(data stored in ACNUC7421 zone)

EMBL: CP002100

ID   CP002100; SV 1; circular; genomic DNA; STD; PRO; 2374137 BP.
XX
AC   CP002100;
XX
PR   Project:PRJNA32589;
XX
DT   23-SEP-2010 (Rel. 106, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Vulcanisaeta distributa DSM 14429, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Vulcanisaeta distributa DSM 14429
OC   Archaea; Crenarchaeota; Thermoprotei; Thermoproteales; Thermoproteaceae;
OC   Vulcanisaeta.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2374137
RX   PUBMED; 21304741.
RA   Mavromatis K., Sikorski J., Pabst E., Teshima H., Lapidus A., Lucas S.,
RA   Nolan M., Glavina Del Rio T., Cheng J.F., Bruce D., Goodwin L., Pitluck S.,
RA   Liolios K., Ivanova N., Mikhailova N., Pati A., Chen A., Palaniappan K.,
RA   Land M., Hauser L., Chang Y.J., Jeffries C.D., Rohde M., Spring S.,
RA   Goker M., Wirth R., Woyke T., Bristow J., Eisen J.A., Markowitz V.,
RA   Hugenholtz P., Klenk H.P., Kyrpides N.C.;
RT   "Complete genome sequence of Vulcanisaeta distributa type strain (IC-017)";
RL   Stand Genomic Sci 3(2):117-125(2010).
XX
RN   [2]
RP   1-2374137
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ivanova N., Held B., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Wirth R., Papst E., Brambilla E., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Vulcanisaeta distributa DSM 14429";
RL   Unpublished.
XX
RN   [3]
RP   1-2374137
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Held B., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Wirth R., Papst E., Brambilla E., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (16-JUL-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 7930ceb76cd1b7b96b5462a5dde69a2e.
DR   BioSample; SAMN00017002.
DR   CABRI; DSM 14429.
DR   EnsemblGenomes-Gn; EBG00001226800.
DR   EnsemblGenomes-Gn; EBG00001226801.
DR   EnsemblGenomes-Gn; EBG00001226802.
DR   EnsemblGenomes-Gn; EBG00001226803.
DR   EnsemblGenomes-Gn; EBG00001226804.
DR   EnsemblGenomes-Gn; EBG00001226805.
DR   EnsemblGenomes-Gn; EBG00001226806.
DR   EnsemblGenomes-Gn; EBG00001226807.
DR   EnsemblGenomes-Gn; EBG00001226809.
DR   EnsemblGenomes-Gn; EBG00001226810.
DR   EnsemblGenomes-Gn; EBG00001226811.
DR   EnsemblGenomes-Gn; EBG00001226812.
DR   EnsemblGenomes-Gn; EBG00001226813.
DR   EnsemblGenomes-Gn; EBG00001226814.
DR   EnsemblGenomes-Gn; EBG00001226815.
DR   EnsemblGenomes-Gn; EBG00001226816.
DR   EnsemblGenomes-Gn; EBG00001226817.
DR   EnsemblGenomes-Gn; EBG00001226818.
DR   EnsemblGenomes-Gn; EBG00001226819.
DR   EnsemblGenomes-Gn; EBG00001226820.
DR   EnsemblGenomes-Gn; EBG00001226821.
DR   EnsemblGenomes-Gn; EBG00001226822.
DR   EnsemblGenomes-Gn; EBG00001226823.
DR   EnsemblGenomes-Gn; EBG00001226824.
DR   EnsemblGenomes-Gn; EBG00001226825.
DR   EnsemblGenomes-Gn; EBG00001226826.
DR   EnsemblGenomes-Gn; EBG00001226827.
DR   EnsemblGenomes-Gn; EBG00001226828.
DR   EnsemblGenomes-Gn; EBG00001226829.
DR   EnsemblGenomes-Gn; EBG00001226830.
DR   EnsemblGenomes-Gn; EBG00001226831.
DR   EnsemblGenomes-Gn; EBG00001226832.
DR   EnsemblGenomes-Gn; EBG00001226833.
DR   EnsemblGenomes-Gn; EBG00001226834.
DR   EnsemblGenomes-Gn; EBG00001226835.
DR   EnsemblGenomes-Gn; EBG00001226836.
DR   EnsemblGenomes-Gn; EBG00001226837.
DR   EnsemblGenomes-Gn; EBG00001226838.
DR   EnsemblGenomes-Gn; EBG00001226839.
DR   EnsemblGenomes-Gn; EBG00001226840.
DR   EnsemblGenomes-Gn; EBG00001226841.
DR   EnsemblGenomes-Gn; EBG00001226842.
DR   EnsemblGenomes-Gn; EBG00001226843.
DR   EnsemblGenomes-Gn; EBG00001226844.
DR   EnsemblGenomes-Gn; EBG00001226845.
DR   EnsemblGenomes-Gn; EBG00001226846.
DR   EnsemblGenomes-Gn; EBG00001226847.
DR   EnsemblGenomes-Gn; EBG00001226848.
DR   EnsemblGenomes-Gn; EBG00001226849.
DR   EnsemblGenomes-Gn; EBG00001226850.
DR   EnsemblGenomes-Gn; EBG00001226851.
DR   EnsemblGenomes-Gn; EBG00001226852.
DR   EnsemblGenomes-Gn; EBG00001226853.
DR   EnsemblGenomes-Gn; Vdis_R0001.
DR   EnsemblGenomes-Gn; Vdis_R0002.
DR   EnsemblGenomes-Gn; Vdis_R0003.
DR   EnsemblGenomes-Gn; Vdis_R0004.
DR   EnsemblGenomes-Gn; Vdis_R0005.
DR   EnsemblGenomes-Gn; Vdis_R0006.
DR   EnsemblGenomes-Gn; Vdis_R0007.
DR   EnsemblGenomes-Gn; Vdis_R0008.
DR   EnsemblGenomes-Gn; Vdis_R0009.
DR   EnsemblGenomes-Gn; Vdis_R0010.
DR   EnsemblGenomes-Gn; Vdis_R0011.
DR   EnsemblGenomes-Gn; Vdis_R0012.
DR   EnsemblGenomes-Gn; Vdis_R0013.
DR   EnsemblGenomes-Gn; Vdis_R0014.
DR   EnsemblGenomes-Gn; Vdis_R0015.
DR   EnsemblGenomes-Gn; Vdis_R0016.
DR   EnsemblGenomes-Gn; Vdis_R0017.
DR   EnsemblGenomes-Gn; Vdis_R0018.
DR   EnsemblGenomes-Gn; Vdis_R0019.
DR   EnsemblGenomes-Gn; Vdis_R0020.
DR   EnsemblGenomes-Gn; Vdis_R0021.
DR   EnsemblGenomes-Gn; Vdis_R0022.
DR   EnsemblGenomes-Gn; Vdis_R0023.
DR   EnsemblGenomes-Gn; Vdis_R0024.
DR   EnsemblGenomes-Gn; Vdis_R0025.
DR   EnsemblGenomes-Gn; Vdis_R0026.
DR   EnsemblGenomes-Gn; Vdis_R0027.
DR   EnsemblGenomes-Gn; Vdis_R0028.
DR   EnsemblGenomes-Gn; Vdis_R0029.
DR   EnsemblGenomes-Gn; Vdis_R0030.
DR   EnsemblGenomes-Gn; Vdis_R0031.
DR   EnsemblGenomes-Gn; Vdis_R0032.
DR   EnsemblGenomes-Gn; Vdis_R0033.
DR   EnsemblGenomes-Gn; Vdis_R0034.
DR   EnsemblGenomes-Gn; Vdis_R0035.
DR   EnsemblGenomes-Gn; Vdis_R0036.
DR   EnsemblGenomes-Gn; Vdis_R0037.
DR   EnsemblGenomes-Gn; Vdis_R0038.
DR   EnsemblGenomes-Gn; Vdis_R0039.
DR   EnsemblGenomes-Gn; Vdis_R0040.
DR   EnsemblGenomes-Gn; Vdis_R0041.
DR   EnsemblGenomes-Gn; Vdis_R0042.
DR   EnsemblGenomes-Gn; Vdis_R0043.
DR   EnsemblGenomes-Gn; Vdis_R0044.
DR   EnsemblGenomes-Gn; Vdis_R0045.
DR   EnsemblGenomes-Gn; Vdis_R0046.
DR   EnsemblGenomes-Gn; Vdis_R0047.
DR   EnsemblGenomes-Gn; Vdis_R0048.
DR   EnsemblGenomes-Gn; Vdis_R0049.
DR   EnsemblGenomes-Tr; EBT00001795643.
