHCHSTTGVTLVTLMKA
FT                   IEAGADVVDTAISSLSLGPGHNPTESLVEMLEGTDYTTDLDMDRLINVRDHFKAIRPKY
FT                   KEFESKTLVDTNIFLSQIPGGMLSNMESQLTAQGAGDRIDEVMREVPIVRKDAGYPPLV
FT                   TPSSQIVGTQAVFNVLMGRYKVMTAEFADLMLGYYGECIGERNPEIVEQAKAQTKKEAI
FT                   TVRPADLLEPEWDHLVEEANKLEGCDGTDEDVLTNALFPGVAPGFFKNRPEGPKNVGKD
FT                   PSKIKTRENEAVLEPITYKVTVGGRSQTVKVEPAE"
FT   gene            601024..602580
FT                   /locus_tag="CPFRC_02865"
FT                   /old_locus_tag="cpfrc_00571"
FT   CDS_pept        601024..602580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02865"
FT                   /old_locus_tag="cpfrc_00571"
FT                   /product="acyl-CoA carboxylase subunit beta"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00571"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28365"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013910998.1"
FT                   /protein_id="ADK28365.1"
FT                   /translation="MSQEPTMSERLDQLAKARHEIELGGGEAKIEKQHEKGKLTARERV
FT                   AALLDEGTFREIGMFAKHRTTHFGMDKAVAPADGVVTGSGAIFGRAVHVASQDFTVMGG
FT                   SAGETQSNKVAAMMEASATTGTPFIFINDSGGARVQEGIDSLSGYGKVFYQNVLLSGLV
FT                   PQISIISGPCAGGAAYSPALTDFIIQTRKANMFITGPGVIKSVTGEEVTADALGGADAH
FT                   MAKAGNIHFIADDDEQAVLIAQKLLSFLPQNNTEEPPVVEPDPIVTPDEELREIVPVDG
FT                   KRGYDVRDIISRVVDRGDFLEVQAGYAQNLVVGFARIVGRTVGIVANQPNVMSGVLDIN
FT                   SSDKGSQFIRFCNAFNIPLVTFVDVPGFMPGVAQEHGGIIRHGAKMLYAYSAASVPKIT
FT                   VELRKSYGGAHLAMCSKDLGADRVFAWPTAEIAVMGAEGAVNVVFRKEIEAAEDKESKR
FT                   NELIRLYKETFSTPYMAASRGLVDDIIDPAETRLHIADALEVLANKRVVRPAKKHGLGP
FT                   V"
FT   gene            602590..602853
FT                   /locus_tag="CPFRC_02870"
FT                   /old_locus_tag="cpfrc_00572"
FT   CDS_pept        602590..602853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02870"
FT                   /old_locus_tag="cpfrc_00572"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00572"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28366"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241429.1"
FT                   /protein_id="ADK28366.1"
FT                   /translation="MSELNSEQLAQLVAKLSARLDAAEAELKELRKRSDASIPEDVIIA
FT                   ISAAVSAFMGNRGTIKAVRYSRERTWAAQGRQKVQHHIPGQP"
FT   gene            602878..603240
FT                   /locus_tag="CPFRC_02875"
FT                   /old_locus_tag="cpfrc_00573"
FT   CDS_pept        602878..603240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02875"
FT                   /old_locus_tag="cpfrc_00573"
FT                   /product="biotin/lipoyl-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00573"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28367"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013911000.1"
FT                   /protein_id="ADK28367.1"
FT                   /translation="MKLNVTVNGIAYSVEVEVEEEKRQIAPIYFGGGSGATHSEPANAS
FT                   VSGVSANAVVAPLAGSVFKILVEEGEEIEAGQVLLILEAMKMETEITAPNAGTITSVRV
FT                   AVGDSVQGGQALITID"
FT   gene            603336..604520
FT                   /locus_tag="CPFRC_02880"
FT                   /old_locus_tag="cpfrc_00574"
FT   CDS_pept        603336..604520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02880"
FT                   /old_locus_tag="cpfrc_00574"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00574"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28368"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800157.1"
FT                   /protein_id="ADK28368.1"
FT                   /translation="MRNRNPHTRRLFITAAITGMAVFGSPSAGASEAVSQPAPVSAWVN
FT                   QVSEQLRGVGVATPPVDPAMIASADAAVARMQADADAFNANVHAAGAQAQAALHQIVRP
FT                   QQPQAVHPAPAPLENTQPTQKDAQGRTIPEVVKREKAFEPIIDGPNYHWRTDFLSQFMA
FT                   QHPGKVLNRVAGSWFNSPDVPAESLAAEKRGISLYGPGTPVYVGKNSLCTVAATGHDSA
FT                   GRAVAITAGHCGAVGQSVESADSWRIGPSGTVALRGDRLDYSVIELGSNAEVTNAYNGI
FT                   RVNSVGGHNPNTGETACKQGIATGHSCGHIWNKDALTSMSQICARQGDSGAPVIVGDRV
FT                   VGIVKRGAINNQALACHTPWQGPLFMPTISTNMDAVLADINAKKGVGAGFTLAK"
FT   gene            complement(604595..605401)
FT                   /gene="hisN"
FT                   /locus_tag="CPFRC_02885"
FT                   /old_locus_tag="cpfrc_00575"
FT   CDS_pept        complement(604595..605401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisN"
FT                   /locus_tag="CPFRC_02885"
FT                   /old_locus_tag="cpfrc_00575"
FT                   /product="histidinol-phosphatase"
FT                   /EC_number="3.1.3.15"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28369"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241432.1"
FT                   /protein_id="ADK28369.1"
FT                   /translation="MTSYDSDLDFALSLADAADAITFPRFESADLVVDSKPDMTPVSDA
FT                   DLACEKALRELITARYPDDAILGEEFGGDVEFKGRQWVIDPIDATKNFVRGVPAWATLI
FT                   ALLVDGTPVVGVVTAPALARRWWAASGQGAWRTFNGGTPTKLSVSRIAHLDNASLSFSS
FT                   LSGWQSLDLDQRFIDLTECTWRLRGFGDFWSYCLVAEGAVDIAAEPEVSLWDLAPLAVL
FT                   VEEAGGTFTSLTGEPGPHGGSAVASNALLHDAALDILGTKTQKPSA"
FT   gene            complement(605443..606327)
FT                   /locus_tag="CPFRC_02890"
FT                   /old_locus_tag="cpfrc_00576"
FT   CDS_pept        complement(605443..606327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02890"
FT                   /old_locus_tag="cpfrc_00576"
FT                   /product="inositol monophosphatase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00576"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28370"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800159.1"
FT                   /protein_id="ADK28370.1"
FT                   /translation="MVNMDQPRDTALHSSLTDMIATITKTFVIAHDQDSDEHLAQALVF
FT                   NAGRLAWRMREQGVSTDFKTSLSDVVTDADRAAEQFVTGVISALRPEDGIVGEEGTHKP
FT                   GTSGRTWVIDPVDGTYNFVSGSDYWCSALALVEGDPAHPDKVCFGAVHRPAMGYTWFGG
FT                   KDIPTTRDGKALPALENKSTELISMATYLNPPFIAEPALLNAWLSLAQAFLSWRMIGAG
FT                   SVDLGGVADGTLGAYVQHTVQDWDWLPGRALVEGVGGTCIKVEAAGVTWCVAANPQAAN
FT                   EIATILRGLPPAN"
FT   gene            606441..607541
FT                   /gene="prfB"
FT                   /locus_tag="CPFRC_02895"
FT                   /old_locus_tag="cpfrc_00577"
FT   CDS_pept        606441..607541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="CPFRC_02895"
FT                   /old_locus_tag="cpfrc_00577"
FT                   /product="peptide chain release factor 2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00577"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28371"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241434.1"
FT                   /protein_id="ADK28371.1"
FT                   /translation="MRPEILAALNELDATLTTIEKVMDPEELASRVRELEQQASDPTLW
FT                   DNPDHAQKVTTELSSVQAQLKKLTSLRQRIDDMPVMYELAEEEGDDTELADEELAELTS
FT                   EIESLEVKTMLSGEYDAREAVINIRSGAGGVDAADWAEMLMRMYVRWAEKNDRKVDIYD
FT                   ISYAEEAGIKSATFVVHGEYMYGQLSVEQGAHRLVRISPFDNQGRRQTSFAEIEVLPVV
FT                   EQTDHIDIPDSEVRVDVYRSSGPGGQSVNTTDSAVRLTHIPTGIVVTCQNEKSQIQNKA
FT                   SAMRVLQAKLLEKKRQEERAELDALGAGGNASWGNQMRSYVLHPYQMVKDLRTNYEVND
FT                   PQKVLDGDLDGFLEAGIRWRMAQQEQ"
FT   gene            complement(607576..608049)
FT                   /locus_tag="CPFRC_02900"
FT                   /old_locus_tag="cpfrc_00578"
FT   CDS_pept        complement(607576..608049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02900"
FT                   /old_locus_tag="cpfrc_00578"
FT                   /product="Topology modulation protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00578"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28372"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800161.1"
FT                   /protein_id="ADK28372.1"
FT                   /translation="MKIAIMGYSGGGKSTLARRLGSQLNAPVLHLDSIHFSAGWVERNL
FT                   AEESATVEAFLNAHSDWIIDGNYALLSEERRLAEADRIILVLVPRAIRLWRVFLRLVRY
FT                   YGTTRPDMARGCPEKIDCVFLKWVLWDSCTKEKRKHYAEIAEKYPGKTEIRRR"
FT   gene            complement(608110..609738)
FT                   /locus_tag="CPFRC_02905"
FT                   /old_locus_tag="cpfrc_00579"
FT   CDS_pept        complement(608110..609738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02905"
FT                   /old_locus_tag="cpfrc_00579"
FT                   /product="p-aminobenzoyl-glutamate transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00579"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28373"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014525464.1"
FT                   /protein_id="ADK28373.1"
FT                   /translation="MSTTSEQTLENKNDAPPKSQGFLGFVERAGNLLPDPFWLFVILAG
FT                   LVAISSWLGSKAGMIAINPQDNSPVAVTNLLTKDGISKMLTEAVNNFVTFPPLGVILTV
FT                   MLGVAVAEHSGFISALIRAMVTKVGPRTLTFVVALAGVTGSIASDAVYVILIPLGAMSF
FT                   RALGRSPIVGAMVAFAASSAGFNASLILNITDVLLGGISTSAAQLVDPDYHVSPLANYF
FT                   FVVASSIVLALIITLVTELFIKKKARELVDHDRIDHSALTFSNNAGDSPGAQPHREETD
FT                   DELAQEIELHPSEARALACAGGAFVLMLAAYFALLFVPFSPLYSAEGALSSPLIKAIAV
FT                   PIAMMFLGLGIVYGVAAKTITKLGDIPEFMGRGLKTLIPMIVLFFMVAQFLAWFQWSNL
FT                   GMWTAIKGAELLQQWDLPVYVLFGALVVMVAALNLAITSGSAQWALMAPVIVPMMMYIG
FT                   VSPEVSQMLFRIGDSPTNIITPMSPYFALALTFLQRYYKPAGVGTLMSLALPYSISMLV
FT                   GWFLFFVVWYFLGIPIGPGTPIHYG"
FT   gene            complement(609825..610004)
FT                   /locus_tag="CPFRC_02910"
FT   CDS_pept        complement(609825..610004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02910"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366660.1"
FT                   /protein_id="QGW57319.1"
FT                   /translation="MITLEHLSQTIVTIETLVTNGNEFPYTHDVMGDMPNSTIWSARII
FT                   TCTYLDSPSPRHPT"
FT   gene            609997..610686
FT                   /gene="ftsE"
FT                   /locus_tag="CPFRC_02915"
FT                   /old_locus_tag="cpfrc_00580"
FT   CDS_pept        609997..610686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="CPFRC_02915"
FT                   /old_locus_tag="cpfrc_00580"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28374"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_600031.1"
FT                   /protein_id="ADK28374.1"
FT                   /translation="MITFDKVTKSYKTSTRPALDNLSLTIEKGEFVFLIGPSGSGKSTF
FT                   LQLMIREENLTSGDLYLSDFHVNKLHGRQINKLRQHIGYVFQDFRLLQKKTVYDNVAFA
FT                   LEVIGTRKSRINKLVPETLEMVGLSGKAHRMPHELSGGEQQRVAVARAFVNRPLLLLAD
FT                   EPTGNLDPETSDGIMVLLNQINKTGTTVVMSTHNARAVNDMRRRVIELNLGKLVRDDAH
FT                   GVYGEAQ"
FT   gene            610708..611610
FT                   /locus_tag="CPFRC_02920"
FT                   /old_locus_tag="cpfrc_00581"
FT   CDS_pept        610708..611610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02920"
FT                   /old_locus_tag="cpfrc_00581"
FT                   /product="FtsX-like permease family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00581"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28375"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014318805.1"
FT                   /protein_id="ADK28375.1"
FT                   /translation="MKLGFVFREAFRGLGRNITMTIALIITTAISLALLATGFLVTHMT
FT                   EATKDIYLDRVEVMVQLDEDISANDKDCTSDACKQVRQKLDGQTGIESVTFRSREQSYQ
FT                   RFVEVFKDTDPQLVAETSKDALPAALHVRLVDPLDTKPLDAVRGMEQVSTIVDQVDDLR
FT                   GATDNLDAIRNATFIFAAIQAVAAVFLIVNMVQIAAFNRREEISIMRMVGASRWYTQAP
FT                   FVLEAVIAAFFGAVLSGVALFGGKEWVVDKTLKGLYDSQLIARVGNSDIWAVAPIVAVI
FT                   GVVFAAITAQVTLRWYVRK"
FT   gene            611717..612208
FT                   /gene="smpB"
FT                   /locus_tag="CPFRC_02925"
FT                   /old_locus_tag="cpfrc_00582"
FT   CDS_pept        611717..612208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="CPFRC_02925"
FT                   /old_locus_tag="cpfrc_00582"
FT                   /product="SsrA-binding protein SmpB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00582"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28376"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_600033.1"
FT                   /protein_id="ADK28376.1"
FT                   /translation="MAKKKKAANNNPVIATNRKARHDYKILESYECGIVLLGTEIKSLR
FT                   EGKASLVDAFATIDEGEVWLRNLNIPIYSMGSWTNHSPKRTRKLLMHRREIDSLMGKVR
FT                   DGNKTLVPLSLYFSGGRLKVELGLAQGKQDYDKRQDIKRRTEEREVVRELGHRVKGIHA
FT                   "
FT   gene            612345..612726
FT                   /gene="ssrA"
FT                   /locus_tag="CPFRC_02930"
FT   tmRNA           612345..612726
FT                   /gene="ssrA"
FT                   /locus_tag="CPFRC_02930"
FT                   /product="transfer-messenger RNA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: cmsearch."
FT                   /inference="COORDINATES:nucleotide motif:Rfam:12.0:RF00023"
FT                   /inference="COORDINATES:profile:INFERNAL:1.1.1"
FT   gene            613082..613804
FT                   /locus_tag="CPFRC_02935"
FT                   /old_locus_tag="cpfrc_00583"
FT   CDS_pept        613082..613804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02935"
FT                   /old_locus_tag="cpfrc_00583"
FT                   /product="carbonic anhydrase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00583"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28377"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241440.1"
FT                   /protein_id="ADK28377.1"
FT                   /translation="MSTRKSYSRRQILRALGFGAGATALAACTTGPTKASQGTGDPIAD
FT                   GINKFEDSIYPDNKKLYEDMADSQSPHTLVVTCSDSRIDAETLLSAKPGELFHLRNIAN
FT                   IVPHASKPDFGMLAPVEYAVASLEVSTIAVIGHSNCGGMAALQHLDDYAKKLPATHDWL
FT                   TRSKDVLARLEGERKAEDFSLRLERANAAAQLENLMSHPFVSDRVNAGALKLEAYHYDI
FT                   GKGDVTKFDQKKGIFVDV"
FT   gene            614414..615406
FT                   /locus_tag="CPFRC_02940"
FT                   /old_locus_tag="cpfrc_00585"
FT   CDS_pept        614414..615406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02940"
FT                   /old_locus_tag="cpfrc_00585"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28379"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836111.1"
FT                   /protein_id="ADK28379.1"
FT                   /translation="MVSRFTKFAAVFTAAGLALSACSDSGIKDSAASVQSKENTVTVQD
FT                   NYGKVEIKTPVERVVATDNRTFQVLDQWGVTPVAVPKPIAPSTVPNFLNNDQIVDLGTH
FT                   REPNLEAMVATDPDLIISGQRFSQHYKEMKKLNPGVPIVDFEPRDGEPFDAELKRQVTE
FT                   MGVIFNKEGEAKKLVKDFEDSVARAKKAYNGSDKVMAVNVSGGSIGYIAPHVGRVYGSV
FT                   FDLLGLKPALQIEGASSNHKGDDISVEAIADSNPDWIFVLDRDGAIMANDASYTPAKDV
FT                   IAKNQALAGITAVKNQKVLVAPQDTYRNESIITYTKIFNSIADAFEQGK"
FT   gene            615522..616487
FT                   /locus_tag="CPFRC_02945"
FT                   /old_locus_tag="cpfrc_00586"
FT   CDS_pept        615522..616487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02945"
FT                   /old_locus_tag="cpfrc_00586"
FT                   /product="iron chelate uptake ABC transporter family
FT                   permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00586"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28380"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300544.1"
FT                   /protein_id="ADK28380.1"
FT                   /translation="MKTHTTLAQRFNIRLLLAACAVVCLLIVSLLTGEYDIFSGGEVDI
FT                   FGITRIPRTVALVLAGAAMAMSGLVMQMITQNRFVEPTTTGTTEWAGLGLLFCMLTFPQ
FT                   ASILDRMLSAVVFSFAGTMVFFLFLRRVSLRSSLVVPIIGIMLGAVVSSVSTFVALKTD
FT                   TLQTLGVWFQGSFTSVSKGQYEVLWAVALVVVAVFFYADRLTATGLGEDIATNIGVNYN
FT                   RMVLIGTALIALATGVVTVVIGNLPFLGLIVPNLVSIFRGDDLRGNLPWVCLSGIGLVT
FT                   ICDLISRTIISPFEVPVSVVLGMFGAFVFVGLIVRQVRRG"
FT   gene            616480..617538
FT                   /locus_tag="CPFRC_02950"
FT                   /old_locus_tag="cpfrc_00587"
FT   CDS_pept        616480..617538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02950"
FT                   /old_locus_tag="cpfrc_00587"
FT                   /product="iron chelate uptake ABC transporter family
FT                   permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00587"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28381"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523837.1"
FT                   /protein_id="ADK28381.1"
FT                   /translation="MARKLVQEKTGADVQDLATTRRSGAFQTRREQRRYWIILSIVVFA
FT                   GLSCAFGLLVYKNPMPFGTQRFWLIAERRTNAIIAMAVVAFCQSLATVAFQTVTNNRII
FT                   TPSIMGFESLYRVIHTSTVFFFGSVGLMQSRTIPMFLLQLALMIGLSMMLYAWLFTGKN
FT                   SNMHALLLIGIIIGAGLGSLATFMQRLLTPSEFDVLTARLFGSISNADPVYFPIAIPLV
FT                   LVAGGILLMLARHLNLLQLGREVAINAGVNYKVLSVLILALVSVLMATSTALVGPMTFL
FT                   GFLVATLAYQCANTFDHRYVFPMAWALGFVILTSAYFVMNHIFYAQGVVSIIIELVGGI
FT                   IFLIVILKKGRL"
FT   gene            617535..618290
FT                   /locus_tag="CPFRC_02955"
FT                   /old_locus_tag="cpfrc_00588"
FT   CDS_pept        617535..618290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02955"
FT                   /old_locus_tag="cpfrc_00588"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00588"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28382"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655177.1"
FT                   /protein_id="ADK28382.1"
FT                   /translation="MIRLEQVAKNYNSEVSIGPVELEIPQGGITAFIGPNGAGKSTLLT
FT                   MIGRLLPIDAGQISVAGYDVAATKSQDLAKIISILRQENHFITRLSVRQLVGFGRFPYS
FT                   KGKLTKQDEEIVSRYIDFLNLRPLENRYLDQLSGGQRQRAYVAMVLAQETDYVLLDEPL
FT                   NNLDIAHSVEMMRHLRDIARDLGRTVIVVLHDINFAARYADYICAVKDGSVVHFGPVAS
FT                   AMDSEVLTRIFNTPVRVIDGPDGPLACYH"
FT   gene            complement(618697..619008)
FT                   /locus_tag="CPFRC_02960"
FT   CDS_pept        complement(618697..619008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02960"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014301030.1"
FT                   /protein_id="QGW57320.1"
FT                   /translation="MIIQQKTMKKVQQNSDHRCLDETTQQSPNTHTTTPQAQHPEHHST
FT                   SITRFHSHQHPHNTTSCTHQHHNNASCQQHFFHKQHNLLQASHTCRSILHHRDHHTTM"
FT   gene            619097..620624
FT                   /locus_tag="CPFRC_02965"
FT                   /old_locus_tag="cpfrc_r001"
FT   rRNA            619097..620624
FT                   /locus_tag="CPFRC_02965"
FT                   /old_locus_tag="cpfrc_r001"
FT                   /product="16S ribosomal RNA"
FT   gene            620986..624064
FT                   /locus_tag="CPFRC_02970"
FT                   /old_locus_tag="cpfrc_r002"
FT   rRNA            620986..624064
FT                   /locus_tag="CPFRC_02970"
FT                   /old_locus_tag="cpfrc_r002"
FT                   /product="23S ribosomal RNA"
FT   gene            624182..624298
FT                   /gene="rrf"
FT                   /locus_tag="CPFRC_02975"
FT                   /old_locus_tag="cpfrc_r003"
FT   rRNA            624182..624298
FT                   /gene="rrf"
FT                   /locus_tag="CPFRC_02975"
FT                   /old_locus_tag="cpfrc_r003"
FT                   /product="5S ribosomal RNA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: cmsearch."
FT                   /inference="COORDINATES:nucleotide motif:Rfam:12.0:RF00001"
FT                   /inference="COORDINATES:profile:INFERNAL:1.1.1"
FT   gene            complement(624438..625606)
FT                   /pseudo
FT                   /locus_tag="CPFRC_02980"
FT   CDS_pept        complement(624438..625606)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02980"
FT                   /product="pyridoxal phosphate-dependent aminotransferase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800170.1"
FT   gene            complement(625606..626247)
FT                   /locus_tag="CPFRC_02985"
FT                   /old_locus_tag="cpfrc_00591"
FT   CDS_pept        complement(625606..626247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02985"
FT                   /old_locus_tag="cpfrc_00591"
FT                   /product="DUF3239 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28385"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558619.1"
FT                   /protein_id="ADK28385.1"
FT                   /translation="MQKFSFPINADYAKKNNELLKDTKRLQLSAGLFGLIQVLIGVALF
FT                   LVLGGIFGGIVFTLFIVMALISFAMIAIIPKKVGTAESLYQNYPLAAGMIAEVNPRDFV
FT                   VMALVNANVDEQAPPAWALATRSITNLEGVERAVGVRIPVVAVAGQRSVHSQDTWDQIS
FT                   PMPIGWATTDPTVVERAIEEIPDEQWKILEKNLTRLEDVKETKFDLLVID"
FT   gene            complement(626314..627963)
FT                   /locus_tag="CPFRC_02990"
FT                   /old_locus_tag="cpfrc_00592"
FT   CDS_pept        complement(626314..627963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02990"
FT                   /old_locus_tag="cpfrc_00592"
FT                   /product="helicase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00592"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28386"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241449.1"
FT                   /protein_id="ADK28386.1"
FT                   /translation="MAFGDGPLIVQSDKTVLLEIDHPQADPARAALAPFAELERAPEHI
FT                   HTYRITPLALWNARAAGHDAEGIVDVLETFSRFPVPQALLIDVAETMSRYGRVRLHKHP
FT                   AHGLILESAEPAILAELIRHKKIRPMLGAQIDEETIVVHPSERGRLKQELLKVGWPAED
FT                   LAGYVDGEAHPIALSQEHEHWELRDYQRMAADSFWEGGSGVVVLPCGAGKTMVGAASMA
FT                   RAQATTLILVTNTVAGRQWRDELLRRTTLTPEEIGEYSGEKKEIRPVTIATYQVVTRKT
FT                   KGEYRALELFDSRDWGLIIYDEVHLLPAPVFRMTSDLQSRRRLGLTATLVREDGREGDV
FT                   FSLIGPKRYDAPWKDLEQRGFIATAECTEVRTTMTHEERMLYATAENQDRYRIAACAES
FT                   KLRAVDTLLHRHQGLPTLIIGAYIDQLEELGARFDAPVIEGKTSNKKREELFNKFRAGH
FT                   ITTLVVSKVANFSIDLPEAAVAIQVSGTFGSRQEEAQRLGRLLRPKADGSEAHFYSVVS
FT                   RDSLDSEYAAHRQRFLAEQGYAYRIVDAADLG"
FT   gene            complement(628079..630577)
FT                   /locus_tag="CPFRC_02995"
FT                   /old_locus_tag="cpfrc_00593"
FT   CDS_pept        complement(628079..630577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_02995"
FT                   /old_locus_tag="cpfrc_00593"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00593"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28387"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366675.1"
FT                   /protein_id="ADK28387.1"
FT                   /translation="MSPHGLLAPATLATSSVTACPPPGTCAGQPGSTYPFFSMFAMCPI
FT                   VSNFKGKSHLKEQLNWNTIMCSSPAPYKWPINFREWLSSLNEENLTVILKNRPDVTHPI
FT                   PPGISSLAARLQLRASLARALMSLNAFELLTLEAASFLGAELEPVIAPNLVDALRQYLG
FT                   AQTPDNLDLLVEEAVSELLSRALLYGSTVSFKVVPEAINALPTGWQLFGVRAQEETDFQ
FT                   HALASVDERDRKVLNTLDQSGGTGITKDAAPDADPQRPIPRMIAQGLLIRIDDTTVRLP
FT                   MPVRYLLRGQQPPLIPVLPNPRVEFSASSKNDENSAGTGLEIVRLMRILLRGLGHDPMP
FT                   LLKDGVLGVRSVTALTRILDSNELTALRVLSLALSCNLVARGVPDPLPSDDTGGDYLCP
FT                   THHADTWLVSPLSHQWSQLIYGWYFHGTLRPWVVNTLDDRGKPQRFLSPATWNEKLPTL
FT                   RKLTLSTAAQHCTSSGISDHSLRANIGFAAPLRVSRVSPEHIDQLIAEARWLGVLTANN
FT                   GTTSVLDALVKETEATALSRLDQITQSLTPAEVTQLIPQADMTILAPGPLPQLLMQEMT
FT                   LVGEAESMGLASVYRITESSIRRALDAGRTPEELTGFLKAHVLGELPQSIAYLIADVAR
FT                   RHGSLRGGPAMSYLRCSDEALLLEASRTPAAEIIGLRLIAPTVAVSQAPLVRVLQALRE
FT                   EGFHPVAEDANGISIDIRPAPSRVSATLPQQHPDKDNESHIAAAIASILRHDAAKEAAA
FT                   TGTKATVHDSGVLSALQSAIRAKRTVTLGFVDKHGQAAQRVVTPITVSSGQLSAVDPID
FT                   GAMHRFTIHRITEVVINQPE"
FT   gene            complement(630818..631441)
FT                   /locus_tag="CPFRC_03000"
FT                   /old_locus_tag="cpfrc_00594"
FT   CDS_pept        complement(630818..631441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03000"
FT                   /old_locus_tag="cpfrc_00594"
FT                   /product="DUF3235 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00594"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28388"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241451.1"
FT                   /protein_id="ADK28388.1"
FT                   /translation="MARHARKSASALAKIAASTVAVGSAATLFAPAASAAPDSDWDRLA
FT                   GCESGGNWAINTGNGYYGGIQFSASTWKGFGGGQYAPTADKATREQQIAVAEKVLASQG
FT                   WGAWPSCSAKLGLNSAPTPRDSVASAPAPLQQIVDDAQNYAAASGQNADKLAVDAVYKA
FT                   VKDRLAGYGIGVHPEIDAFYQANNNNFDAFYQANRQVIDTAMGM"
FT   gene            632266..632658
FT                   /locus_tag="CPFRC_03005"
FT                   /old_locus_tag="cpfrc_00596"
FT   CDS_pept        632266..632658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03005"
FT                   /old_locus_tag="cpfrc_00596"
FT                   /product="cold shock domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00596"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28390"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366677.1"
FT                   /protein_id="ADK28390.1"
FT                   /translation="MPIGRVRWYDPEKGYGFVSNPGDEDCYVGKNVLPAGVDKLEKGQR
FT                   IEFDFAAVGKKPQALRIKILETPKTRRPQHRHKHSPEELHGMVSDLVTILELKVQPSLR
FT                   SGRFPERKDGRQIAGILRAVAKELDS"
FT   gene            complement(632727..633254)
FT                   /locus_tag="CPFRC_03010"
FT                   /old_locus_tag="cpfrc_00597"