DR   EnsemblGenomes-Tr; EBT00001795644.
DR   EnsemblGenomes-Tr; EBT00001795645.
DR   EnsemblGenomes-Tr; EBT00001795646.
DR   EnsemblGenomes-Tr; EBT00001795647.
DR   EnsemblGenomes-Tr; EBT00001795648.
DR   EnsemblGenomes-Tr; EBT00001795649.
DR   EnsemblGenomes-Tr; EBT00001795650.
DR   EnsemblGenomes-Tr; EBT00001795651.
DR   EnsemblGenomes-Tr; EBT00001795652.
DR   EnsemblGenomes-Tr; EBT00001795653.
DR   EnsemblGenomes-Tr; EBT00001795654.
DR   EnsemblGenomes-Tr; EBT00001795655.
DR   EnsemblGenomes-Tr; EBT00001795656.
DR   EnsemblGenomes-Tr; EBT00001795657.
DR   EnsemblGenomes-Tr; EBT00001795658.
DR   EnsemblGenomes-Tr; EBT00001795659.
DR   EnsemblGenomes-Tr; EBT00001795660.
DR   EnsemblGenomes-Tr; EBT00001795661.
DR   EnsemblGenomes-Tr; EBT00001795662.
DR   EnsemblGenomes-Tr; EBT00001795663.
DR   EnsemblGenomes-Tr; EBT00001795664.
DR   EnsemblGenomes-Tr; EBT00001795665.
DR   EnsemblGenomes-Tr; EBT00001795666.
DR   EnsemblGenomes-Tr; EBT00001795667.
DR   EnsemblGenomes-Tr; EBT00001795668.
DR   EnsemblGenomes-Tr; EBT00001795670.
DR   EnsemblGenomes-Tr; EBT00001795671.
DR   EnsemblGenomes-Tr; EBT00001795672.
DR   EnsemblGenomes-Tr; EBT00001795673.
DR   EnsemblGenomes-Tr; EBT00001795674.
DR   EnsemblGenomes-Tr; EBT00001795675.
DR   EnsemblGenomes-Tr; EBT00001795676.
DR   EnsemblGenomes-Tr; EBT00001795677.
DR   EnsemblGenomes-Tr; EBT00001795678.
DR   EnsemblGenomes-Tr; EBT00001795679.
DR   EnsemblGenomes-Tr; EBT00001795680.
DR   EnsemblGenomes-Tr; EBT00001795681.
DR   EnsemblGenomes-Tr; EBT00001795682.
DR   EnsemblGenomes-Tr; EBT00001795683.
DR   EnsemblGenomes-Tr; EBT00001795684.
DR   EnsemblGenomes-Tr; EBT00001795685.
DR   EnsemblGenomes-Tr; EBT00001795686.
DR   EnsemblGenomes-Tr; EBT00001795687.
DR   EnsemblGenomes-Tr; EBT00001795688.
DR   EnsemblGenomes-Tr; EBT00001795689.
DR   EnsemblGenomes-Tr; EBT00001795690.
DR   EnsemblGenomes-Tr; EBT00001795691.
DR   EnsemblGenomes-Tr; EBT00001795692.
DR   EnsemblGenomes-Tr; EBT00001795693.
DR   EnsemblGenomes-Tr; EBT00001795694.
DR   EnsemblGenomes-Tr; EBT00001795695.
DR   EnsemblGenomes-Tr; EBT00001795696.
DR   EnsemblGenomes-Tr; Vdis_R0001-1.
DR   EnsemblGenomes-Tr; Vdis_R0002-1.
DR   EnsemblGenomes-Tr; Vdis_R0003-1.
DR   EnsemblGenomes-Tr; Vdis_R0004-1.
DR   EnsemblGenomes-Tr; Vdis_R0005-1.
DR   EnsemblGenomes-Tr; Vdis_R0006-1.
DR   EnsemblGenomes-Tr; Vdis_R0007-1.
DR   EnsemblGenomes-Tr; Vdis_R0008-1.
DR   EnsemblGenomes-Tr; Vdis_R0009-1.
DR   EnsemblGenomes-Tr; Vdis_R0010-1.
DR   EnsemblGenomes-Tr; Vdis_R0011-1.
DR   EnsemblGenomes-Tr; Vdis_R0012-1.
DR   EnsemblGenomes-Tr; Vdis_R0013-1.
DR   EnsemblGenomes-Tr; Vdis_R0014-1.
DR   EnsemblGenomes-Tr; Vdis_R0015-1.
DR   EnsemblGenomes-Tr; Vdis_R0016-1.
DR   EnsemblGenomes-Tr; Vdis_R0017-1.
DR   EnsemblGenomes-Tr; Vdis_R0018-1.
DR   EnsemblGenomes-Tr; Vdis_R0019-1.
DR   EnsemblGenomes-Tr; Vdis_R0020-1.
DR   EnsemblGenomes-Tr; Vdis_R0021-1.
DR   EnsemblGenomes-Tr; Vdis_R0022-1.
DR   EnsemblGenomes-Tr; Vdis_R0023-1.
DR   EnsemblGenomes-Tr; Vdis_R0024-1.
DR   EnsemblGenomes-Tr; Vdis_R0025-1.
DR   EnsemblGenomes-Tr; Vdis_R0026-1.
DR   EnsemblGenomes-Tr; Vdis_R0027-1.
DR   EnsemblGenomes-Tr; Vdis_R0028-1.
DR   EnsemblGenomes-Tr; Vdis_R0029-1.
DR   EnsemblGenomes-Tr; Vdis_R0030-1.
DR   EnsemblGenomes-Tr; Vdis_R0031-1.
DR   EnsemblGenomes-Tr; Vdis_R0032-1.
DR   EnsemblGenomes-Tr; Vdis_R0033-1.
DR   EnsemblGenomes-Tr; Vdis_R0034-1.
DR   EnsemblGenomes-Tr; Vdis_R0035-1.
DR   EnsemblGenomes-Tr; Vdis_R0036-1.
DR   EnsemblGenomes-Tr; Vdis_R0037-1.
DR   EnsemblGenomes-Tr; Vdis_R0038-1.
DR   EnsemblGenomes-Tr; Vdis_R0039-1.
DR   EnsemblGenomes-Tr; Vdis_R0040-1.
DR   EnsemblGenomes-Tr; Vdis_R0041-1.
DR   EnsemblGenomes-Tr; Vdis_R0042-1.
DR   EnsemblGenomes-Tr; Vdis_R0043-1.
DR   EnsemblGenomes-Tr; Vdis_R0044-1.
DR   EnsemblGenomes-Tr; Vdis_R0045-1.
DR   EnsemblGenomes-Tr; Vdis_R0046-1.
DR   EnsemblGenomes-Tr; Vdis_R0047-1.
DR   EnsemblGenomes-Tr; Vdis_R0048-1.
DR   EnsemblGenomes-Tr; Vdis_R0049-1.
DR   EuropePMC; PMC5069417; 27807432.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00062; HgcC.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01139; sR2.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002100.
DR   SILVA-SSU; CP002100.