FT   CDS_pept        complement(632727..633254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03010"
FT                   /old_locus_tag="cpfrc_00597"
FT                   /product="DUF2771 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00597"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28391"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241454.1"
FT                   /protein_id="ADK28391.1"
FT                   /translation="MASRKTRRRNLIQIAALIAAVAVVVAGSIAFQTWWNKRPEKEPRD
FT                   IAIEFSSPTASQEVFPFSICEPGVECPENSVPVITMSADQELTVKVPPQVSDHDWSLLK
FT                   IYDDPAANDQSFYAAHDANEIKVSGSASLKKDAQSLAKLVVVEVSSVLIGHDDKGDETP
FT                   YTVTWSVHVTVT"
FT   gene            complement(633283..634224)
FT                   /locus_tag="CPFRC_03015"
FT                   /old_locus_tag="cpfrc_00598"
FT   CDS_pept        complement(633283..634224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03015"
FT                   /old_locus_tag="cpfrc_00598"
FT                   /product="glutamine cyclotransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00598"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28392"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522368.1"
FT                   /protein_id="ADK28392.1"
FT                   /translation="MRLHRFARAMSSFSPLLAQIRRPHTLHKNRISIKVFSVGFLSITF
FT                   GITACASPPKPSQQSEELLERPVELQAEIISRHDFDAQSFTQGLEVDGEGLVVGTGGYG
FT                   TSSIYRTSVDNIQATRTQLPESFFGEGITVTKGSSRKIWQLTWKNNVAIQRDPDSLEEI
FT                   TRVTYQGEGWGLCAFSDRLIMSDGTSDLRVLNPVTFQEIKRIPVRMINAQGRPMPVEGI
FT                   NELECVPSGPGAQTDTVYANRFLSTDILGIDAASGSVKKLIDASRIPNNAQPDIDNVLN
FT                   GIAHIPGTDNFYITGKRWPDLYRVRFVHHVSP"
FT   gene            634281..635015
FT                   /locus_tag="CPFRC_03020"
FT                   /old_locus_tag="cpfrc_00599"
FT   CDS_pept        634281..635015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03020"
FT                   /old_locus_tag="cpfrc_00599"
FT                   /product="DUF3027 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00599"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28393"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241456.1"
FT                   /protein_id="ADK28393.1"
FT                   /translation="MPNRRNTKNSQSGPLLSAKALSIARHALEELGEGEVGAHIGVRNV
FT                   NETSATHRFVADLPGYNGWEWNVVLACASGSRWVTVSELALLPGQEALRAPDWVPYHQR
FT                   VQPGDLGPNDFMPPRPDDPRLTDDSDQAAYDFGTLKKLTKVGIQTASERWKDGAFGPSS
FT                   EYARKAVHNCGGCAFYFPLAEPVGKDFGVCVNEYSADGRVVHTTYGCGAHTDTPPAEPL
FT                   GVVENSPFDDEKPEIFPSGANQ"
FT   gene            635229..636707
FT                   /locus_tag="CPFRC_03025"
FT                   /old_locus_tag="cpfrc_00601"
FT   CDS_pept        635229..636707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03025"
FT                   /old_locus_tag="cpfrc_00601"
FT                   /product="NCS2 family permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00601"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28395"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241458.1"
FT                   /protein_id="ADK28395.1"
FT                   /translation="MASMPISDQAAPKQTEKSRGAFDRYFKISERGSTIGTEVRAGVVT
FT                   FFAMAYIIILNPLILGTSPDSEGTVLGIPQVAAATAFVAGVMTILFGVIAKYPFGIAAG
FT                   LGINTLVAVSMVATEGLTWSEAMGLVVLDGVIIVILAISGFRQAVFDAIPKPMIAAMSV
FT                   GIGMFIALIGLVDAGFVRRLPDAAHTTVPVGLGTNGSIASWPTFVFIIGLLICGFMVIR
FT                   NIRGGLFIGIVATTIIGMIVEALTGAGSSVNNPTGGWSLAIPMIPEGFGGIPDLSLIGN
FT                   VSIFGAFARVGVLAATLLLFTLVLANFFDAMGTMTALGKQARLVNDDGVLPDMKKALVV
FT                   EGAGAIIGGGASASSATVYVDSAAGIADGARTGLANVVTGLLFLLAMFLTPLYEVVPIE
FT                   AAAPVLVVVGAMMIGQVSEIDFTKFNIALPAFLTIVIMPFTYSIANGIGVGFIAFTLMT
FT                   LFAGKAKEIHWIMWLVSALFVVYFSIDPIMSALG"
FT   gene            636794..637666
FT                   /locus_tag="CPFRC_03030"
FT                   /old_locus_tag="cpfrc_00602"
FT   CDS_pept        636794..637666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03030"
FT                   /old_locus_tag="cpfrc_00602"
FT                   /product="RNA methyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00602"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28396"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241459.1"
FT                   /protein_id="ADK28396.1"
FT                   /translation="MTEQPTPPAFNIVHIADAEDTRLDDFRDLNHSDNRPDLPGGKGLV
FT                   IAEGPLVVGRLLQSRFPVRCLIGFPAKLESFLSDPAMAELVRDIPVYSLDRETLASVAG
FT                   FDMHRGLLAAADRVAGLSIEEAVSTARTVAILEGVGDHENIGSMFRNAAGMGVDAILFG
FT                   NGCADPLYRRVVRVSMGHVLRTPFAHFGGKRTTWQRELEGLKAAGFHLVSLTPHPEAVH
FT                   LADALVDATGQPYDKVALLVGAEGPGLTEHAMRATDVRARIPMAPGTDSLNLATSAAIA
FT                   FYERDRSLR"
FT   gene            complement(637667..638569)
FT                   /locus_tag="CPFRC_03035"
FT                   /old_locus_tag="cpfrc_00603"
FT   CDS_pept        complement(637667..638569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03035"
FT                   /old_locus_tag="cpfrc_00603"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00603"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28397"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800176.1"
FT                   /protein_id="ADK28397.1"
FT                   /translation="MNAPDYGDPSTPRHDAVVTLWFVTTADPGAVIAKQPRADRGFGRK
FT                   LLAQLNPRWPITPIGQFSLNRSAQASPQEFYIAGFEGLSIIQTGVADATRLSELNPKLH
FT                   SCIPAADVYAFAINEETGLGAFAHWTGDTLRRSFSARRERVYEDLGLPEPFENPYWAGE
FT                   KAEDSGGITLPFWPIELVREAQRQWLGFDVEGASDINVAAFAIDGRPEPKLVDHPSDQK
FT                   KSIQSLVTTASSKLGLGESRSDYDDYEQHGSEPTVAAELARYAEVSKDVAQNLAVTAGK
FT                   KIRVFSHKLAEKLRHTDRP"
FT   gene            complement(638631..639716)
FT                   /locus_tag="CPFRC_03040"
FT                   /old_locus_tag="cpfrc_00604"
FT   CDS_pept        complement(638631..639716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03040"
FT                   /old_locus_tag="cpfrc_00604"
FT                   /product="DUF3071 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00604"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28398"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241461.1"
FT                   /protein_id="ADK28398.1"
FT                   /translation="MQELVLIPSESTKTSLVFHAAESPEDQYFLVVDDSLRAALLGKTS
FT                   EDSSPMPAPPDSAADNAETDSQVDKVEPPCESEEAHPADNAVASIAPGANGQRELRTKE
FT                   MDPRLSTPLAMRPREIQDRIRGGATVAQLAEENGVTESRIEPYAHPVLLERARIADMAK
FT                   QSHPVRDDGPARLTLWEVLATAFAARGLDLSTTQWDAYRDASGQWIATVSWKSGVSDLT
FT                   AEWSYHRNSMSSTTAIARNGIAADLIDPDFIQPVRTISPVGRPRAVDVFENTQDFEPTK
FT                   EKHAESDIEKTRDDLPPVTEVQEPHREVSAQDSLEVSGEEFLQHPDQQPKAPSKRRRKA
FT                   VTPHWEDVLLGVRTNTKRPRS"
FT   gene            complement(639894..641027)
FT                   /gene="serC"
FT                   /locus_tag="CPFRC_03045"
FT                   /old_locus_tag="cpfrc_00605"
FT   CDS_pept        complement(639894..641027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="CPFRC_03045"
FT                   /old_locus_tag="cpfrc_00605"
FT                   /product="phosphoserine transaminase"
FT                   /EC_number="2.6.1.52"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28399"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655188.1"
FT                   /protein_id="ADK28399.1"
FT                   /translation="MSEFPVLPSDLIPSDPRFGCGPSKVRTEQLLAITEKGRTVMGTSH
FT                   RQPAVKNVVGNIREGLASLFNLPDGYEIILSLGGATAFWDCAAFGLIQSKSGHLTYGEF
FT                   SGKFATAAAKAPWLQDPTIISAEPGDAPTPVALDGCDVLAWAHNETSTGAMVPVVRPTG
FT                   SEGQLVVIDATSGAGGLPVELDHADVYYFSPQKCFASDGGLWFAAMSPAALERIQKINS
FT                   SDRFIPDFLNLQTAVDNSRKNQTYNTPAVSTLLMLEQQVQWMNNQGGLPAMVQRTTASS
FT                   DVLYQWAEARLETTPFVAAPEKRSLVVGTVDFDDSIDAAQVARILRAHGILDVEPYRKL
FT                   GRNQLRVGMFPAIETSDVRILTSAIDYILDNSLALAS"
FT   gene            641681..642991
FT                   /locus_tag="CPFRC_03050"
FT                   /old_locus_tag="cpfrc_00607"
FT   CDS_pept        641681..642991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03050"
FT                   /old_locus_tag="cpfrc_00607"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.16"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00607"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28401"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_600058.1"
FT                   /protein_id="ADK28401.2"
FT                   /translation="MEREAVATDNKDKAVLHYPGGEYEMDLIHASEGNDGVVLDKLLSE
FT                   TGLVTFDPGYVSTGSTESKITYIDGDNGILRHRGYDIADLAENATFNEVSYLLIKGHLP
FT                   TLDELHSFNSEIRHHTLLDEDFKAQFNIFPRNAHPMSVLASSVNILSTYYQDQLDPLDE
FT                   AQLDKATVRLLAKVPMLAAYAYRASKGAPYLYPDNSLNARENFLRMMFGYPTEPYEVDP
FT                   VVAKALDKLLILHADHEQNCSTSTVRMIGSAQANMFVAIAGGINALSGPLHGGANQAVL
FT                   EMLDDIAQNHGGDATDFMNRVKNKEKGVRLMGFGHRVYKNYDPRAAIVKETAHEILEHL
FT                   GGDELLDLAMKLEEIALSDDYFVSRKLYPNVDFYTGLIYRAMGFPTDFFTVLFAIGRLP
FT                   GWIAQYREQLATTTKINRPRQIYTGETLRKVTPREQR"
FT   gene            643174..643533
FT                   /locus_tag="CPFRC_03055"
FT                   /old_locus_tag="cpfrc_00608"
FT   CDS_pept        643174..643533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03055"
FT                   /old_locus_tag="cpfrc_00608"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00608"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28402"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014317711.1"
FT                   /protein_id="ADK28402.1"
FT                   /translation="MEKPQIEVPEGPAPEDIVILDVVEGDGPEAQPGGLVEVHYVGVDF
FT                   ETGQEFDSSWDRGQSIEFPLSGLIAGWQEGIPGMKVGGRRQLTIPPEAAYGPAGGGHPL
FT                   SGRTLVFMIDLLNVG"
FT   gene            complement(643607..645112)
FT                   /locus_tag="CPFRC_03060"
FT                   /old_locus_tag="cpfrc_00609"
FT   CDS_pept        complement(643607..645112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03060"
FT                   /old_locus_tag="cpfrc_00609"
FT                   /product="acetyl-CoA carboxylase carboxyl transferase
FT                   subunit alpha/beta"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00609"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28403"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558622.1"
FT                   /protein_id="ADK28403.1"
FT                   /translation="MTRTSAHQLITDVLDHNSFCSWDTPPRYGKISASYQQALANACEK
FT                   SGVDESVITGEGTVHGHRVAVILSEFSFLGGSIGAATARRIINAINRATAERLPLLISP
FT                   SSGGTRMQEGTPAFALMVSITTAVYRHKDAHLPFLVYLRNPTTGGVMASWGSAGHFTFA
FT                   EPEALLGFLGPRVVELTTGTPIPKGIQSGENLAAKGVIDGVISPQQLRAALNKIVNVLL
FT                   IPSTNSSHSHPPISKEIPIPSAWEAITATRKRDRPGIQALLSAIGDANYIELSGSGDGR
FT                   ISPSVVVALARIEGRTVVIVGQDRHSQPPFADSQLGTEALRFARRGIQLAHDLQLPLLS
FT                   VIDTPGAELSAHAEETGMAGSIARTLGEIVSVDVPTVSVILGQGCGGGALALLPADKVL
FT                   ASSHAWLSPLPPEGASAIIYRDIDHAPTMMEEQGVSAFALAATGIVDAIIPELPDAADE
FT                   PLLFSERVLRSISDAFTELQLAPQRVGREQRLRHYEKLADALS"
FT   gene            complement(645290..645910)
FT                   /locus_tag="CPFRC_03065"
FT                   /old_locus_tag="cpfrc_00610"
FT   CDS_pept        complement(645290..645910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03065"
FT                   /old_locus_tag="cpfrc_00610"
FT                   /product="superoxide dismutase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28404"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241467.1"
FT                   /protein_id="ADK28404.1"
FT                   /translation="MSRTLALRAAVALVGVSSIAVLSACSSSTTTKDSADKAMTSAAST
FT                   ASNSHAFATAELKNQSGEGVGMVEFSKTAAGTKITVDAKGLTPGFHGFHVHDKGVCEGN
FT                   FKSAGGHLHGKNQPHGDGYHPHAGDLPSLLANADGTAHLEVVTDAVDEDLLFGADGTSL
FT                   IVHEGRDNYANIPQRYAPNGPDEETLKTGDAGARFACGVITKK"
FT   gene            646349..647209
FT                   /locus_tag="CPFRC_03070"
FT                   /old_locus_tag="cpfrc_00611"
FT   CDS_pept        646349..647209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03070"
FT                   /old_locus_tag="cpfrc_00611"
FT                   /product="aldo/keto reductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00611"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28405"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523142.1"
FT                   /protein_id="ADK28405.1"
FT                   /translation="MIDAQSVPTVTLNDATEMPVIGLGTWELRGEGAVTAVRTAIDLGY
FT                   RHIDTAALYKNEQEVGRAIHDAIASGDVTRDELFITTKAWNDMHGADKVQRAFQDSLTR
FT                   LGLDYVDCYMVHWPCPQKGLYVETFESVAKLQGLGQLRSVAVANFHPEVLEEVTRETGI
FT                   APAVNQVELHPGFSQPDQREVHRKLGVLTEAWSPLGRGESLSEPTVVAIAKNHGKSPAQ
FT                   VILRWLVQLECSVVPKSAHPDRQRENIDIFDFELNEEELKALTALDETGGRLFPDPREW
FT                   PGLKG"
FT   gene            647275..647961
FT                   /locus_tag="CPFRC_03075"
FT                   /old_locus_tag="cpfrc_00612"
FT   CDS_pept        647275..647961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03075"
FT                   /old_locus_tag="cpfrc_00612"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00612"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28406"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300553.1"
FT                   /protein_id="ADK28406.2"
FT                   /translation="MFEQTRDDDASRALKEIETVKVSSDGFVRHIVLDRDDRRNALSGD
FT                   MCRAIAHAVTEASAAAVDNASVRAIMISGVGRAFCAGADLGSSVREGGEHSSDGAVYGA
FT                   GFHDALFAMLHSIIQAEVPIIANVQGAAVGAGMQLALACDLRVVGESAWFKVPAVSLGF
FT                   ALDGWTIGRAQKLCGGAFARNLLLAGASLTPDAALSSGFAAIRGDHAAAVAFAHEVAGL
FT                   APLSVR"
FT   gene            648514..648855
FT                   /locus_tag="CPFRC_03080"
FT                   /old_locus_tag="cpfrc_00613"
FT   CDS_pept        648514..648855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03080"
FT                   /old_locus_tag="cpfrc_00613"
FT                   /product="DUF485 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00613"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28407"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366690.1"
FT                   /protein_id="ADK28407.1"
FT                   /translation="MSAPTEAHGVRQPTDAEFRAMQVSPQFKELKRTYRSFTFPMSIAF
FT                   FVWYLVFVIAATYAPDFMGTKVVGSINLGVVLGITQFVTTFVITWIYIKYANKNIEPRA
FT                   RAIREEMEG"
FT   gene            648859..650502
FT                   /gene="actP"
FT                   /locus_tag="CPFRC_03085"
FT                   /old_locus_tag="cpfrc_00614"
FT   CDS_pept        648859..650502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actP"
FT                   /locus_tag="CPFRC_03085"
FT                   /old_locus_tag="cpfrc_00614"
FT                   /product="cation/acetate symporter ActP"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00614"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28408"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800184.1"
FT                   /protein_id="ADK28408.1"
FT                   /translation="MTTSYVAAESSAGNPVLNIVVFVAFIVITMAVVLRAGKTTKEASD
FT                   FYTGGGTFSGKQNGLAIAGDYLSAASFLGIVGAIALSGYDGFLYSIGFFVAWLVALLLV
FT                   AEPLRNVGRFTMADVLSFRLKQKPVRVAAAFGTLFVSLFYLIAQMAGAGALVSVLLDLH
FT                   SKAAQSIVVAVVGVIMIVYVLIGGMKGTTYVQMIKAVLLVGGVTIMTVLVFVMVKGGFS
FT                   NLFDQAVSTHAASDYLAKKGYDASQILEPGLKYGATATSKLDFLSLGIALVLGTAGLPH
FT                   VLMRFYTVPTATEARRSVTWAIVLIGAFYLMTLVLGFGAAALVGPDRIMSAPGTANAAA
FT                   PLLALELAGPVFMALISAVAFATVLAVVAGLAITASASVAHDIYDAVLRNGQSTEEEQV
FT                   RVSRITVIVIGVAAIALGILAMQQNVAFLVSLAFAIAASANLPTILYSLYWKKFNTTGA
FT                   IASIYTGLGAALLLIVFSPAVSGSPTSMIPGVDFAWFPLTSPGIVSIPLAFLAGYIGTL
FT                   VGKPDNFDDLQAEMEVRSLTGVGVEAPVDH"
FT   gene            650649..651478
FT                   /pseudo
FT                   /locus_tag="CPFRC_03090"
FT   CDS_pept        650649..651478
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03090"
FT                   /product="hypothetical protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366692.1"
FT   gene            complement(651521..652429)
FT                   /locus_tag="CPFRC_03095"
FT                   /old_locus_tag="cpfrc_00617"
FT   CDS_pept        complement(651521..652429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03095"
FT                   /old_locus_tag="cpfrc_00617"
FT                   /product="DUF1906 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00617"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28411"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523145.1"
FT                   /protein_id="ADK28411.1"
FT                   /translation="MPNFDTPISRRRFLKASAALMSGAAALAVAPTASATPGPIVGTVI
FT                   DFAAGVPRAHDIKAAGHIGAVRYVSQRRPGTEGWMLGKPVTLAETKANADLGLATASVY
FT                   QFGKDATADWKQGAAGAVVHAPQAIALHIAAGGPKGRPIYVAIDDNPTRAQYDHQIRPY
FT                   LQAFGTALNAAGYSLGIYGNYNVIDWALADRLGSFFWQHDWGSNGRIHPRTTIHQKAGY
FT                   AGKISGVGVDINNVYASDWGQWVPGVAPAAPPVSPGNPAPVVPGLPDLQQLSSQLPANI
FT                   PTPSQAQINAALDLIKMFSPR"
FT   gene            complement(652668..653942)
FT                   /locus_tag="CPFRC_03100"
FT                   /old_locus_tag="cpfrc_00618"
FT   CDS_pept        complement(652668..653942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03100"
FT                   /old_locus_tag="cpfrc_00618"
FT                   /product="cation:proton antiporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00618"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28412"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655192.1"
FT                   /protein_id="ADK28412.2"
FT                   /translation="MLYASSASSAEIILVSEVNQTDTLVSFVWIMAAALVAPLISYATG
FT                   KRIPAVVLLIAFGCLIGPHVLGLASEAGGVGLIKEIGLGMLFLLAGYEIDPETLRGKEG
FT                   RSGLSTWIICAVLSFLGAFAILGFDNSSTAIVLAIAVTSTAIGTLLPIMKQQNLLNTPV
FT                   GSSLMIHGAIGEIAPILAMALLLSARSTWMTAAVLFAFFLVAIVVGILPKTVKLFLPWM
FT                   GRAMVDGAGSTNQTVLRLILLMLAILMAVAAVFELDVVLGAFAAGFILRQMVPQKYRTA
FT                   LEQRLDVVGYSLLIPVFFICSGMSINPAAVAEKPWFLLVLIPLIYITRGLPVFLREMFF
FT                   STGSGLKDWREKLQLSLFAATALPIIVAVTEVATASHILSHENASIMVAAGSITVLLFP
FT                   LLASHLKPAKAYMESEQQGPDASRP"
FT   gene            complement(654029..654610)
FT                   /locus_tag="CPFRC_03105"
FT                   /old_locus_tag="cpfrc_00619"
FT   CDS_pept        complement(654029..654610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03105"
FT                   /old_locus_tag="cpfrc_00619"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00619"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28413"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800187.1"
FT                   /protein_id="ADK28413.1"
FT                   /translation="MPEPTPQPTHNPYPQQLPAKKKGGCFKWGAIVGGCLLVLQIASML
FT                   GDGDSTDISAVSPTTQQQAIKNIAAAPQETKAAITPSPANAATTPSVPREFKNALRSAE
FT                   QYSKLMHMSKAGIYDQLTSEYGEKFSAEAAQYAIDTIKVDWNKNALESAKKYQDSMAMS
FT                   SDAIYDQLVSEYGEKFTPEQANYAISNLPQ"
FT   gene            complement(654962..656380)
FT                   /locus_tag="CPFRC_03110"
FT                   /old_locus_tag="cpfrc_00620"
FT   CDS_pept        complement(654962..656380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03110"
FT                   /old_locus_tag="cpfrc_00620"
FT                   /product="MATE family efflux transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28414"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241477.1"
FT                   /protein_id="ADK28414.1"
FT                   /translation="MRLISSGSQDLSSLHRQLLRLSLPLAGTQLANIALSATDTIVMGY
FT                   LSVAALAGGGLAVIWFNQIRTMAVGLLTPLGNRIAQVHAQYEQNPSSELQQDIRNLTRT
FT                   GLFLATASGIIGAILLVLISYALPLFGQPSEVTDAAIPMMWALAPGLIPCLWFQVSRQF
FT                   CVGLGKPQSLLGITLAMVVVNALLNFVFAFGYGPFPELGLVGIGLSTTLVHCASAAAYF
FT                   VLINRNPEINEFHAIDFWRRDATAFRSQLLPQLRTQLRLGAPVSATYGAEAGMFSVLAL
FT                   IMGSFGADALAAHNVVYQVTFIVFQIGIGFSHGSSILVSRAYGLHDIPLSRRIGLQALT
FT                   IMMVVVSVAAIFFLFTPELVLRPFMRDATPEALALAVSLLMIGALMEFVDTGQNLAIGA
FT                   LRGINDTSTGLKASLLGYWVVGLPAALAFAYGFDLGPHGIWWGLVTGLATSAFLLWATF
FT                   LRKTQDPESNRLST"
FT   gene            complement(656371..657441)
FT                   /locus_tag="CPFRC_03115"
FT                   /old_locus_tag="cpfrc_00621"
FT   CDS_pept        complement(656371..657441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03115"
FT                   /old_locus_tag="cpfrc_00621"
FT                   /product="pyridoxal-phosphate dependent enzyme"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00621"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28415"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013911043.1"
FT                   /protein_id="ADK28415.1"
FT                   /translation="MTNTVVTRVSQLIGNTPLFELVATPSGSRVLLKLEQFNPSGSAKI
FT                   RMAESMIDAAEADGRLQAGGTIVESTSGNTGQGLAILAVERGYEFVAVVDNHSCKDKLN
FT                   AMSAMDTKLEYVAAEGDDALATSAREDYAEELGQQPGWVFMKQHDNEANSKGYYPAADE
FT                   IIETLGHCPSHLISAVGTGGSLFGVTERLNELGYRPHTIGVEPEGSIAFGGPAHDYRQS
FT                   GTGTPEGAVIGTAVRYDLLDLGAKVSDIAAFAACRTIAKHTGLLLGGSAGGAVVAALEL
FT                   LPTLPAGSTSVTMVCDGGEKYLDTVFNDSWMRSHNLLDSDLEEQIWKHITTLREGRTPT
FT                   PLKLTRISWSKEKTCV"
FT   gene            complement(657438..658796)
FT                   /locus_tag="CPFRC_03120"
FT                   /old_locus_tag="cpfrc_00622"
FT   CDS_pept        complement(657438..658796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03120"
FT                   /old_locus_tag="cpfrc_00622"
FT                   /product="ornithine decarboxylase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00622"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28416"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800189.1"
FT                   /protein_id="ADK28416.1"
FT                   /translation="MVAAPLCRMPIPHWQEELAYSSTLESIAHAARGPFHVLYPQNFTD
FT                   TARLWLDTAADTGITFGLRFGKKSNKAGCFARNLADLYAQGNNAGIDVASTDELRAALC
FT                   AGLPGEQLVVTGPTPTAELIRLASYHGSLITISRPEDIDVIAGTIYNIKPTKSLRILLR
FT                   LSSDGVHTRFGMSLEQSYAVAQTLESGRYQDLPLDIAGVSFHCNGYDLDERIRMAHKAT
FT                   DAVLKLREWSSASIVSIGGGFPTSSISPELWNAVTEQLTPSMFVTGRVPGDQYPFAANC
FT                   AGAEALRYILTQGTTSLKDKAISHGITILAEPGRSLCQAAGASYFPVLSCHELPNTEGN
FT                   VTVVEGTSLSLSEQWFDSEYYPDPYLIRAGKILSQGNPTDSAVAGSTCLDSDYLSRRFI
FT                   RFPDRPQPGDILVYPDTAGYQMDSNESSFHGKEPPKKFVFSTTPHHHFTEDFS"
FT   gene            complement(658790..659776)
FT                   /locus_tag="CPFRC_03125"
FT                   /old_locus_tag="cpfrc_00623"
FT   CDS_pept        complement(658790..659776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03125"
FT                   /old_locus_tag="cpfrc_00623"
FT                   /product="ornithine cyclodeaminase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00623"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28417"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558624.1"
FT                   /protein_id="ADK28417.1"
FT                   /translation="MISSLRILRNADLSHVAVAPQSVLNAVRTALTELGHGAAECPEKI
FT                   TVKVPTSVNYSMLGRSSALSTVGFKTSFTHWGPHNAEGHREKSYATTLTLYDDTTGAPI
FT                   AMMDGAPIGALRTPAVSAILAQAVGCNPTTALVIGSGVQGQQAAPFLITEFPALSRLIL
FT                   SGNHPEGLEKAKDLALKTAARLGREIVIDLVRDPAPIACECDLIIGAAGPDTSAVVTAH
FT                   DLKENATVVVVGYGIDASVCHQAERVVTTSKQQMYLTGTDFADAQGIMPEVTAELPALL
FT                   AAQTPLRASSGITFCYNSGLVLTDIAVGSVFAAAAIEQNLGVEVDLW"
FT   gene            complement(659773..660741)
FT                   /locus_tag="CPFRC_03130"
FT                   /old_locus_tag="cpfrc_00624"
FT   CDS_pept        complement(659773..660741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03130"
FT                   /old_locus_tag="cpfrc_00624"
FT                   /product="oxygenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00624"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28418"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013911046.1"
FT                   /protein_id="ADK28418.1"
FT                   /translation="MQKIFMDEALSHRLIKSADELAAVSSVNDPESAAAIDALLEGELA
FT                   DLRDVICPDPRQHATLIAGLPFPAVNGPTPASWKECRGKVRTWRFMLAIVTSVVGRPFG
FT                   WLGQQEGRLITDLVPTKGQEAQQVGASSSTPLTLHTEDAFHPRRSTHFALFGLRNPKKV
FT                   GTTLAPLDQAWKHLDSDSRKVLMTPGAVILPDDSYSDFENSAPESMTAVWEREHGLGLR
FT                   FDPSYTDHSTGSQRWWRAYEKLAAALDSVTYSVPIAPGQIVIINNDTCVHGRVPFTADY
FT                   NGTDRWMLRINMMEQDTQRLSSELAEPGYGQQIRCIDGQVL"
FT   gene            660931..662463
FT                   /locus_tag="CPFRC_03135"
FT                   /old_locus_tag="cpfrc_00625"
FT   CDS_pept        660931..662463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03135"
FT                   /old_locus_tag="cpfrc_00625"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28419"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655196.1"
FT                   /protein_id="ADK28419.1"