DR   StrainInfo; 304275; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085237
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Vulcanisaeta distributa DSM 14429
CC   collection_date     :: September 1993
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Japan
CC   environment         :: Fresh water, Hot spring
CC   num_replicons       :: Missing
CC   ref_biomaterial     :: DSM 14429, JCM 11212
CC   biotic_relationship :: Free living
CC   trophic_level       :: Heterotroph
CC   rel_to_oxygen       :: Anaerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS 454/Illumina
CC   assembly            :: Newbler v. 2.3
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02950
CC   Type Strain         :: Yes
CC   Greengenes ID       :: 19003
CC   Isolation Site      :: Hot spring from Kanagawa, Ohwakudani, Japan
CC                          on 9/1993
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Nonmotile
CC   Temperature Range   :: Hyperthermophile
CC   Temperature Optimum :: 90C
CC   pH                  :: 4.0 - 4.5
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2374137
FT                   /organism="Vulcanisaeta distributa DSM 14429"
FT                   /strain="DSM 14429"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Kanagawa, Ohwakudani"
FT                   /isolation_source="hot spring"
FT                   /collection_date="Sep-1993"
FT                   /db_xref="taxon:572478"
FT   gene            2..502
FT                   /locus_tag="Vdis_0001"
FT   CDS_pept        2..502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0001"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_0922 hypothetical protein; SPTR:
FT                   A8MD99 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49416"
FT                   /db_xref="GOA:E1QRP1"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRP1"
FT                   /protein_id="ADN49416.1"
FT                   /translation="MSIMVNKVLITVKSSFEYGIRQDIRDYLFFFDKDVNVKATEFRGV
FT                   LIVETGKDPKYVASLLVNAPIPESVLTSIVPIIYEGSYSTVNDLISAVRKYVSGDCRVY
FT                   VVRCRLRGSLISNSDCENALINLLRSLGFHAIYRGDSDCVVIIEGLVNWFGIYVGPRSF
FT                   VRV"
FT   gene            584..1777
FT                   /locus_tag="Vdis_0002"
FT   CDS_pept        584..1777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0002"
FT                   /product="orc1/cdc6 family replication initiation protein"
FT                   /note="COGs: COG1474 Cdc6-related protein AAA superfamily
FT                   ATPase; InterPro IPR014277:IPR003593:IPR011991:IPR015163;
FT                   KEGG: cma:Cmaq_0923 cell division control protein 6; PFAM:
FT                   CDC6 domain protein; SMART: AAA ATPase; SPTR: A8MDA0 Cell
FT                   division control protein 6 related; TIGRFAM: orc1/cdc6
FT                   family replication initiation protein; PFAM: CDC6, C
FT                   terminal; TIGRFAM: orc1/cdc6 family replication initiation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49417"
FT                   /db_xref="GOA:E1QRP2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRP2"
FT                   /protein_id="ADN49417.1"
FT                   /translation="MPRIFKNEAALTPEYIPSKLPHREEQLKQLETYFSGFLESPGSMY
FT                   PKVVLIGRPGSGKTVTSRKFGNYVVRSSERVRYVHVSCFLNRTLSSVLKDIGVQLNIAI
FT                   PKRGFSTEELLKMLLDMVRDKDIYAIVALDDVFHLVNNSGPHALGTLIRLGEEYVSRGD
FT                   KYRFGLILISQDLTFRDQLDRSSQSALGNAVIKFEPYTKDQIFEILLARAQEALVDGAY
FT                   DEEILEMIADVAGVDEKSMDEHRGDARYAIDILWRASKLAEMKGVDRILPEHVREAIKN
FT                   TLRGIRSDELRMLPLHEKIFLLAIVRSLMKNPNSPYIPFGTAEDEYQMLCEQYGQEPRK
FT                   HTQLWEYLRDLNTKGFVETRTSSKGMRGRTTLISIPSEPLETLKEELEKIIKGELGT"
FT   gene            1774..2085
FT                   /locus_tag="Vdis_0003"
FT   CDS_pept        1774..2085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0003"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001845; KEGG: pai:PAE0738
FT                   transcriptional regulatory protein (helix-turn-helix),
FT                   putative; SPTR: Q8ZYK0 Transcriptional regulatory protein
FT                   (Helix-turn-helix), putative; PFAM: Bacterial regulatory
FT                   protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49418"
FT                   /db_xref="GOA:E1QRP3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRP3"
FT                   /protein_id="ADN49418.1"
FT                   /translation="MSIDFIEDLFSSRIRVRVLRALIKYKEVNITKLSRELGVNYKVIE
FT                   YHVEALKRLGIAEEKRFGRIRIIRLSEGDPRVLAIERFFSELEHAFMNQSDSRSQGSS"
FT   gene            complement(2045..2872)
FT                   /locus_tag="Vdis_0004"
FT   CDS_pept        complement(2045..2872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0004"
FT                   /product="Citrate (pro-3S)-lyase"
FT                   /EC_number="4.1.3.6"
FT                   /note="COGs: COG2301 Citrate lyase beta subunit; InterPro
FT                   IPR015813:IPR011206:IPR005000; KEGG: sai:Saci_0312
FT                   citryl-CoA lyase beta subunit-like protein; PFAM: HpcH/HpaI
FT                   aldolase; PRIAM: Citrate (pro-3S)-lyase; SPTR: Q704B1
FT                   Citrate lyase beta subunit; PFAM: HpcH/HpaI
FT                   aldolase/citrate lyase family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49419"
FT                   /db_xref="GOA:E1QRP4"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRP4"
FT                   /protein_id="ADN49419.1"
FT                   /translation="MVLRRSQLFVPGNNEHMIRKAALELKPDSVIIDLEDAVPIDGKES
FT                   ARKLIRELLPQLDWKGKELCVRVNDPKTPFFYADIDTVYKIDVVKCIVIPKAEFDLSFV
FT                   YKATGREIEPLIETARGLLRVEDVIRSEGVTAVSYGAADFALSVGGVVKTYEQSQVLKT
FT                   LVVSAARAYGVDPIDKVFFDIKDIEGFRKECVEAKSMGFIGKQVIHPSQIPVANEVFSP
FT                   SEEEINWARRVVEAYEKAVREGRGAISLEGQLVDYVHYKLAKRILDFANQTDS"
FT   gene            complement(2912..3868)
FT                   /locus_tag="Vdis_0005"
FT   CDS_pept        complement(2912..3868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0005"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="COGs: COG1064 Zn-dependent alcohol dehydrogenase;
FT                   InterProIPR002328:IPR011032:IPR016040:IPR013154:IPR 013149;
FT                   KEGG: mse:Msed_0398 alcohol dehydrogenase; PFAM: Alcohol
FT                   dehydrogenase GroES domain protein; Alcohol dehydrogenase
FT                   zinc-binding domain protein; SPTR: A4YDS3 Alcohol
FT                   dehydrogenase GroES domain protein; PFAM: Alcohol
FT                   dehydrogenase GroES-like domain; Zinc-binding
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49420"
FT                   /db_xref="GOA:E1QRP5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRP5"
FT                   /protein_id="ADN49420.1"
FT                   /translation="MRVLAAVLREFNKPFSIEEYDIGEPGPNDIVVRVKAEGICGRDLV
FT                   IWRGGFRNLKPPLILGHEIFGEVDGRAVGVFGAITDGTCPYCRAGKENLCLNLQFFGEG
FT                   RPGGYAEVVIAPRSNVFELPDNDYVKYAAAVCPLATAIHASKLGNIGPGTRVLVTGAGG
FT                   GVGIHTIQYLKSLGAYVISITSPAKADFVAKYSDEVITDREFSRKVRDVDVVLEIVGAA
FT                   TINESLRVLKREGTLVLIGNTEGEEIRLIRPALTVMREHRIVGSAAYTRREVLEAVDLL
FT                   HRGVVKPVYKVYNFKDVNQAYNDLVNQRVLGRAVLVF"
FT   gene            3938..5062
FT                   /locus_tag="Vdis_0006"
FT   CDS_pept        3938..5062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0006"
FT                   /product="Dolichyl-phosphate beta-D-mannosyltransferase"
FT                   /EC_number="2.4.1.83"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: cma:Cmaq_0619
FT                   glycosyl transferase family protein; PFAM: glycosyl