FT                   /translation="MSNLSRRQFLTSVAALGLGTFAVASCTSGNTSGNGSSEKTSEASG
FT                   KVLKVGALGKAASAQRDPYKLLPNDSDMLICSLIWEALTVPGEDKIVAPRLMKQWKQLN
FT                   PMEWEFTIADGAKFHDGSEVTPKDVVWSLTKMLSDEANGFRLPVDPKSIVASGERTVQM
FT                   KTATPNSQLPMLARLMTFVMKEGSSPEKPVGSGPFKLMSWDNGSAKLQRFDDYHGTVAG
FT                   FEEVHVVPFEDTTAMTNALLAGQIDLAQAVGPIAARSAENNANVQIIKRSHDSVIPLIM
FT                   RTSDGPFADPKVREALRLGVDREQVVQRALSGYGTVAYDILGTGDPNIDSSLMRHRDVE
FT                   KAKQLLAQAHFDTSKTYDLFVTPEAPGQVEAMKVIAEQLGEIGVQIKVVQQESGQFYDN
FT                   TWTKADLYCGYWGTNDSVLFFAGKVLNGAAKSNESNFHDAEFDAVYAELLASTDQSKID
FT                   QLSKKLQKIEFERGGYLVWGASDGVDIAAKGLSGLPKAPGYGRVLLETVKKA"
FT   gene            662467..663423
FT                   /locus_tag="CPFRC_03140"
FT                   /old_locus_tag="cpfrc_00626"
FT   CDS_pept        662467..663423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03140"
FT                   /old_locus_tag="cpfrc_00626"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00626"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28420"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241483.1"
FT                   /protein_id="ADK28420.1"
FT                   /translation="MPKAVSRACNWLFPRLAIRAGALLVVLGLVFFAIDQLPGNAAAAL
FT                   LGANRTPEAIASFEQSLGLDRPPATRFLYWLGHALTGDFGVSVHGRPIVELLATALPVT
FT                   ITTTGIAFILTAVLSILTSIWWVQRSPRSGMSRTLEWASTSIIALPEFVIGVFLVAVFA
FT                   LGLGVLPAVTIIDGGLPSSTTMYILPVLALVIPQVAWNSRVLRAALIDATATRPVQSAM
FT                   LAGVTGTSLLRRHVLPLAIPSFATSMATSAGVLIAGTVSVEALFNHPGVGLLVATAVSQ
FT                   RDVSVLLAVLAATGALILLLLTMADILKIVCTPKVNV"
FT   gene            663420..664196
FT                   /locus_tag="CPFRC_03145"
FT                   /old_locus_tag="cpfrc_00627"
FT   CDS_pept        663420..664196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03145"
FT                   /old_locus_tag="cpfrc_00627"
FT                   /product="ABC transporter permease subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00627"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28421"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241484.1"
FT                   /protein_id="ADK28421.1"
FT                   /translation="MTRKIFALLVLAISICGPLVAQLFQLPTPNAAAGLPFDTAGNGAL
FT                   LGTDHLGRSVVSAVLHGGQALILTALAAGTLTTVVGAIVGCFGVLRPKMGFVVETCADA
FT                   TILVPAVIVLLLVSVLYPNSGLWLLVVVAVAVGSPYAARVIAAAAYPVAHSGYVQAARN
FT                   AGASDISVIMRDILPNISTVLRSVWGLRVVEALHLLAVASFLGVGAKLGEFAWSAMVRD
FT                   NAGGITLNPLAVLAPAAMLAVASIAVMALIKQKEAR"
FT   gene            664199..665641
FT                   /locus_tag="CPFRC_03150"
FT                   /old_locus_tag="cpfrc_00628"
FT   CDS_pept        664199..665641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03150"
FT                   /old_locus_tag="cpfrc_00628"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00628"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28422"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366700.1"
FT                   /protein_id="ADK28422.1"
FT                   /translation="MKTSGPLIQADIKVTLGAIELVPATVVQAQAGSITALIGPSGCGK
FT                   TTLLLALIGEVPAGSTVTGKLSVCGVDPISLRAAELARFRREQVAFVGQDPGAELPPLM
FT                   TVHTMLTELAPTADVPGLLHSVGLTVDTAAKRLHQLSGGQQRRVALARALSRNPRVIAL
FT                   DEPFAGLDPVTAKTIASLLRSVADSGVAIIITGHRLGVFPDLLDAHVCVGDTDADNAEL
FT                   AADQGRKPQATLGTQGAAADNEPLGEETALCMQASGLSYATDEGTPLFSDLSFAVVPGR
FT                   ILAIMGASGSGKSTLLRCLAGSNLQGVGVVECHGARREASMPWPRTHAKKLQIIPQDPA
FT                   STLNPKMRVIDAVARAVRDAHTQKRRLKKIGKRRTIGRQEAVRQALELLERVGISKELA
FT                   YRLPSGLSGGQRQRVAIARALATQPIVLLCDEITSALDPESAARVMAVLHDLCRSGIGV
FT                   IFVTHDQELVEEHCEENSRVFL"
FT   gene            666107..666286
FT                   /locus_tag="CPFRC_03155"
FT   CDS_pept        666107..666286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03155"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523848.1"
FT                   /protein_id="QGW57321.1"
FT                   /translation="MTHLAQRDDFNFQNLVSPAHMTFISVSLTKEQSTLILVEADFRLG
FT                   GLHSMLTRCVNTMI"
FT   gene            complement(666448..666520)
FT                   /locus_tag="CPFRC_03160"
FT                   /old_locus_tag="cpfrc_t018"
FT   tRNA            complement(666448..666520)
FT                   /locus_tag="CPFRC_03160"
FT                   /old_locus_tag="cpfrc_t018"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:666485..666487,aa:Arg,seq:cct)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: tRNAscan-SE."
FT                   /inference="COORDINATES:profile:tRNAscan-SE:2.0.4"
FT   gene            666693..666971
FT                   /locus_tag="CPFRC_03165"
FT                   /old_locus_tag="cpfrc_00629"
FT   CDS_pept        666693..666971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03165"
FT                   /old_locus_tag="cpfrc_00629"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00629"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28423"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800193.1"
FT                   /protein_id="ADK28423.1"
FT                   /translation="MADKHPIFHDVERRPVIATVVEENGTAVLALDEAAEDGSSRRILT
FT                   LNKFDAKQLSAVCDRYLHQQNSIDYANVNTLLTEVDRAALYDDEDDE"
FT   gene            666978..667733
FT                   /gene="cobF"
FT                   /locus_tag="CPFRC_03170"
FT                   /old_locus_tag="cpfrc_00630"
FT   CDS_pept        666978..667733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobF"
FT                   /locus_tag="CPFRC_03170"
FT                   /old_locus_tag="cpfrc_00630"
FT                   /product="precorrin-6A synthase (deacetylating)"
FT                   /EC_number="2.1.1.152"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28424"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800194.1"
FT                   /protein_id="ADK28424.1"
FT                   /translation="MRTILVIGIGAGSPEFLTLQAISGLRRAQAVVALDKGETKSDLLA
FT                   LRQGIVDTHAPGTPIVAVTDPERDRAPKDYDAEVLRWHKERANLLAEAIRGASSEDGTV
FT                   AFLVWGDPSLYDSTLRIIDHMRELEGLECAVEVIPGITAVQVLTAAHGILLNRIGEAIH
FT                   ITTGRNLASTSEKDRRNCVVMLDGNSAWMDVATEHTYMWWGAFLGTPQQIIREGYVKEI
FT                   GAQVAELKQTLRAEHGWIMDTYLLREMTD"
FT   gene            complement(667730..667984)
FT                   /locus_tag="CPFRC_03175"
FT                   /old_locus_tag="cpfrc_00631"
FT   CDS_pept        complement(667730..667984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03175"
FT                   /old_locus_tag="cpfrc_00631"
FT                   /product="mycoredoxin"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00631"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28425"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655200.1"
FT                   /protein_id="ADK28425.1"
FT                   /translation="MKEQHVTVYAADWCPFCQRLISALNRTNTPFVLVDVEADDQASEW
FT                   VKSVNNGNRIVPTVKYSDGSTATNPPASDVRRKLEELTA"
FT   gene            complement(668003..668530)
FT                   /locus_tag="CPFRC_03180"
FT                   /old_locus_tag="cpfrc_00632"
FT   CDS_pept        complement(668003..668530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03180"
FT                   /old_locus_tag="cpfrc_00632"
FT                   /product="dihydrofolate reductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00632"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28426"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014523152.1"
FT                   /protein_id="ADK28426.1"
FT                   /translation="MLRAIWAQSRDGVIGNGSDMPWHLPEDLAHFKKTTLGCPVIMGRK
FT                   TWESLPPTFRPLPGRQNYVLSRSAAGPWSTGACVVSTLPDVTGAWIMGGGQIYDATLPK
FT                   VKEVVRTIVDVELLDVLGESAVSAPALGSEFEIVSETEWMASISGKLHREYQDSASSQP
FT                   LRYKFQSLRRTA"
FT   gene            complement(668530..669330)
FT                   /locus_tag="CPFRC_03185"
FT                   /old_locus_tag="cpfrc_00633"
FT   CDS_pept        complement(668530..669330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03185"
FT                   /old_locus_tag="cpfrc_00633"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00633"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28427"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_600073.1"
FT                   /protein_id="ADK28427.2"
FT                   /translation="MMISTPYEDLLRKILSEGSHKDDRTGTGTTSLFAQQMRFDLSESF
FT                   PLITTKKVYWRGVVGELLWFLQGSSNITWLQDNNIHIWDEWASEDGELGPIYGVQWRSW
FT                   PTPHGAHVDQISGALDMLKNNPDSRRNIVSAWNVAELDNMALPPCHLLFQLYVADGKLS
FT                   CQLYQRSADMFLGVPFNIASYSALTHMFAQQAGLEVGEFIWTGGDCHIYDNHREQVEIQ
FT                   LSREPRPYPQLELAKAKDLFSYDFADFQVIGYDPHPAIRAEVAV"
FT   gene            complement(669440..670198)
FT                   /locus_tag="CPFRC_03190"
FT                   /old_locus_tag="cpfrc_00634"
FT   CDS_pept        complement(669440..670198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03190"
FT                   /old_locus_tag="cpfrc_00634"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase CysQ"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00634"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28428"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_600074.1"
FT                   /protein_id="ADK28428.2"
FT                   /translation="MTAHFDDATLTKRLAQGTGEILKGVRNVGLLRGRELGDAGDDLAQ
FT                   NWIARVLEQHRPDDGFLSEEAADNPERLGKDRVWIIDPLDGTKEFATGRQDWAVHIALV
FT                   EDGTPTHAAVNLPDLGVVFHTSEVRAVRGPYAKKIAVSHNRPPAVANHVAEKLSFTAEP
FT                   LGSAGAKAMHVLLGDYDAYIHAGGQYEWDSAAPVGVSLAAGLHCSRLDGSPLTYNNKDT
FT                   YLPDLLVCRPELADDILSMVAAFREENGSY"
FT   gene            670532..675403
FT                   /locus_tag="CPFRC_03195"
FT                   /old_locus_tag="cpfrc_00635"
FT   CDS_pept        670532..675403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03195"
FT                   /old_locus_tag="cpfrc_00635"
FT                   /product="ATP-dependent helicase"
FT                   /EC_number="3.6.4.-"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28429"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522154.1"
FT                   /protein_id="ADK28429.2"
FT                   /translation="MLSRFNPQIATWFAEVFAEPTPVQKAAWEKISLGGNTLIVAPTGS
FT                   GKTLAAFLWAINGLSVASGQTVAFPAPKNKPLAGKETNQGVKVLYISPLKALGVDVENN
FT                   LRAPLTGINHVAARLGLEYSDISVAVRSGDTPAAERARQVRKPPDILITTPESAYLMLT
FT                   SKAGAILKNVETVIVDEIHAVAGTKRGAHLSLTLERLERLAGRTIQRVGLSATARPIDA
FT                   VAHFLAGDRPVDIVNPRIDKQWELSVRVPVADMSDGTTTRSDSTAGEATYNGAHNLGSV
FT                   LSDLPDTELLSESALPTQGSIWPFIEERVYHDVMTHRSTLIFVNSRRTAERLTSRLNEI
FT                   YAEEHDPESLSPQLRRTPAQLMKASDVAGLAPTVIARAHHGSVSKDERAETERMLKEGS
FT                   LRAVVATSSLELGIDMGAVELVVQVESPPSVASGLQRVGRAGHMVGALSKGVFYPKHRA
FT                   DLIQTAVVVGRMDEGAIEELKVPRNALDVLLQQTVAAVSVEDLDVEEWYATVVRAYPYR
FT                   DLSRSVFDAVIDLASGVYPSTDFAELRPRVVFDRITGRLTARPGAQRVAVTSGGTIPDR
FT                   GMFGVFLAVQTGTGSVPRRVGELDEEMVYESRVGDVFTLGASSWRIEEITRDQVLVIPA
FT                   PGHTGRLPFWTGDQVGRLAELGKALGEFRRRTLARCQSLEDNAKENHGGDLLELEELGL
FT                   DAFARQNLVQFLHDQQEATGIVPDEKTLVLERFHDELGDWRIVLHTPYGRGVNAAWALA
FT                   VGARISERTGIDAQAVASDDGIVLRLPESDEEPGADLFMIDPDDIEALVAEQVGNSALF
FT                   ASRFRECAARALLLPRRDPGKRAPLWQQRQRAAQLLDVARKYPSFPIILETVRECLQDV
FT                   YDLPALVELLQEIKQRRIRIAEVVTSQPSPFAASILFSYTGAFMYEGDSPLAEKRAAAL
FT                   SLDPALLASLLGTVELRDLLDPEIIAEVHDTMQRKAPHRRAKTTEELVDALRVLGPVPL
FT                   SDLPAITEPPMNREQVMAQLRGRVMEVRIAGVSHLAQTLDAPLLRDALGIPIPPGVAAQ
FT                   VETITDALEQLVSRWVRVRGPFTLMDVQHSFGLAAGIAHGVVEKLCAQSKLVAGRFRQD
FT                   SDVQEYVATEVLKIIRARSLAAVREQTQPVSHAAFGRFLPEWQHVASVGETPELAGPDG
FT                   VFNVVEQLAGVRLPASAWETLVLPQRVRNYSPLDLDELTNNGEVIVVGAGRAGAHDPWV
FT                   MLLPTDYAAELIPHVDIETLSETQQKIMAVLSRGGGFLFSDIYRETVSEHETSPEQSFV
FT                   PELGSALWDLFEAGLVSPDGFAPIRARLAAHSGTKTAHRTSRRPNRSRIRMGRTSFAHS
FT                   HRLAQPPDVIGRWATTAAAEDNATARSVAHGEAWLDRYGVVTRGAVVSEDVVGGFALAY
FT                   KVLSGFEESGKALRGYLIEGLGAAQFSTSAVIDRLRGLADTPDIAGWPSGASSPRVYVL
FT                   AAADPANPYGAALPWPEPGPTRAAGAVVVLIDGLLAAHLTRGGRNLTLFSPPTGVEQQE
FT                   FLGIVLGALAESVLTGKIQPLIVEKINGVAVLRSPELEMLRILGVGITPRGARISGDLS
FT                   NQGQARRGRSLSSALDSLSSLESEPGSGQHKKSPHRGFRSGGYR"
FT   gene            complement(675400..676035)
FT                   /locus_tag="CPFRC_03200"
FT                   /old_locus_tag="cpfrc_00636"