FT                   transferase family 2; PRIAM: Dolichyl-phosphate
FT                   beta-D-mannosyltransferase; SPTR: A8MCF4 Glycosyl
FT                   transferase family 2; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49421"
FT                   /db_xref="GOA:E1QRP6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRP6"
FT                   /protein_id="ADN49421.1"
FT                   /translation="MPNQLFSVKVMLISLVPAYYQVDACIVLPTINEADNLRILLPMLR
FT                   NYLADYDWFIVVVDDGSTDGTQDVVMEFARVTNRAELIERGAKLGLGSAIKTGMRACLD
FT                   KGANSIVVMDADLQHPPDVVPNLVKAVLVNGVDLAIASRYVKGGGIVGWSFKRLAISKG
FT                   ATYMARLLMPWTRSIKDPISGFFAVNAGKLRGVIDMLSDSSGYKLILELLTLFHVKYGN
FT                   SLRVVEVPYIFRNRAYGVSKLGTHELINYALLVLKLSNYSVPKYLVSLLIGSIIGYFLF
FT                   NLSSSLNPIAGNLISIELSLITVITIYQLLMGMKPQLQYYIKYHLIKYVAVAVKLLLYM
FT                   ASTPVVIALIISGVIQLLMTLGIITVNPTAVHVL"
FT   gene            5108..6160
FT                   /locus_tag="Vdis_0007"
FT   CDS_pept        5108..6160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0007"
FT                   /product="putative RNA methylase"
FT                   /note="COGs: COG0116 N6-adenine-specific DNA methylase;
FT                   InterPro IPR002052:IPR000241; KEGG: pis:Pisl_0408 putative
FT                   RNA methylase; PFAM: putative RNA methylase; SPTR: A1RRK4
FT                   Putative RNA methylase; PFAM: Putative RNA methylase family
FT                   UPF0020"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49422"
FT                   /db_xref="GOA:E1QRP7"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRP7"
FT                   /protein_id="ADN49422.1"
FT                   /translation="MRVLLTTVPGIEDAVISEVKELFKDRVVTAEVFGSSNVTGKVLID
FT                   INNVTINELKALGTVEHVVMVLDIKNVGRDMGSLRDCIWKLRLDELLNYYTVNTTIGIM
FT                   ADRSGDHEFKSPDAAALLGERISEFLMSMGLKSLFNLDNADLTLRLIIDQDKCVLGLSI
FT                   TRKPLRNRPYRKFNHPASINPILANAMFRILSPAPSSRICDVTCGSGTIVIEGALMRRD
FT                   VIFLCADIDYGYVNGALANAREANVDYLIDFVVMDSTRPAIRDNACSYAIFNPPFGIRI
FT                   EPLKGIADFYGSLFRALRNVLRDGSSMVFITVRKSLAKKLLVKYGFRIVSERVVEQGGI
FT                   WSSIFKVVKE"
FT   gene            complement(6190..6966)
FT                   /locus_tag="Vdis_0008"
FT   CDS_pept        complement(6190..6966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0008"
FT                   /product="Protein of unknown function DUF2192"
FT                   /note="COGs: COG4879 conserved hypothetical protein;
FT                   InterPro IPR018693; KEGG: cma:Cmaq_1302 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2192; SPTR:
FT                   A8M8R0 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized protein conserved in archaea (DUF2192)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49423"
FT                   /db_xref="InterPro:IPR018693"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRP8"
FT                   /protein_id="ADN49423.1"
FT                   /translation="MSSGLDARQLYKGRIEAATEIWSKIMRNEVSTRNQLEELVYIVYK
FT                   QKGIEPFRGLSKVRIYDKEIATIYIIGKYGLGLLDGELTNAFRNIFNVEVACDEIYSFL
FT                   KSKNFQLNDNNDTEQFRKMVDNEVLGPRTEERGFRLLRYVFTGTIMRFFPEEDFVGTYR
FT                   ALSTAYPDLASRFMRYVRFYVAFRVAEDIALGSIKKIEEKKIMKYTHCLRLNLTKCVPH
FT                   DKLIREIALRVYKVPKKILDRLFPNEDQRSFIPKAQ"
FT   gene            complement(7032..7577)
FT                   /locus_tag="Vdis_0009"
FT   CDS_pept        complement(7032..7577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0009"
FT                   /product="Ribosomal protein L10e/L16"
FT                   /note="COGs: COG0197 Ribosomal protein L16/L10E; InterPro
FT                   IPR018255:IPR016180:IPR001197; KEGG: cma:Cmaq_0968 50S
FT                   ribosomal protein L10e; PFAM: Ribosomal protein L10e/L16;
FT                   SPTR: A8MDE4 50S ribosomal protein L10e; PFAM: Ribosomal
FT                   protein L16p/L10e; TIGRFAM: ribosomal protein L10.e"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49424"
FT                   /db_xref="GOA:E1QRP9"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR018255"
FT                   /db_xref="InterPro:IPR022981"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRP9"
FT                   /protein_id="ADN49424.1"
FT                   /translation="MPLRPGRCYRRLKRPYTRTEYIAGAPYVQIPRFELGNTKPRERAR
FT                   FDYVAELVAEETGQIRANALEAARQMAYKYLSKYVGDPNFYLKINVYPFHVIRENKMLA
FT                   MAGADRLQQGMRLAFGVPSGRAARILRPGTIIMHLEIEGKNLAHAKEALKRAASKLPLP
FT                   MRIVIYPKQAQAKVVAQS"
FT   gene            complement(7627..7905)
FT                   /locus_tag="Vdis_0010"
FT   CDS_pept        complement(7627..7905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011991; KEGG: pai:PAE3014 hypothetical
FT                   protein; SPTR: Q8ZTZ7 Conserved within P. aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49425"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRQ0"
FT                   /protein_id="ADN49425.1"
FT                   /translation="MSSREFRPDLYVLARIIEALVNNGTMRRTRLATACGLSYDKFERY
FT                   LEWMVSRGLVMIDGDGLVRLTRDGERTYEELVLWIKRYVGSLRINRI"
FT   gene            complement(7880..8554)
FT                   /locus_tag="Vdis_0011"
FT   CDS_pept        complement(7880..8554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btr:Btr_0490 hypothetical protein; SPTR:
FT                   A9INE1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49426"
FT                   /db_xref="GOA:E1QRQ1"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRQ1"
FT                   /protein_id="ADN49426.1"
FT                   /translation="MSIEDARTKLMALKDVLNHIEGINKAMDELPKLLITVLGIVAMVL
FT                   GGYIAYIIIYVLTARSMAPQLQSWGVIIISILLIAIPYYVYTRIDKLMRGVSTYDYWVG
FT                   KLQSGISGILEVLSTLDFDGIEYKINRARAGYALLIIVKLLALSILLAILIFGLTLLLL
FT                   SFLGYTQLNWYVIAMTVILDIAITLALEWDSITNDVKKLWSLGGLIIELRWLYHELKGI
FT                   QA"
FT   gene            complement(8551..9147)
FT                   /locus_tag="Vdis_0012"
FT   CDS_pept        complement(8551..9147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0012"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ebw:BWG_1827 putative polisoprenol-linked
FT                   O-antigen transporter; SPTR: C4ZSC5 Predicted
FT                   polisoprenol-linked O-antigen transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49427"
FT                   /db_xref="GOA:E1QRQ2"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRQ2"
FT                   /protein_id="ADN49427.1"
FT                   /translation="MRVPKAIGRVLIVLLLIIVLAEIAFLLINWRNMIDVNTVRFFTIN
FT                   STTGLLLLTLVTHNAYAKVIIIIENPSNETLLIYLSNGTTMTLGPLSKVKLTYLFTPSS
FT                   YYSFPTCSGALGLVSPNASITIPFSLNSMVNPIVIYENVTSLRLLRQVVPIILMQIRHV
FT                   SQCAMLGTDLLVTTANDEDESVTIMVIVSKLVIVV"
FT   gene            complement(9204..9659)
FT                   /locus_tag="Vdis_0013"
FT   CDS_pept        complement(9204..9659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0013"
FT                   /product="ubiquitin-associated-domain-containing protein"
FT                   /note="COGs: COG1308 Transcription factor homologous to
FT                   NACalpha-BTF3; InterPro IPR002715:IPR000449; KEGG:
FT                   cma:Cmaq_0650 ubiquitin-associated domain-containing
FT                   protein; PFAM: ubiquitin-associated- domain-containing
FT                   protein; SPTR: A8MCI4
FT                   Ubiquitin-associated-domain-containing protein; PFAM: NAC
FT                   domain; UBA/TS-N domain; TIGRFAM: alpha-NAC-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49428"
FT                   /db_xref="GOA:E1QRQ3"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR005231"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR038187"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRQ3"
FT                   /protein_id="ADN49428.1"
FT                   /translation="MGINPREVRRLLKRFGIQDLNLEEVSNVTKVIIYLGDGSTIEINK
FT                   PVVARMRIQGLSIYQVQASDSDVKVVKPQSTLPQPRPSLIIQQPQKQATQTLAAETTKQ
FT                   YEPSEDDIKLVMEETGCTREEAIRALKETNGDIAEAIVKIQSQKGAK"
FT   gene            complement(9711..10637)
FT                   /locus_tag="Vdis_0014"
FT   CDS_pept        complement(9711..10637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0014"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012336; KEGG: cma:Cmaq_0050 hypothetical
FT                   protein; SPTR: A8M9M3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49429"
FT                   /db_xref="GOA:E1QRQ4"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRQ4"
FT                   /protein_id="ADN49429.1"
FT                   /translation="MSSSTNINRMLLVAVIVLAVALAAVLIYFLAFKTTPTQKTPSSQG
FT                   SSSSSSQNSASSQLSLATTAFERGVENWLSIECIYSNYGENATLNAVNSIYTIAYNYIY
FT                   DYEETNNVTYLLLYPIAQYQYIESNYAKCAINESDQGLVNTVLGALSNINTVAYTLNIP
FT                   GNLLGTPLFIVFDRTNNVTYVLAGASPYVFNAINDAVRGNITVFTYQGQELGYGFRANS
FT                   TQVSFIDQIISSGLRIGNPSANITVIEFLDPVCPYCALFQVMYGRSLETMINSGYVYYV
FT                   IQYFPTHVLGYGCSSPTIAQMLGPYCG"
FT   sig_peptide     complement(10569..10637)
FT                   /locus_tag="Vdis_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            10736..11155
FT                   /locus_tag="Vdis_0015"
FT   CDS_pept        10736..11155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_0769 hypothetical protein; SPTR:
FT                   A8MCU8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49430"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRQ5"
FT                   /protein_id="ADN49430.1"
FT                   /translation="MAIRLRVKLSSIMGKTTVAKALVTTGYETQEPEVLIPRGVAEDLN
FT                   LLPKLPSGSEVKNYVLADGTVTRLILIPNAVQVWVLENDREVGGITAHAVISERADEVL
FT                   LSDKLVSKLGIVLLDIGEGIWCFKDEIGKTVRRSL"
FT   gene            complement(11139..13895)
FT                   /locus_tag="Vdis_0016"
FT   CDS_pept        complement(11139..13895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0016"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="COGs: COG0013 Alanyl-tRNA synthetase;
FT                   InterProIPR018165:IPR018162:IPR018163:IPR002318:IPR
FT                   018164:IPR012947; KEGG: cma:Cmaq_1898 alanyl-tRNA
FT                   synthetase; PFAM: Alanyl-tRNA synthetase, class IIc-like;
FT                   Threonyl/alanyl tRNA synthetase SAD; PRIAM: Alanine--tRNA
FT                   ligase; SPTR: A8MBI2 Alanyl-tRNA synthetase; TIGRFAM:
FT                   alanyl-tRNA synthetase; PFAM: Threonyl and Alanyl tRNA
FT                   synthetase second additional domain; tRNA synthetases class
FT                   II (A); TIGRFAM: alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49431"
FT                   /db_xref="GOA:E1QRQ6"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR022429"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRQ6"
FT                   /protein_id="ADN49431.1"
FT                   /translation="MEELRTRLFDRMRFYRKQCPYCKHYFWTLNKDQESCGDQPCTPYL
FT                   FIGNPPGKFRPESIRDVRERFLNFFERHGHVRIKRYPVVARWRTDVYLVGASIYDFQPW
FT                   VTEGIVPPPANPLTLSQPSIRFTDIDKVGRSGRHLTGFEMMAHHAFNYPDKYIYWIDET
FT                   VEYAHEFFTKELGLKDHEITYKENIWEGGGNAGECLEVLVSGLEIATLVFMHYRTVNGK
FT                   YVEMPMKIVDTGYGLERIYWLLTGKPTVYDAVFGPFIEKLRSKLGLPKPSNEMLMHMAT
FT                   YFGQLDPEVTSIEKAYEYISSKVGMDVNEVRNILKAQETLYILSDHGRTLSWMMADGVI
FT                   PSNSGVGYLGRLLLRRMLRSMYVAGIEMPLTEVMDMELEFLRDDYPEVYEERQTILELV
FT                   DLEERKFKELLRQAPGIIDRVIRDRERRTGKRELTVDDLIMLYDSQGLPPEVVREVASS
FT                   RLGLSVVVPDDFYSRLAARYQRQVGEEKPKVDVNPVEVQDLPQTRELFYENMRLFQFNA
FT                   KVLRVIRGKYVVLDQTAFYPEGGGQVADHGVIRHSRGEARVIDVQRVGPVIVHVIEGEP
FT                   PMEGETVEGIVDATRRLDLMRMHTATHILLQSIRRVLGRHVWQAGAEKNVPFSRLDVTH
FT                   YKLPSRDEIRKIEELANQMVVANYPVIIRWLGRTDAESKFGVYIYQGGAVPGAKLRIVQ
FT                   VGPDDNPYDVEACGGMHVGSTGEIGMIKIVKVEKIQEGVVRFIFTTGRHALNYTESLED
FT                   SINEVSELIGKGREDVVKGVKELLSDVSKMEGRIKALTRKAIKGDIAEAMGRETAINGV
FT                   GFTYMEYENEDRNYIQEFAKEYLGARPNTVLLIINRVSNGTEYMVYLSPETAKRVSIKE
FT                   LMARLNASVNGKGGGSTTYGQGFAQGRPPVDTLVSTVKSFLSSISSS"
FT   gene            complement(13959..14870)
FT                   /locus_tag="Vdis_0017"
FT   CDS_pept        complement(13959..14870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0017"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; KEGG: pis:Pisl_0153 beta-lactamase
FT                   domain-containing protein; SPTR: A1RQV4 Beta-lactamase
FT                   domain protein; PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49432"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR037482"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRQ7"
FT                   /protein_id="ADN49432.1"
FT                   /translation="MVRVIEVMNNVYQIDLEPGGFSNLVSVYAINTGKGIIVFEGGPAV
FT                   SSNDLRNALRRLPSNVTHAFITHVHIDHYGGTGALTGLNPNIEVYVHPRGSKVLPNPDI
FT                   IWVPAREAMGWLGELYGRPLEVPSKNARETKDGDRVTIGDVTVEVIHTPGHASHHQSFI
FT                   VEPWDILIVGDAAGIYVRDLDYIIPTTMEPLRFDMYVDSVKKLIARNPKYIAYTHHLLV
FT                   PNATELLNRHLRQLDVWGKAAEEAVREGLSVNDLEGMLVERDQDLRRVYDRLRNMKAHY
FT                   HLFGMAVDGLYKYFRDLETKRK"
FT   gene            complement(14983..16044)
FT                   /locus_tag="Vdis_0018"
FT   CDS_pept        complement(14983..16044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0018"
FT                   /product="ribosomal protein L10"
FT                   /note="COGs: COG0244 Ribosomal protein L10; InterPro
FT                   IPR001790; KEGG: tne:Tneu_1654 acidic ribosomal protein P0;
FT                   PFAM: ribosomal protein L10; SPTR: B1YAC7 Ribosomal protein
FT                   L10; PFAM: Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49433"
FT                   /db_xref="GOA:E1QRQ8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022909"
FT                   /db_xref="InterPro:IPR040637"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRQ8"
FT                   /protein_id="ADN49433.1"
FT                   /translation="MASQPVFKRTYVRTKPYPEKKVRIVNELKELFSKYENVFVIDIHE
FT                   TSNRVLQEYRFWLRRRGARVIKAKNTLVLIALRQLMGNVSEDIEKLFTGENLLIFSNEN
FT                   PFELAKWIWGTGVRREAMPGDIAPFDLVAPAGNTNMSPGPIMSKFGKLKIPIKVQDGKI
FT                   WIVKDTVVVKKGDKINEDAAEILKKLNIKPIFETLKIKAAILKGKYVITVDNLKLDVGT
FT                   YRSMIEDAVRYAFNLAVNTAYPTPEVLRVSIAKAHMEALNLAVNARYVTPETAQYILAK
FT                   AVAEANALAAVIAPKAPELGLQVAQQPQQVKTEEAKAEEKKAEEKKEEAGEEKKEGPSE
FT                   EEVAAGFSSLFGS"
FT   gene            complement(16172..16831)
FT                   /locus_tag="Vdis_0019"
FT   CDS_pept        complement(16172..16831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0019"
FT                   /product="ribosomal protein L1"
FT                   /note="COGs: COG0081 Ribosomal protein L1; InterPro
FT                   IPR002143:IPR016095; KEGG: cma:Cmaq_1928 ribosomal protein
FT                   L1; PFAM: ribosomal protein L1; SPTR: A8MBL2 Ribosomal
FT                   protein L1; PFAM: Ribosomal protein L1p/L10e family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49434"
FT                   /db_xref="GOA:E1QRQ9"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023669"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRQ9"