FT   CDS_pept        complement(675400..676035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03200"
FT                   /old_locus_tag="cpfrc_00636"
FT                   /product="mismatch-specific DNA-glycosylase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00636"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28430"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800197.1"
FT                   /protein_id="ADK28430.1"
FT                   /translation="MSTAHPSPLGGRRPTRAELVNFKNKTVSDRFPPPGSALRLLIVGV
FT                   NPGLWTAAVNAPFAYPGNRFWPSLDRAGIVSPVFEVSEGMSDAQELILYEQGIAMTNLV
FT                   SRATARADELEKDELMAGAHRVVGLASELRPQAVAVAGITAFRIAFEMKKAVLGLQDTN
FT                   SIKGWPEDVSLWVVPQPSGLNAHETIDSLAAKWRAVWDSTIPPQQSHC"
FT   gene            676109..676930
FT                   /locus_tag="CPFRC_03205"
FT                   /old_locus_tag="cpfrc_00637"
FT   CDS_pept        676109..676930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03205"
FT                   /old_locus_tag="cpfrc_00637"
FT                   /product="Fpg/Nei family DNA glycosylase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00637"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28431"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366707.1"
FT                   /protein_id="ADK28431.2"
FT                   /translation="MPEGDSIYQLSHRLRFMEGRKVLGTSIRVPQLALATFTGRTVKRV
FT                   WPYGKNLFMQIGEDILHTHLKMEGAWAVYRKGDRWSKPAHTARVQLLLDGTPQKRSIEV
FT                   VGFSLGFVRIFPACDYPGAIAHLGPDVLGQSWENTGHSEARRRILLDPDRAIGLAILDQ
FT                   RNLAGVGNEYRAEICFLCGVHPATRVRDVDVDRILLITRRLMWANRLSTVRVTTGIKRL
FT                   GETTYVFGRNHKPCRRCGTRILQSTLVDDPSSELERIIWWCPHCQPFYSEP"
FT   gene            676972..677385
FT                   /locus_tag="CPFRC_03210"
FT                   /old_locus_tag="cpfrc_00638"
FT   CDS_pept        676972..677385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03210"
FT                   /old_locus_tag="cpfrc_00638"
FT                   /product="YccF domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00638"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28432"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013911067.1"
FT                   /protein_id="ADK28432.1"
FT                   /translation="MRLILNLLWLVTGGIWLALSYIIFGALACIFIVTIPAGVASFRMA
FT                   EYALWPFGRTVVRSTGSSSVLAGVSNVIWFLVAGLWLALGHLTTAAGQALTIIGIPLAI
FT                   ANIKMIPVTCFPFGKRIVDSDAIPFGYEPMVKM"
FT   gene            complement(677462..679105)
FT                   /locus_tag="CPFRC_03215"
FT                   /old_locus_tag="cpfrc_00639"
FT   CDS_pept        complement(677462..679105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03215"
FT                   /old_locus_tag="cpfrc_00639"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00639"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28433"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800200.1"
FT                   /protein_id="ADK28433.1"
FT                   /translation="MSFDVTATPEWTELSRCYETAASTSLRELFASDADRARKFSFDAA
FT                   SLHVDLSKNFLDDTTVEAFVKTAKAAHLHERIKSMFAGEHINNTEDRAVLHTALRIPVE
FT                   ADLVVDGQDVAADVHEVLGRMRDLATALRSGAWRGYSNHTIKTVVNIGIGGSDLGPAMA
FT                   TKALRTYATAGISAKFVSNVDPADMHSVLDECDPESTLFIVASKTFTTQETLANAHAAK
FT                   RWLLDAANGDESAVAKHFVAVSTNAEKVAEFGIDTKNMFGFWNWVGGRYSVDSAIGLSL
FT                   MAVIGPMDFMRFLEGFHAMDEHFRTAEFHENIPVLMGLLGVFYNDFFGAETHAVLPYSQ
FT                   DLGRFPAYLQQLTMESNGKSVRRDGSPVSTGTGEIYWGEPGTNGQHAFFQLIHQGTKLI
FT                   PADFIGFARPKQDLPTATGEGSMHDLLMSNFFAQTKVLAFGKTAEEIAAEGVPSELVAH
FT                   KVMPGNRPTTTILAEELTPAVLGALIALYEHIVFVQGVIWDINSFDQWGVELGKQQAND
FT                   LAPAVAGASAIQSGDSSTDELINWYRAHRG"
FT   gene            679283..680770
FT                   /locus_tag="CPFRC_03220"
FT                   /old_locus_tag="cpfrc_00640"
FT   CDS_pept        679283..680770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03220"
FT                   /old_locus_tag="cpfrc_00640"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28434"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655205.1"
FT                   /protein_id="ADK28434.1"
FT                   /translation="MTDGSKENKIMQTTLPEGAPTQLFLGGEFTDGHEGETFEVLNPSD
FT                   GSILARVASASKHDAEEALNKAAKAQPLWAATSARERSDVLWNAYKSLLENSEKLAVIQ
FT                   SLELGRALPDSRAEVAYAAEFFRWFAEEAVRIRGDYRHSPTGNSRLIVHQQPVGVSLAI
FT                   TPWNFPLAMGTRKLGPALAAGCTMILKPASKTPLTMLYLARILKESGLPEGVVSVLPTA
FT                   DSSVISDLLDDPRLRKLTFTGSTEVGQKLAARAAQHSMKVSLELGGNAPYMVMEDADIS
FT                   VAAQAVATAKMRGAGQVCIAANRFLVHESIKDEFLDRVIDTMKSFTQGPATQEGVDFAA
FT                   LSGADQLEKVTELVNDALAHGATRVLGESLPAGLPEGGFYYPATVLDNVPLDARIVHEE
FT                   IFGPVVAISTFRDDEEAIAMANNTPFGLAAYVFSEQITHALSVAERVEAGMVGVNKGGI
FT                   SDPSAPFGGIKESGVGREGGFEGIHEFLESKLIALPL"
FT   gene            complement(680820..681122)
FT                   /locus_tag="CPFRC_03225"
FT                   /old_locus_tag="cpfrc_00641"
FT   CDS_pept        complement(680820..681122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03225"
FT                   /old_locus_tag="cpfrc_00641"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00641"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28435"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241498.1"
FT                   /protein_id="ADK28435.1"
FT                   /translation="MNSEKNFKVRTPTGTDDPLSDAEIQQYRKEIDRLDKEILAAVKRR
FT                   TEISRAIGKTRMGSGGTRLVHTREVAIINQFREEIGEEGPALAAILLRLGRGRLG"
FT   gene            681262..683802
FT                   /gene="pcrA"
FT                   /locus_tag="CPFRC_03230"
FT                   /old_locus_tag="cpfrc_00642"
FT   CDS_pept        681262..683802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="CPFRC_03230"
FT                   /old_locus_tag="cpfrc_00642"
FT                   /product="DNA helicase PcrA"
FT                   /EC_number="3.6.4.12"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00642"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28436"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655206.1"
FT                   /protein_id="ADK28436.1"
FT                   /translation="MNNSDDFPTQQGFDFGDWATAKKTPAEPSPFSSHTYRQEEHRTWT
FT                   TAKDQQPASTSAPADDLVQGLNPQQQQAVEHSGSPLLIVAGAGSGKTAVLTRRIAYLMR
FT                   IRGVQPGQILAITFTNKAAAEMRERVAHLVGPIASRMWVSTFHSTCVRILREQAQLVAG
FT                   LNSNFTIYDSDDSKRLLAMISKDMNLDIKKFTPRLLGAGISNLKNELISPATAVAEAES
FT                   TKNPYETTVAAVYVEYQRRLRQANAVDFDDLIGETVRIFKEHPQITEYYRRRFRHVLID
FT                   EYQDTNHAQYVLIHELVGTGETASELCVVGDSDQSIYAFRGATIRNIEEFERDYPNATT
FT                   VLLEQNYRSTQTILNAANSVISQNENRRKKKLWTALGSGDPITGYVADNEHDEARFIAQ
FT                   EIDALADKGIDYSDMAIMYRTNNSSRAVEDVFMRSGIPYKVVGGTRFYERKEIRDVIAY
FT                   LRLLDNPEDTVSLRRIINTPRRGIGDKAVAFLTLHSENQGVSLQQALIDASEGQVSLLG
FT                   ARGCNAISGFVNMMSGLRDSAAESVNEITGMPDIGNVIAQILDITGYKAELEKSNDPQD
FT                   GARLDNLNELVSVAREFSSEAANQVAYAKMDGSELDDLAAVGEPEPGSLQAFLERVSLV
FT                   ADADQIPDNEQGLVTLMTLHTAKGLEFPVVFLMGWEDGQFPHLRALGDPKELAEERRLA
FT                   YVGITRARKALYITRAMLRSSWGNPVTNPASRFLTEIPQELLDWRREEPESSFDAWGQP
FT                   SWGRNTGFSSARGDSWGSPRYGASPKPKKTMPSYAKNSDLSLVVGDRVNHDKYGLGTVT
FT                   KVDKGSPADSVTIDFGSSGTVRLMLIGPVPMEKL"
FT   gene            complement(683893..684606)
FT                   /locus_tag="CPFRC_03235"
FT                   /old_locus_tag="cpfrc_00643"
FT   CDS_pept        complement(683893..684606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03235"
FT                   /old_locus_tag="cpfrc_00643"
FT                   /product="peptidoglycan DD-metalloendopeptidase family
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00643"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28437"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013911072.1"
FT                   /protein_id="ADK28437.1"
FT                   /translation="MQQTQHVVSGKHRKQTSQAKGRVAFVALATGAVSTAGATGAALAH
FT                   TNSHNDTADFKLTADTSAKLGDSAPQILAIQEFKPNTNLSDQLTKAINYNEERALADKE
FT                   ARKPKIVVHTPAMGTLTSPYGMRWGTLHAGIDIANAMHTPIYSIMDGVVIDAGPASGYG
FT                   QWVRVRHTDGTVTVYGHVETINVVTGQAVAAGDQIAGMGNRGFSTGVHLHFEVHPGGGA
FT                   AVDPVPWLSEKGISV"
FT   gene            684863..686602
FT                   /locus_tag="CPFRC_03240"
FT                   /old_locus_tag="cpfrc_00644"
FT   CDS_pept        684863..686602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03240"
FT                   /old_locus_tag="cpfrc_00644"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00644"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28438"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014522375.1"
FT                   /protein_id="ADK28438.1"
FT                   /translation="MLRGTVNGMSKKTSPNAGPSRRPRSRPVSIGNRGDERGGQVSRGT
FT                   QRKVPDGAPEAVPERTTFIARLRSLLPTVLISNAIVLIAIIIFSLIVLIATSAPMAAMP
FT                   ATVAETWLALNLAPVSGRGISLALLPMLPAIGVVALVSRRVYKTVKDRISLHDLLILLC
FT                   GTLGVPALITVMACAMLWDASSVFDVASPNVFAAVGVVVLLHACAFMIGMGTRLWRALA
FT                   RRYGVPSWVVDSVLLAVRAVGYLLLAAFIVFLISLAVHYRAFAESLQGYSSAGVAGVML
FT                   ISLIYLPNAVVASLAVIVGSSLELGQGSVSLFAATLVPTPPVPVFAALPTSMVPSVLVV
FT                   LILPVVAVSLALRKRVSDFLSAAVITVAAGLGTLLLSFFAGGSLGVYGYVGPLMWLTPL
FT                   MVMLVIGVVSVAVVALTRYREGRNSTKLLGGEHSVADPAFVTPVAATSIPGQKDEVEDA
FT                   GEGEESDEEPDGELLETENDQEEDSPEAESDEPYEITANGLDSAEILEEAEIRDAAIDL
FT                   NESQENLPESGEITAGNDQDNDQGAESAGLQGHNMPEEAGEPEDEESTETEDAPEKEEK
FT                   GEA"
FT   gene            686650..687276
FT                   /locus_tag="CPFRC_03245"
FT                   /old_locus_tag="cpfrc_00645"
FT   CDS_pept        686650..687276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03245"
FT                   /old_locus_tag="cpfrc_00645"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28439"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014401066.1"
FT                   /protein_id="ADK28439.1"
FT                   /translation="MTDEIHLKTDHESAALPIVVMASGSGTLLQAIIDHQGAYKVVGVV
FT                   ADVSCPAITRAETAGIPAEVVSYASGDDREKWNKALAVAVEKHAPAIVVSAGFMRILGK
FT                   TFLEKFPGRIINTHPALLPAFPGAHAVRDALAYGVKVTGSTVHFIDEGVDTGKIIAQVP
FT                   VSIEPGESEAHLHERIKHVERKLIVSVLNSATTEKKSEEVFFTYE"
FT   gene            687269..688846
FT                   /gene="purH"
FT                   /locus_tag="CPFRC_03250"
FT                   /old_locus_tag="cpfrc_00646"
FT   CDS_pept        687269..688846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="CPFRC_03250"
FT                   /old_locus_tag="cpfrc_00646"
FT                   /product="bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00646"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28440"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_600090.1"
FT                   /protein_id="ADK28440.1"
FT                   /translation="MSDDRKQIKRALISVYDKTGLEELAHALNQAGVEIVSTGSTAATI
FT                   AKQGIPVTPVEALTGFPECLEGRVKTLHPKVHAGILADTRKADHLAQLDELGVSLFQLV
FT                   VVNLYPFTQTVASGADFDACVEQIDIGGPSMVRAAAKNHPSVAVVVSPERYTAVAEAIQ
FT                   AGGFTRAERTELAVDAFRHTASYDVAVATWMGEQIAGDAEEYAPWIGASYARTSVLRYG
FT                   ENPHQSAALYVDPNAPAGLAQAEQLHGKEMSYNNYTDSDAAWRAAWDHERPCVAIIKHA
FT                   NPCGIAVSDASIAEAHRLAHACDPVSAFGGVIASNREVSVEMAQQVSEIFTEVIIAPSY
FT                   EEGAVELLSQKKNIRILVAPAPVRDQKEQRQISGGLLVQRRDLVDAEGDAPENWTLVAG
FT                   EAATPELLADLEFAWRTVRAVKSNAILLAQDGATVGVGMGQVNRVDAAKLAVERADSLA
FT                   GEQQRAKGAVAASDAFFPFADGFEVLAHAGVKAVVQPGGSIRDAEVIQAAEKAGVTMYL
FT                   TGARHFAH"
FT   gene            689108..689866
FT                   /locus_tag="CPFRC_03255"
FT                   /old_locus_tag="cpfrc_00647"
FT   CDS_pept        689108..689866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03255"
FT                   /old_locus_tag="cpfrc_00647"
FT                   /product="ATP-binding cassette domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00647"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28441"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366716.1"
FT                   /protein_id="ADK28441.2"
FT                   /translation="MIQNTDECGLMVSMQKVNKYFDHFHALRDINLNVPRGQVVVVLGP
FT                   SGSGKSTLCRTINRLETIDSGEIFIDGHKLPEEGKELARLRSEVGMVFQQFNLFPHKTI
FT                   RENITLGPVNVKKLGKKEASLLAMQLLERVGIASQADKFPAQLSGGQQQRVAIARALAM
FT                   KPKVMLFDEPTSALDPEMVNEVLDVMADLAREGMTMICVTHEMGFARKAADRVLFMADG
FT                   LIVEDSDPESFFTSPQSDRAKDFLGKILSH"