FT                   /protein_id="ADN49434.1"
FT                   /translation="MSLNLDAIIKAVTEAKAKAKKRRFKQTYELIVRFKDFDVKNQANR
FT                   FNITIALPHPLQGKEPKVCVMATGAMVLAAKEAKADAILTREDIEKLAGNKKEIRRLAN
FT                   SFDYFVATPDLMVLIGRVMGQILGPRNKMPEVIQPNADIKAVIDRLKRSVRVRVKDQPQ
FT                   VMCKVGTEDMDPKQVAENIATVLDEILKRVRPEQLGDVSVKLTMGPPITFSPLTSK"
FT   gene            complement(16901..17419)
FT                   /locus_tag="Vdis_0020"
FT   CDS_pept        complement(16901..17419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0020"
FT                   /product="Ribosomal protein L11"
FT                   /note="COGs: COG0080 Ribosomal protein L11; InterPro
FT                   IPR020783:IPR000911:IPR020784; KEGG: cma:Cmaq_0676
FT                   ribosomal protein L11; PFAM: Ribosomal protein L11-like;
FT                   SMART: ribosomal protein L11; SPTR: A8MCL0 Ribosomal
FT                   protein L11; PFAM: Ribosomal protein L11, RNA binding
FT                   domain; Ribosomal protein L11, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49435"
FT                   /db_xref="GOA:E1QRR0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRR0"
FT                   /protein_id="ADN49435.1"
FT                   /translation="MAKRVVKIAVAPGKAGGPAVQQLSQYGVDVNKVTEEINKKTKILT
FT                   NYGINNVFVEIEIDEDTKSFDIKPELPPIADLIMKAIGKDTGSHQAVKELIGDISIEKL
FT                   AEIAYIKWEELRSRNFKNALKQVVSACRSIGVTIGGKDPKQVLKEIDAGSYNNVISKYE
FT                   ELLRQEGRL"
FT   gene            complement(17462..17932)
FT                   /locus_tag="Vdis_0021"
FT   CDS_pept        complement(17462..17932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0021"
FT                   /product="NusG antitermination factor"
FT                   /note="InterPro IPR008991:IPR006645:IPR005824; KEGG:
FT                   tpe:Tpen_0405 NusG antitermination factor; PFAM: KOW domain
FT                   protein; SMART: NGN domain protein; KOW domain protein;
FT                   SPTR: A1RX84 NusG antitermination factor; PFAM: Early
FT                   transcription elongation factor of RNA pol II, NGN section;
FT                   KOW motif; TIGRFAM: ribosomal protein L24p/L26e, archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49436"
FT                   /db_xref="GOA:E1QRR1"
FT                   /db_xref="InterPro:IPR005100"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011590"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRR1"
FT                   /protein_id="ADN49436.1"
FT                   /translation="MSSTEQAMSCRVYALRAVGNQEYNVAFMLKARTEHKGLDKVKVTA
FT                   IVVLPALKGFVFVEGSLPYEIQDLATGIKHYRGMVRGVMSVDEIVSSLAKPVEINVGDV
FT                   VEIIVEPFKGYRGKVVDIDRQRGQVYLELLDSSSTMPIIVNIRGVRKIESKQ"
FT   gene            complement(17991..18296)
FT                   /locus_tag="Vdis_0022"
FT   CDS_pept        complement(17991..18296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_0069 hypothetical protein; SPTR:
FT                   A8M9P2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49437"
FT                   /db_xref="GOA:E1QRR2"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRR2"
FT                   /protein_id="ADN49437.1"
FT                   /translation="MSSEDLGKRIMNWLSTLAWIFKVAKKPTKSNYMIILKLGSLIVAI
FT                   LGVYSFLFSVAQQYLTSSANFSLPYPLNLIVVLTIVIILTIMLILVILSTRGIGRR"
FT   sig_peptide     complement(18129..18296)
FT                   /locus_tag="Vdis_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(18345..19262)
FT                   /locus_tag="Vdis_0023"
FT   CDS_pept        complement(18345..19262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0023"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="COGs: COG0552 Signal recognition particle GTPase;
FT                   InterPro IPR000897:IPR013822:IPR004390:IPR003593; KEGG:
FT                   pcl:Pcal_1829 signal recognition particle-docking protein
FT                   FtsY; PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase; SPTR: A3MX79 Signal
FT                   recognition particle-docking protein FtsY; TIGRFAM: signal
FT                   recognition particle-docking protein FtsY; PFAM: SRP54-type
FT                   protein, GTPase domain; SRP54-type protein, helical bundle
FT                   domain; TIGRFAM: signal recognition particle-docking
FT                   protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49438"
FT                   /db_xref="GOA:E1QRR3"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRR3"
FT                   /protein_id="ADN49438.1"
FT                   /translation="MFDKLKNAFKSLTNTIVNSITTTELSEDKLNEIRDELFMQLVESD
FT                   VAVDVADAISNAIVNYLRGLKVPRFGDKESVIKNGIIDIMSKLFSDIPDVDFMSEVIRL
FT                   LQMKKPVVLLFLGPNGYGKTTTIAKITHQLMKRGYTAVWAAADTYRAGAIEQLEGHATK
FT                   LGVRVIKHGYGSDPAAVAYDAINHAKVRGIDYVMIDTAGRMHTDINLMNELSKIQRVSR
FT                   PDLSIFIADALLGNEALDIAKYYSKYVKIDGLIVTKVDAYPKGGAILTFLYELKKPIYF
FT                   LGVGQGYDDLRPFSKAEFFRQLIL"
FT   gene            complement(19274..19732)
FT                   /locus_tag="Vdis_0024"
FT   CDS_pept        complement(19274..19732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0024"
FT                   /product="prefoldin, alpha subunit"
FT                   /note="COGs: COG1730 prefoldin molecular chaperone
FT                   implicated in de novo protein folding; InterPro
FT                   IPR009053:IPR011599:IPR004127; KEGG: cma:Cmaq_0871
FT                   prefoldin, alpha subunit; PFAM: Prefoldin alpha domain
FT                   protein; SPTR: A8MD50 Prefoldin, alpha subunit; TIGRFAM:
FT                   prefoldin, alpha subunit; PFAM: Prefoldin subunit; TIGRFAM:
FT                   prefoldin, archaeal alpha subunit/eukaryotic subunit 5"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49439"
FT                   /db_xref="GOA:E1QRR4"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRR4"
FT                   /protein_id="ADN49439.1"
FT                   /translation="MSQQPQRIVITREDIERLIEERNSLAALLDVIRQNLALVTQSINE
FT                   LRSAKDMLTLLSKGVVQDTYAGIGGGVFIKASPVQGEKVLVSVGANFVIEMDISYAINY
FT                   IDERIKEFEDLRSKLDAQSADVAKRITDIDNFLLYISAAIRQQQQSRQ"
FT   gene            complement(19741..19989)
FT                   /locus_tag="Vdis_0025"
FT   CDS_pept        complement(19741..19989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0025"
FT                   /product="Ribosomal LX protein"
FT                   /note="COGs: COG2157 Ribosomal protein L20A (L18A);
FT                   InterPro IPR002768; KEGG: pai:PAE3098 ribosomal protein LX;
FT                   PFAM: Ribosomal LX protein; SPTR: Q8ZTU0 50S ribosomal
FT                   protein LX; PFAM: Ribosomal L18ae/LX protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49440"
FT                   /db_xref="GOA:E1QRR5"
FT                   /db_xref="InterPro:IPR002768"
FT                   /db_xref="InterPro:IPR023573"
FT                   /db_xref="InterPro:IPR028877"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRR5"
FT                   /protein_id="ADN49440.1"
FT                   /translation="MSVRIYRVTGRMRIGMQWQRFSLELLATKPSEAVEKAYSELGSRH
FT                   KLKRSMIRIEEVREISKDEVKRTEILQLLSMESLVKW"
FT   gene            20073..20609
FT                   /locus_tag="Vdis_0026"
FT   CDS_pept        20073..20609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0026"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="COGs: COG1813 transcription factor homolog of
FT                   eukaryotic MBF1; InterPro IPR001387:IPR010982; KEGG:
FT                   cma:Cmaq_0112 helix-turn-helix domain-containing protein;
FT                   PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; SPTR: A8MA34