FT   gene            689913..690794
FT                   /locus_tag="CPFRC_03260"
FT                   /old_locus_tag="cpfrc_00648"
FT   CDS_pept        689913..690794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03260"
FT                   /old_locus_tag="cpfrc_00648"
FT                   /product="transporter substrate-binding domain-containing
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00648"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28442"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241505.1"
FT                   /protein_id="ADK28442.1"
FT                   /translation="MIRTSTRFLGASAIALLSATTLAACGGNNNDGAGLLGHIESGQVT
FT                   LGTKFDQPGLGMKEASGGMSGLDVDIAQYVVNHIADTKGWKHPDVEWRETPSAQRESLI
FT                   QNGEVDLIAATYSINKSRAETVNFGGPYLLTHQALLTRKDDAGIKEVKDLEHGKILCSV
FT                   SGSTPAQKVKESLPGVQLQEYDTYSSCVEALRQGNVDALTTDATILNGYAQQNEGSFKV
FT                   VEMFKEDQTPYTDEYYGIGLKKDDAEATKAVNEALNQLNSSGEFEKLVKKNLGDAAAGV
FT                   ATAKPGDLTFIK"
FT   gene            690830..691516
FT                   /locus_tag="CPFRC_03265"
FT                   /old_locus_tag="cpfrc_00649"
FT   CDS_pept        690830..691516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03265"
FT                   /old_locus_tag="cpfrc_00649"
FT                   /product="ABC transporter permease subunit"
FT                   /note="The N-terminal region of this protein, as described
FT                   by TIGR01726, is a three transmembrane segment that
FT                   identifies a subfamily of ABC transporter permease
FT                   subunits, which specificities that include histidine,
FT                   arginine, glutamine, glutamate, L-cystine (sic), the opines
FT                   (in Agrobacterium) octopine and nopaline, etc; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00649"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28443"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_601159.1"
FT                   /protein_id="ADK28443.1"
FT                   /translation="MDAMWSQLGPAILPAFWATIKLTALAAMGAMACGTLLTAMRVSPV
FT                   RILRTLAALYVNTVRNIPLTLVVLFYSFGLYQTLGLSLASRESATFLADNNFRLATLGF
FT                   ILYTSAFVSECLRSGINTVDFGQAEAARSLGLSFSQTFNKIIFPQAIRAAIVPLGNTLI
FT                   ALTKNTTIASVIGVGEASLLMKEVIENHASQLFVIFGCFALGFMALTLPMRYFLGALST
FT                   RMAVKK"
FT   gene            691513..692451
FT                   /locus_tag="CPFRC_03270"
FT                   /old_locus_tag="cpfrc_00650"
FT   CDS_pept        691513..692451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03270"
FT                   /old_locus_tag="cpfrc_00650"
FT                   /product="ABC transporter permease subunit"
FT                   /note="The N-terminal region of this protein, as described
FT                   by TIGR01726, is a three transmembrane segment that
FT                   identifies a subfamily of ABC transporter permease
FT                   subunits, which specificities that include histidine,
FT                   arginine, glutamine, glutamate, L-cystine (sic), the opines
FT                   (in Agrobacterium) octopine and nopaline, etc; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28444"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366719.1"
FT                   /protein_id="ADK28444.1"
FT                   /translation="MSVRATVLYDAPGPNALRRNALYTVLTVIVAIALIGWVLVALHSK
FT                   GQLDAVKWAPFIDPRTWNTYLLPGLVGTLKSAFSSVILAIILGVLLGLGRLSRRRSLRW
FT                   ICAAITEFFRAVPVLLLIIFSYQALAMYKVVPPRELAFTAVVFSLTMYNGAVIAEILRA
FT                   GIRALPRGQTEAAQALGLGHWQTMQKILLPQAVAAMLPALIAQAVIALKDSALGYQIGY
FT                   VEIVRQGIQSSATNRNYLPSLIVVAILMILINYSLTVLAERVERQLRAGGARRNILAKV
FT                   PEHPHQGLTTKDNAYADWHDPGHQEIKNPAE"
FT   gene            692465..693358
FT                   /locus_tag="CPFRC_03275"
FT                   /old_locus_tag="cpfrc_00651"
FT   CDS_pept        692465..693358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03275"
FT                   /old_locus_tag="cpfrc_00651"
FT                   /product="CoA ester lyase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00651"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28445"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241508.1"
FT                   /protein_id="ADK28445.1"
FT                   /translation="MLHVNEHLLGKHVFKAVASVIMHTDSLELAGPAILFAPADRAEII
FT                   PKAAERADLVILDLEDGAGDVNRESAYQNIKNAHLDPATTFVRVVGPSDEHYHQDIAFV
FT                   RETEYRNVIVPKVGTRLPKNLDGFNVVPIIETPAALINIQHFAEHPLVVGLYWGADDLT
FT                   IGLGGAYSRQRNDEPTPGRYRETMAYARSQTLIHAAAAGKWAMDAVYQDFSDQDGLYLE
FT                   ALDSARMGFALYPCIHPRQVEVVRRAFYPGEEQITWARRIAEESQRHSGAFKLDGEMVD
FT                   TPLITLAFNLLNRIKE"
FT   gene            complement(693401..694084)
FT                   /locus_tag="CPFRC_03280"
FT                   /old_locus_tag="cpfrc_00652"
FT   CDS_pept        complement(693401..694084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03280"
FT                   /old_locus_tag="cpfrc_00652"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00652"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28446"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300567.1"
FT                   /protein_id="ADK28446.2"
FT                   /translation="MAGAVGRPRKNSPRRRGSTAREEILDASSELFTVQGFATTSTHQI
FT                   ADAVGIRQASLYYHFPSKTEIFLTLLNSTVEPSTVLAADLGEAEVPAPLRLWALTAAEC
FT                   RLLLSTRWNVGRLYQLPVAASPEFSEYHAQRTQLRQIFHDIAAEIAGSDDPRVDLPFHI
FT                   AVSVIEMRPNNGIVPEPLKNDSLPSLAIMLADAALAVVGAELPVDRVERTMELLAAVDK
FT                   KHSEA"
FT   gene            complement(694259..695155)
FT                   /locus_tag="CPFRC_03285"
FT                   /old_locus_tag="cpfrc_00653"
FT   CDS_pept        complement(694259..695155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03285"
FT                   /old_locus_tag="cpfrc_00653"
FT                   /product="nucleotidyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00653"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28447"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800208.1"
FT                   /protein_id="ADK28447.1"
FT                   /translation="MHESLTELSELAPQCADAPTARGLLTEGQDLVRNAIAHGERPQAL
FT                   IEWFSRLVSDVLHSEGIAEITGGAQIVLTGAIGRGDALPASPIKWLTVGSDEVTTAELD
FT                   SLLTNVGLITEQTRFGHQPRSKSEWCGMIANADGPELAIFADAGSWCLQEVITHADHRL
FT                   LLIDAINQRPPALRLHEGLPDKDVPVDVRQDLLYPIIAIARWASVAAGSTEVSTRRRIN
FT                   AGVEAGLLSQTQADFLRQAWESGLDLQFKRWTDRVHSHKTTVDTLPAIQRSIFGASSRM
FT                   VSDVARVLAAEYDVQLV"
FT   gene            complement(695381..695629)
FT                   /gene="rpsR"
FT                   /locus_tag="CPFRC_03290"
FT                   /old_locus_tag="cpfrc_00654"
FT   CDS_pept        complement(695381..695629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="CPFRC_03290"
FT                   /old_locus_tag="cpfrc_00654"
FT                   /product="30S ribosomal protein S18"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00654"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28448"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005291360.1"
FT                   /protein_id="ADK28448.1"
FT                   /translation="MKHNNMKKARMEQSRRPKKNPLKAAGIEKVDYKDINTLRQFISDR
FT                   HKIRSRRVTGLTPQQQRQVATAVKNAREMALLPFTSR"
FT   gene            complement(695644..695949)
FT                   /gene="rpsN"
FT                   /locus_tag="CPFRC_03295"
FT                   /old_locus_tag="cpfrc_00655"
FT   CDS_pept        complement(695644..695949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="CPFRC_03295"
FT                   /old_locus_tag="cpfrc_00655"
FT                   /product="30S ribosomal protein S14"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00655"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28449"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_018297576.1"
FT                   /protein_id="ADK28449.1"
FT                   /translation="MAKKSKIAKNEQRKEIVARYAERRNELKAIIKNPNTSDEDRMDAQ
FT                   FELNRQPRDASPARVRNRDSRDGRPRGFLRKFGVSRVRMREMAHRGELPGVRKSSW"
FT   gene            complement(695953..696117)
FT                   /gene="rpmG"
FT                   /locus_tag="CPFRC_03300"
FT                   /old_locus_tag="cpfrc_00656"
FT   CDS_pept        complement(695953..696117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="CPFRC_03300"
FT                   /old_locus_tag="cpfrc_00656"
FT                   /product="50S ribosomal protein L33"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00656"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28450"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005279910.1"
FT                   /protein_id="ADK28450.1"
FT                   /translation="MARNDIRPIIKLKSTAGTGYTYVTRKNKRNNPDRISLMKYDPVVR
FT                   KHVEFREER"
FT   gene            complement(696121..696357)
FT                   /gene="rpmB"
FT                   /locus_tag="CPFRC_03305"
FT                   /old_locus_tag="cpfrc_00657"
FT   CDS_pept        complement(696121..696357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="CPFRC_03305"
FT                   /old_locus_tag="cpfrc_00657"
FT                   /product="50S ribosomal protein L28"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00657"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28451"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_015400296.1"
FT                   /protein_id="ADK28451.1"
FT                   /translation="MSAICQVTGRKPGYGKSVSHSHRRTSRRWNPNVQRRKFYLPSEGR
FT                   TITLNVSTKGLKVIDRDGIESVVAKIRARGEKI"
FT   gene            696897..697163
FT                   /locus_tag="CPFRC_03310"
FT                   /old_locus_tag="cpfrc_00658"
FT   CDS_pept        696897..697163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03310"
FT                   /old_locus_tag="cpfrc_00658"
FT                   /product="type B 50S ribosomal protein L31"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00658"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28452"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_600100.1"
FT                   /protein_id="ADK28452.1"
FT                   /translation="MKKDIHPDYHPVVFQDAGTGHQFLTRSTASSDRTVAWEDGNEYPL
FT                   IVVDVTSESHPFWTGAQRVMDTAGRVEKFQRRFGGMARRKKKA"
FT   gene            697182..697355
FT                   /gene="rpmF"
FT                   /locus_tag="CPFRC_03315"
FT                   /old_locus_tag="cpfrc_00659"
FT   CDS_pept        697182..697355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="CPFRC_03315"
FT                   /old_locus_tag="cpfrc_00659"
FT                   /product="50S ribosomal protein L32"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00659"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28453"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005530148.1"
FT                   /protein_id="ADK28453.1"
FT                   /translation="MAVPKRRMSRANTHSRRSQWKADNVALQEVKIDGQTVRIPRRLVK
FT                   AAQLGLVEVEQF"
FT   gene            697497..698189
FT                   /locus_tag="CPFRC_03320"
FT                   /old_locus_tag="cpfrc_00660"
FT   CDS_pept        697497..698189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03320"
FT                   /old_locus_tag="cpfrc_00660"
FT                   /product="response regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28454"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005523719.1"
FT                   /protein_id="ADK28454.1"
FT                   /translation="MKIVVVDDEQAVRESLRRSLSFNGYDVFLAEDGVQALEVIEKEQP
FT                   ELVILDVMMPRMDGLEVCRTLRSAGDDRPILVLTARDGVSDRVAGLDAGADDYLPKPFA
FT                   LEELLARVRSLLRRAAADAVGGPSQGELTFDDLKLNPDTRDVTRGGRHISLTRTEFALL
FT                   QLLMANARRVLSRSTILEEVWGYDFPTSGNALEVYIGYLRRKTESEGEPRLIHTVRGVG
FT                   YVLRDTAP"
FT   gene            698186..699730
FT                   /locus_tag="CPFRC_03325"
FT                   /old_locus_tag="cpfrc_00661"
FT   CDS_pept        698186..699730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03325"
FT                   /old_locus_tag="cpfrc_00661"
FT                   /product="HAMP domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00661"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28455"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014655215.1"
FT                   /protein_id="ADK28455.1"
FT                   /translation="MILRRPEFSLGSDSSSILGVDDRPKTVTGSDTPLKWRITLLTASM
FT                   VAIAVGMMMIAAYWSVSAALRGSVDNSLDAKASAMLERSTDPAFFNSLESEVERFKNYN
FT                   PDTRISISAPGWTHAVGDKLPVLSEKAQTEGYRVSTVSGERVLVKRSNIGATVMLARDM