FT                   Helix-turn-helix domain protein; PFAM: Helix-turn-helix;
FT                   TIGRFAM: conserved hypothetical protein TIGR00270"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49441"
FT                   /db_xref="GOA:E1QRR6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004451"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRR6"
FT                   /protein_id="ADN49441.1"
FT                   /translation="MVLTCDVCGALIEGEPVIVEIDGAVLTLCQRCARKYTNVKGVKVI
FT                   RGPSQVQATQQPVSVIKYESRRGVTYRVSKPRVNVDKYEVVENYAELIREARESLGMSR
FT                   DVLAKVIGVKESILRRIEDGQLIPDVELARKLEKALGISLLREAEDVGYETQKPVSKSL
FT                   TLGDVVTLRERSRNK"
FT   gene            20667..21794
FT                   /locus_tag="Vdis_0027"
FT   CDS_pept        20667..21794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0027"
FT                   /product="GTP-binding proten HflX"
FT                   /note="COGs: COG2262 GTPase; InterPro
FT                   IPR016496:IPR005225:IPR002917; KEGG: cma:Cmaq_0139
FT                   GTP-binding protein HSR1-related; PFAM: GTP-binding protein
FT                   HSR1-related; SPTR: A8MA57 GTP-binding protein
FT                   HSR1-related; TIGRFAM: GTP-binding proten HflX; small
FT                   GTP-binding protein; PFAM: GTPase of unknown function;
FT                   TIGRFAM: GTP-binding protein HflX; small GTP-binding
FT                   protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49442"
FT                   /db_xref="GOA:E1QRR7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRR7"
FT                   /protein_id="ADN49442.1"
FT                   /translation="MGNNRAKALLLVADDVGENRIREFQLLSEAGGYEVLDTIIQRRRP
FT                   DTRYYLGIGKLGEVESLVRSLGPDVVITYHQLNPIQYVNLERRLKVRVMDRILLILEIF
FT                   ERRAGSKEAKLQIELTRLRLEIPRVREFIRLAKMGEQIGFYGGGEYAIEAYYRYMMRRV
FT                   AHIRRELSAIKKRREMLVIKRRDYGLPQVALTGYTSAGKTTLFNRLARESKYVDGKPFA
FT                   TLDTYSRLVNFNGLNAILTDTIGFIDDLPPLLIESFYATIAEVLNADLVLFMMDISDDY
FT                   REFSRKFMSSLKIFNDLGISRTKILPVLNKVDLMDGIDINDKIGLVESEFGNYVLISAK
FT                   TGVGIDDLRDAVRSRLEPLVVNKRYGNSKNFNPIG"
FT   gene            21805..22344
FT                   /locus_tag="Vdis_0028"
FT   CDS_pept        21805..22344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0028"
FT                   /product="Transcription factor TFIIE, alpha subunit"
FT                   /note="COGs: COG1675 Transcription initiation factor IIE
FT                   alpha subunit; InterPro IPR017919:IPR002853:IPR011991;
FT                   KEGG: cma:Cmaq_1388 transcription factor TFIIE, alpha
FT                   subunit; PFAM: Transcription factor TFIIE, alpha subunit;
FT                   SMART: Transcription factor TFIIE, alpha subunit; SPTR:
FT                   A8M8Z5 Transcription factor E; PFAM: TFIIE alpha subunit;
FT                   TIGRFAM: conserved hypothetical protein TIGR00373"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49443"
FT                   /db_xref="GOA:E1QRR8"
FT                   /db_xref="InterPro:IPR002853"
FT                   /db_xref="InterPro:IPR016481"
FT                   /db_xref="InterPro:IPR017919"
FT                   /db_xref="InterPro:IPR024550"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRR8"
FT                   /protein_id="ADN49443.1"
FT                   /translation="MVEDLETSLFLEYARRKIAFEYDNEEMGELAVKILKTLSERNEAI
FT                   PDETLALILGISATEIRRILHVMHRAGLVGLVRESTDQYRYEYKWFINKDFIRKFLIQH
FT                   INNVVTKLMHRMNTLSRTTLYICPTCFRGYTLDEVYEYDFKCPRDDTELVQVDVPSEIT
FT                   FLANVIKNLRGEEKEQ"
FT   gene            complement(22386..23738)
FT                   /locus_tag="Vdis_0029"
FT   CDS_pept        complement(22386..23738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0029"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG0446 NAD(FAD)-dependent dehydrogenase;
FT                   InterPro IPR016156:IPR013027:IPR004099; KEGG: cma:Cmaq_1123
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation region;
FT                   SPTR: A8MDU5 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; PFAM: Pyridine nucleotide-disulphide
FT                   oxidoreductase; Pyridine nucleotide-disulphide
FT                   oxidoreductase, dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49444"
FT                   /db_xref="GOA:E1QRR9"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRR9"
FT                   /protein_id="ADN49444.1"
FT                   /translation="MGKRIVIIGGGAAGASAAARARRLDPEAEIVMLDKGLFISHAPCG
FT                   IPYYIGGVVKEAQELAIYTPEEFAKERRITVKVNAEVFDVDTKNQVVYAREGNETVKYQ
FT                   WDVLIIATGAKPITLPVEGHDLNGILTLRLPHEAPKLREEVEKASTVAVVGGGYIGLEV
FT                   AEALRNLGKRVLLFEMMPHVLPTTFDEDMAKLIHDELIKNGIELHLNEKVVGFRGVNGH
FT                   VNKVITEKGEYNVDKVVMGVGVRPDVDLAVKAGAKIGETGAVWVNEYMETSVPNVYAAG
FT                   DVAETWSLITGKRMYVALAPPANKMGQVAGANAVKGRFLKFPGVLGTAITKVFGLYVAR
FT                   TGLTEKQAREEGFKPVSATIKARTTAHYYPGGVQVNIKMIMDETSGRVLGVQIIGPDRI
FT                   VAGYIDVAAALIGKGATVDDFFFADLSYSPPTAPVWHPLITAARVLSKGKY"
FT   sig_peptide     complement(23676..23738)
FT                   /locus_tag="Vdis_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(23785..24723)
FT                   /locus_tag="Vdis_0030"
FT   CDS_pept        complement(23785..24723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q4Z5S6 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49445"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRS0"
FT                   /protein_id="ADN49445.1"
FT                   /translation="MLTNLSWNYVGRLHNDFLNNLKSINALTLLLNRQRIKLRMALSTL
FT                   GLILNLIGSVNPNFMPNGDEYAVIIKDTIESLMKDYDVNKYVTIESMRRGNDRAYVITI
FT                   RASSSLIVRLMIVCGNECEYYIDDRVNRARINANVYFQLVMKALMIMNRVFNIDTPKTL
FT                   LTHNPTIYGKVLTINRNEVIALSIWDILRLTDVISKEDLTVSDISNIVDTAVHEFLHYI
FT                   LDRKYLVTSTFMRMAKRIPSVIDDGVIHELIAWTLTPHVSKYVAECIKYGSADTVSNTE
FT                   LAIQYPIKRRHALTARKIINELLTRLNGECS"
FT   gene            24842..26374
FT                   /locus_tag="Vdis_0031"
FT   CDS_pept        24842..26374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0031"
FT                   /product="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="COGs: COG0405 Gamma-glutamyltransferase; InterPro
FT                   IPR000101; KEGG: cma:Cmaq_1271 gamma-glutamyltransferase;
FT                   PFAM: gamma-glutamyltranspeptidase; PRIAM:
FT                   Gamma-glutamyltransferase; SPTR: A8ME92
FT                   Gamma-glutamyltransferase; PFAM:
FT                   Gamma-glutamyltranspeptidase; TIGRFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49446"
FT                   /db_xref="GOA:E1QRS1"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRS1"
FT                   /protein_id="ADN49446.1"
FT                   /translation="MPLPIIGGVKPPWITELGGVASEHPVASRLGVDVLNLGGNAIDAA
FT                   VTTSLALALTQPHLGGLGGDFFAMIYIAREGRVYFLNASGWAPRRLSRELLLQRGLNAV
FT                   PLRGPLSPVVPGLLAGLHAMWRRFGTDEWRSLVRPVVEVARKGFPVSPSFVKAIELLRN
FT                   EIAGNNDFKSVYPINTKPWDVIRIEPLTKTFELVMEHGPDILYRGEVGEALVNHLQSVG
FT                   GVMEMSDLMEYEPEWRDPLSIDYKGLTIYESPPNTQGITTLMILRLLEELRVSVDAWSR
FT                   GRIETYLGIYKIAYELRDLYVGDPRFVEVPINKLLDPGFLTSAYKSGIGKQLSGSGDTT
FT                   YFVVVDKEGNIVSAIQSLYQHFGSLVTEPRYGITLNDRASDFSMDGPNALMPRKRPLHT
FT                   LSTIIITKDGEPKYALGTSGAHFRPQQHTLFITNMVDYGLSPVEAIDAPRFLWDRKSLI
FT                   IEEGYEVTGLTELHQVIRYPGRTGVASIAAFLDNGRKLLYADIRGDGLALGQ"
FT   gene            26447..27529
FT                   /locus_tag="Vdis_0032"