FT                   TQTNRMITTLGIALLVVAGLGVLLAFGTGVVVSSTVFRPISRLRNAVRYITETDDLRPI
FT                   EVSGNDEIAQLANNFNEMLEALRKSRQRQTELVADAGHELKTPLTSMRTNIELLMMMQN
FT                   SDSHRVSLEDKRALQGDVIAQMEELSTLIGDLVDLARQDTPEKALEEVDLVDVIDASLA
FT                   RVRRRRSDVEFEMSTIPWYLDGDSFALGRAILNLLDNAAKWSPKGGTVRLNMEQHDAHT
FT                   VCIMVADSGPGIPVEDREKVFDRFYRSVQARSTPGSGLGLAIVQSTIERHGGSIVAGES
FT                   EDGGALMTVLLPGFPDDDELSEYRKQLIQRSGKMPSTLEEMRRLRHAKHPERRGKS"
FT   gene            699933..701387
FT                   /locus_tag="CPFRC_03330"
FT                   /old_locus_tag="cpfrc_00662"
FT   CDS_pept        699933..701387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03330"
FT                   /old_locus_tag="cpfrc_00662"
FT                   /product="PDZ domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00662"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28456"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241518.1"
FT                   /protein_id="ADK28456.1"
FT                   /translation="MTNQFGTDNTNNSDRDPRTAMNNSEQNPQTGQNNSYQPNPYIGGN
FT                   SEKPMPTHETREFDRVHNPYAVNASSTTGGPAVSNTAPEGATGGGAAHSQGFSQGVPQH
FT                   MLGDEPPVMEQPVKEKKAIGLGAATALALVAAVAAGSITGVYASKVNTGSTKSTVVESL
FT                   KQPVADTTNKTAPAGSVQSVASQVLPSVVSIMVTSEAGVSEGSGSIISEDGYVMTNNHV
FT                   VAQANSNRAKVSVTMNDGSTHDAEFVAGDPNTDVAVIKIKGASGLPVMNFGDSSKLQVG
FT                   QQVVAIGSPLGLSATVTSGIVSALNRPVRAGGSETGQSSLIDAVQTDAAINPGNSGGPL
FT                   VDSEGKQIGINSVIASLSQRQSQSGAQAGSIGLGFAIPSNFARRVAAQLIETGKATQPM
FT                   IGIQLVSNARVKGAVIADVTEGAPGSKAGLKPGEIITKINGRVVDSADALIAAVRSSDF
FT                   GSTVKLTVVDENGENSRSVDVTLTSE"
FT   gene            701481..702080
FT                   /locus_tag="CPFRC_03335"
FT                   /old_locus_tag="cpfrc_00663"
FT   CDS_pept        701481..702080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03335"
FT                   /old_locus_tag="cpfrc_00663"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00663"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28457"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300569.1"
FT                   /protein_id="ADK28457.2"
FT                   /translation="MSTTIDGIPTPELINRDILDIGEPDEEFFRAHEAEDTVFFDAPRR
FT                   ALVVLVSDHTISSGEDTGRLLTELLTEASFSVDGIVSVKSKETQIRKAIETGVVGGVDL
FT                   VLTVGGTGVGPRDRTPEATRDVLDQNVPGIAQALRSSGLACGAVDACVSRGISGVSGST
FT                   VIVNLAPSRAAIRDGMATLAPLVHHLINQLRSYSVD"
FT   gene            702095..702304
FT                   /locus_tag="CPFRC_03340"
FT   CDS_pept        702095..702304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03340"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014300570.1"
FT                   /protein_id="QGW57322.1"
FT                   /translation="MLERKRRRVFKASPAKDYDRHADSASHNLGAIDSTDDERFVSLDG
FT                   EPLPLSHADMSFWKEQEPPHYGTQ"
FT   gene            complement(702360..702782)
FT                   /gene="mscL"
FT                   /locus_tag="CPFRC_03345"
FT                   /old_locus_tag="cpfrc_00664"
FT   CDS_pept        complement(702360..702782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="CPFRC_03345"
FT                   /old_locus_tag="cpfrc_00664"
FT                   /product="large conductance mechanosensitive channel
FT                   protein MscL"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00664"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28458"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366727.1"
FT                   /protein_id="ADK28458.1"
FT                   /translation="MLKGFKDFILRGNVVELAVAVVIGTAFTAIVTAFTNHLINPLIAS
FT                   LGGADVSGLGFHIRSGNEATFLDFGAVITAAINFLIIAAVVYFILVAPMNKLNEMAARR
FT                   KGIQEEKEAPASIEAELLEEIRDLLKTQRNGNFLSE"
FT   gene            complement(702867..703619)
FT                   /locus_tag="CPFRC_03350"
FT                   /old_locus_tag="cpfrc_00665"
FT   CDS_pept        complement(702867..703619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03350"
FT                   /old_locus_tag="cpfrc_00665"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00665"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28459"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241521.1"
FT                   /protein_id="ADK28459.1"
FT                   /translation="MTSFLAILRTPSFRRSILLRRLFACLLCVLAAVITMRQHHEPHTT
FT                   VFQYRRDIHLGEVITEKDLQAFSIPTHLLPNHAITQEEDIRFSYQRDNAHPHAAPSPSQ
FT                   KIFPLGTDKTTRRIAISARPRGSIAVKTDFLPPPQDITSVIKNISMDRGEELNLVPVRL
FT                   AQPNLSQLLHPGDRVDLVASESTPDSSSVVAAGGLVIFVPDPSSNKQNNIDYSALIAFP
FT                   KPEAQLVAAVTLIKPMSVIITGTRTQNR"
FT   gene            complement(703635..704243)
FT                   /locus_tag="CPFRC_03355"
FT                   /old_locus_tag="cpfrc_00666"
FT   CDS_pept        complement(703635..704243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03355"
FT                   /old_locus_tag="cpfrc_00666"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00666"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28460"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800213.1"
FT                   /protein_id="ADK28460.2"
FT                   /translation="MPAGQFDADKAQDLASQKQQKRRELSLARQQLRLSQRESFNNAIK
FT                   EHLAVLVKNLGATKLAAYCADQQEPGGEGLVTALFNLGITLWLPVSRPHGILEWGQYTH
FT                   PGSLRPGALGILEPQGPYKHSHDILPTLDLIVVPALGATPEGIRIGKGAGYYDRALEDS
FT                   RTPTVALLFDSEIDPAIPHESHDARTDFIITPSGTSTRQ"
FT   gene            704374..705303
FT                   /locus_tag="CPFRC_03360"
FT                   /old_locus_tag="cpfrc_00667"
FT   CDS_pept        704374..705303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03360"
FT                   /old_locus_tag="cpfrc_00667"
FT                   /product="NTP transferase domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00667"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28461"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014836158.1"
FT                   /protein_id="ADK28461.2"
FT                   /translation="MKQPQEAQDSTRVAVKTVIVPAAGMGTRFLPATKTVPKELLPVVD
FT                   TPGIELIAEEAAQLGATRLAVITAPNKQEVMEHFKRFPVLEETLQSRGKTEQYEKVVHA
FT                   SELIAPVSVVQEKPLGLGHAVGMAESVLDPDEDAVAVMLPDDLVLPRGVVEKMVEVREQ
FT                   LGGSVLCAFEVPEEEVYNYGVFEIDESAYDGPHHVKKVKGMVEKPSVEEAPSNFVATGR
FT                   YLLDRAIFDALRRITPGAGGELQLTDAIDLLIDEGHPVHILVHDGKRHDLGNPGGYIPA
FT                   VVDFGLRDPAYGPHLKKVLRKILEEHGA"
FT   gene            705558..706823
FT                   /locus_tag="CPFRC_03365"
FT                   /old_locus_tag="cpfrc_00668"
FT   CDS_pept        705558..706823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03365"
FT                   /old_locus_tag="cpfrc_00668"
FT                   /product="molybdopterin molybdenumtransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00668"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28462"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_600110.1"
FT                   /protein_id="ADK28462.1"
FT                   /translation="MRTVEQQLALVTEAAVAPEPVRIAIAEALGLMCAEEVQATRALPN
FT                   FNQAAIDGYAVRAVDVGGERGLGKAPEPRPVPTETSLPVVGEVAAGSQRPLRLQPKQAV
FT                   RVHTGAPLPTLSDAVIPLEWTDCGRKRVTANRPVRSGEFVRKVGDDIRPGDVAVSSGAI
FT                   LGPAHIGLLAAVGRSKVLVYPRPRMSVISVGHELVDIDREPSLGQVFDVNSYALAAAGR
FT                   DAGADVHRVGIAAGEPRRLREIVESHMMRSEIIVISGAVGGSGAEEIRRVLSDLGDIDT
FT                   TRVAMHPGSVQGFGLLGDHQIPVFLLPSNTVSALVIFEMFIRPVVRLSLGKRNAQRRTV
FT                   KARALNYVGSKLGRRGFIRARLMRDAETQDYLVEALGGADGTPAHLLAGLSEANAMIKI
FT                   PENAADVRPGDIVEVIFLSQNR"
FT   gene            706843..707559
FT                   /locus_tag="CPFRC_03370"
FT                   /old_locus_tag="cpfrc_00669"
FT   CDS_pept        706843..707559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03370"
FT                   /old_locus_tag="cpfrc_00669"
FT                   /product="GNAT family N-acetyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00669"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28463"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241525.1"
FT                   /protein_id="ADK28463.1"
FT                   /translation="MSFLLNRFGRPHRPARGPVDPVHPGWGEYTETLVLPGDSATQEKS
FT                   VRLRPLQLSDGAAWRMMRLSDREILESVEPTVVDSWETAHSSRMWRSFFFSIKQLADMG
FT                   SAVPFVIEVEGKFVGQLTLGGIQHGAISECWIGYWVHSSYAGQGIATAACGLGVDHAFK
FT                   RVGVHRVTATFLPENVASRKILEANGFREEGYLQRNLHIFGEWRDHFLVALTNDEFSQD
FT                   AVTRLIHARGYRRASS"
FT   gene            707721..708884
FT                   /locus_tag="CPFRC_03375"
FT                   /old_locus_tag="cpfrc_00670"
FT   CDS_pept        707721..708884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03375"
FT                   /old_locus_tag="cpfrc_00670"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28464"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013241526.1"
FT                   /protein_id="ADK28464.1"
FT                   /translation="MSGTVVIVLIVLVWLFVLAPWLLRSQKPIRKAGEAFDDTRVVYEG
FT                   GSKELQGKRRPRVKSSDVRAHHFDFHEEEEKYELVQADEFEDVLIDEPSDKTLGSIFTN
FT                   AAGKFSSKQNKTHAAIVDGELVKEIPAAGDSSVVASADEGEDVLEDADTADALDNKDPE
FT                   NSEVDAEALESQSERYEIDDSYYSPDDLMYPTEITESVSVPAEHNTADAFTDPEGYIGT
FT                   GDSELTEEDIQFAARRSARGGWDPQADALKHADLYRRRRRTVGALGIALMLALILSVSI
FT                   GGWAWVATAVVIVLTSFYLWALRQQVRAEQRLRQRRIRQLRRARLGVRNVADEELGIPN
FT                   RLRRPGAVVLEIDDDSPDFEFLESIRSPLNDSDPSGFDHYEQPRRAG"
FT   gene            708908..709321
FT                   /locus_tag="CPFRC_03380"
FT                   /old_locus_tag="cpfrc_00671"
FT   CDS_pept        708908..709321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03380"
FT                   /old_locus_tag="cpfrc_00671"
FT                   /product="DoxX family membrane protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00671"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28465"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014366732.1"
FT                   /protein_id="ADK28465.1"
FT                   /translation="MDQPIVRDIALLLLRLVLGLVFVAHGFDKFFRTGVVETTGRFSAA
FT                   GVPQPKLSAYLTAVSELVGGSLLVVGILTTFVAGALALLVCAAIYFVHLTEGLFVTNNG
FT                   IEYPLVMIVALLMIVVFGAGRASLDGVLTRADL"
FT   gene            709326..709991
FT                   /locus_tag="CPFRC_03385"
FT                   /old_locus_tag="cpfrc_00672"
FT   CDS_pept        709326..709991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03385"
FT                   /old_locus_tag="cpfrc_00672"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00672"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28466"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014558631.1"
FT                   /protein_id="ADK28466.2"
FT                   /translation="MQAALSARLDGEPTGIDDDVLDAHLSTCLECRAFYEEAARFNRSL
FT                   AFGDATERENAPDLSEAILAGVEPMWRQQAATRAWNLALARVIMVLLGIGWAAWAIVLL
FT                   IQSGSQAADALGNVDTMHERLLSEAAATRCALASGLFFAAWQPRITGGLLPLFGALWTF
FT                   SFGLGAKELIFGELSGSSALQLGLLFLSVLCLLWSWLSHKGWAIVSQGIRSLTASPHS"
FT   gene            complement(710208..711941)
FT                   /locus_tag="CPFRC_03390"
FT                   /old_locus_tag="cpfrc_00673"
FT   CDS_pept        complement(710208..711941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPFRC_03390"
FT                   /old_locus_tag="cpfrc_00673"
FT                   /product="phospholipid carrier-dependent
FT                   glycosyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:cpfrc_00673"
FT                   /db_xref="EnsemblGenomes-Tr:ADK28467"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014800219.1"
FT                   /protein_id="ADK28467.2"
FT                   /translation="MSPVTSPKNYADDRSSTAPHLPLGKSSDDAGYSHDATATGVLCDD
FT                   PAITPGSAPPRRRRKATFSGRFTHLPTPSQPRSYRWGRVDTISTLIIAALALLTRFLGI
FT                   TTATASNTPVFDEKHYVPQAWDIVESWINPVTGGIESNPGYGLVVHPPLAKQLIAIGEW
FT                   LFGYSPLGWRLVPALCGTAVVLLTMAIARRLSGSPFVAFCAGLLAVVDGVLVVTSRFGM
FT                   LDIIQVLFIVAAAWALIRDHQQMEDRMYQAWSAGLLTEPGIRAGFRWWRFTAGVFLGCA
FT                   LSVKWSGLYYMAFFGVMIVVLDALRRRRYGIRRPWSEATLFDALHSFLSLVVVPIALYV
FT                   WSWRAWFASETSVYRHAATDGTIETSSWLHHLPEAIAGWLYYHQSVLAFHSSLTTSNGH
FT                   SHPWDSKPWSWLAATRPILYYSSTNIPCEEDTCRRMIYLFGTPAIWWLTVPVLCWALWR
FT                   MVIHKDLRFLIPFVAFQAGFLPWVASYDRQMYFFYATALVPFTIVIISLILGTLYGRGA
FT                   VLQWRKLQRIGIPHLTVGSLTVILYLALAVAMFGYFSPIIYGIRITDNYFNQLMWLNSW
FT                   Q"
FT   gene            complem