FT   CDS_pept        26447..27529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0032"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR002491; KEGG:
FT                   cma:Cmaq_1155 periplasmic binding protein; PFAM:
FT                   periplasmic binding protein; SPTR: A8MDX6 Periplasmic
FT                   binding protein; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49447"
FT                   /db_xref="GOA:E1QRS2"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRS2"
FT                   /protein_id="ADN49447.1"
FT                   /translation="MSRGISKALIVGIVVIIAVIIIALYYVLQPHVLRQGMPNAGVNYP
FT                   ITVVDYLGRNITIYSQPSTIGTISPDCTQIIYALGFGNRVVLIDVYSEQLLNYLNITVP
FT                   SNATTISSIYESPPIEPIITAHPSLLCADAGFQPQLVQSVSTLSAANITVIFIGGTDNT
FT                   NVTGIENDIMLMAKALGVPGKGEEVVSHMNNVINYVKSKVSGESRVTVAYISWYNPIYV
FT                   AGNSSFVGYYINLAGGYDPFSGMYPTVSPSQLLAVNPDYIIADDFMGNYTATLQAILSI
FT                   PGINNTNAVREGHIYVLGNFAESLIEEPGPLSVYGALLLAVILHPSAFGLNSTAIPHYI
FT                   SAQWVDQYIKPNLNITLSNG"
FT   gene            27529..28527
FT                   /locus_tag="Vdis_0033"
FT   CDS_pept        27529..28527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0033"
FT                   /product="transport system permease protein"
FT                   /note="COGs: COG4139 ABC-type cobalamin transport system
FT                   permease component; InterPro IPR000522; KEGG: cma:Cmaq_1156
FT                   transport system permease protein; PFAM: transport system
FT                   permease protein; SPTR: A8MDX7 Transport system permease
FT                   protein; PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49448"
FT                   /db_xref="GOA:E1QRS3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRS3"
FT                   /protein_id="ADN49448.1"
FT                   /translation="MATISNPTIKFIWAFIPLLLIGIVLNLIIGEVTIPLKALIDPTNT
FT                   YRIIIMDIRLPEVLACIVVGIDLTVAGAVMQAVFRNPLAEPYVTGTASGALLGALLGLL
FT                   AYALFKANLPSPIIVIPVLSFLGALLATTIVVTFGRGYWLSLILAGIAVSIMFSSIVMI
FT                   LDTYLLTLIPTLPAVIYLLFGTVSGVNWSEDVVMLGVSLPILAYIVMSGREINLLMISD
FT                   EIAQASGVSPRAFRNLLITLVGLLTAVTVSFTGIIGFVGLMTPHLTRLLISSSDNSRVI
FT                   PLSMISGSTIMLYANVVSKVMIPGVIMPITAITSLFGVPVLLILLRGGRNE"
FT   gene            28520..29275
FT                   /locus_tag="Vdis_0034"
FT   CDS_pept        28520..29275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0034"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems ATPase components; InterPro
FT                   IPR003439:IPR003593; KEGG: cma:Cmaq_1157 ABC transporter
FT                   related; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: A8MDX8 ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49449"
FT                   /db_xref="GOA:E1QRS4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRS4"
FT                   /protein_id="ADN49449.1"
FT                   /translation="MSSFIVRFVNAEIGYDSPIIKDIVLNIPRPSLTTLLGPNGSGKTT
FT                   LLRAMIKYAKVFGGYVYIDDRDINELSIKDLPKYVSYSPAEIYSQMGLTVLDVVMSSRN
FT                   GDGWVGKDDAFMVLKRLGIDNIANRRFDELSTGQKRLVLIARALASKAPLILMDEPTTN
FT                   LDLSNKYRVIAVLRRIVNEGITVIAAGHDIDLALASDWVVAIRNGEILAVGSPEEVISD
FT                   GILSELYGINVRVVSVDGHKLVYVSDGHV"
FT   gene            29363..31201
FT                   /locus_tag="Vdis_0035"
FT   CDS_pept        29363..31201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0035"
FT                   /product="tungsten-dependent formaldehyde:ferredoxin
FT                   oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="COGs: COG2414 Aldehyde:ferredoxin oxidoreductase;
FT                   InterPro IPR001203:IPR013983:IPR013985; KEGG: cma:Cmaq_0005
FT                   aldehyde ferredoxin oxidoreductase; PFAM: aldehyde
FT                   ferredoxin oxidoreductase; Aldehyde ferredoxin
FT                   oxidoreductase; PRIAM: Aldehyde ferredoxin oxidoreductase;
FT                   SMART: Aldehyde ferredoxin oxidoreductase; SPTR: A8M9H8
FT                   Aldehyde ferredoxin oxidoreductase; PFAM: Aldehyde
FT                   ferredoxin oxidoreductase, N-terminal domain; Aldehyde
FT                   ferredoxin oxidoreductase, domains 2 & 3"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49450"
FT                   /db_xref="GOA:E1QRS5"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRS5"
FT                   /protein_id="ADN49450.1"
FT                   /translation="MFGWGGRILRIDLSRKKFIVQQLDPSLAQNYIGGRGFAVKTLWDE
FT                   LPPGIDPLSPLNKLILAVGPLTALPIPNSGKLLVAAKSPLTSGYGDGNVGTWLAVHMRK
FT                   AGLDMIIIEGKAERPTYLYIENRGDEFRVDFNSAEDLWGLDTFTTEDKLKRVHGSDVGM
FT                   VLIGPAGERLVRFATIVAQKGRSGGRPGMGAVMGSKNLKAVVMRGHGDIKVADPVLRKI
FT                   GVDAIVATKSKPNYPFWMRQGTTSTVEWAQEASVLPTYNYTEGQFDEYEKIGGFSVERS
FT                   KVMTRSCPQCVMACGHVVKDAEGELAELDYENIAMLGSNLGIGDLAKVAHLNRIADMMG
FT                   MDTISLGSTLGFAMEASEKGLLKERIEWGDYKRAAEVAMDIALQRTKLGRLLGRGVRAA
FT                   SMELGPEATEFAMHVKGLEVSAYDCHAAPGMALAFSTSPIGAHHKDAWLISWEVQRGRF
FT                   DYTREKVEKLIEMQDIRGGLFETIVTCRFPWVEVGLELDWYFRLFKAATGMDMNMEILS
FT                   TINNRIYTLIRAFWIREYGHWDRAYDTPPAKWFKRPLSKGPLKGAKLDHDGYQRMLSWY
FT                   YELRGWDERGIPRKDTLRRLGLEFVIPQLETKVNLN"
FT   gene            31258..31866
FT                   /locus_tag="Vdis_0036"
FT   CDS_pept        31258..31866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_0633 hypothetical protein; SPTR:
FT                   A8MCG7 Putative uncharacterized protein; PFAM: Cobalamin
FT                   adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49451"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRS6"
FT                   /protein_id="ADN49451.1"
FT                   /translation="MSNECRLPLFVDCKEVDDSIKCPGDSGYSVIPLFGKRVRVRKDSA
FT                   PIKLMGCLDELTNIANNARLNFNDNAVSRIAAIVMALSMQLNAYLVQGSDDRLTRVKNV
FT                   EDLLMAKVAELCRGFKGPLGWIIATTPELQALDTMRVKLRECGRIAASMLDDYPLSSNI
FT                   IGVMNHADKLVAQAMYCMGGRVFKSVDDAVNYLLSNATG"
FT   gene            31906..33576
FT                   /locus_tag="Vdis_0037"
FT   CDS_pept        31906..33576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0037"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="COGs: COG1884 Methylmalonyl-CoA mutase N-terminal
FT                   domain/subunit; InterPro
FT                   IPR016176:IPR006098:IPR014348:IPR006099; KEGG: sto:ST0552
FT                   coenzyme B12-dependent isobutyryl-CoA mutase; PFAM:
FT                   methylmalonyl-CoA mutase; PRIAM: Methylmalonyl-CoA mutase;
FT                   SPTR: Q974V8 562aa long hypothetical coenzyme B12-dependent
FT                   isobutyryl-CoA mutase; TIGRFAM: methylmalonyl-CoA mutase,
FT                   large subunit; PFAM: Methylmalonyl-CoA mutase; TIGRFAM:
FT                   methylmalonyl-CoA mutase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49452"
FT                   /db_xref="GOA:E1QRS7"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRS7"
FT                   /protein_id="ADN49452.1"
FT                   /translation="MESTDKIKEKYDEWVREFLLPTLRKLPEWRKFVTSFGVDVKPLYT
FT                   PLDIKGEYLDKLGFPGEYPFTRGIYPSMYRSRLWTFREYSGFGSPEDTNRRYKFLISQG
FT                   QTGLSVAFDLPTQLGLDPDHELAYPEVGKVGVSVPEVVSMSILFDGIDIGKITTSFTIN
FT                   ATAAEILSMYITVAESRGIDKAVLDGTIQNDILKEFIARNLYIYPPLHSMRYATDIIAY
FT                   TSKNLPKWHPISISGYHFREAGATAVQELAFTLADAIEYTNWVINRWKMNVDDFAPGLS
FT                   FFFAATTNLFEEVAKFRAARRLYARIMKERFGVKKPESMRMKFHVQTSGAALTAQQPEV
FT                   NIIRTTIQALAAVLGGAQSLHVNAYDEALALPTEKSVKLALRVQQVIAYESGVVDSIDP
FT                   LGGSYYIEWLTDTIEEEVMKIIDYIDRLGGMTKAVEIGYPQRAIAESAYQYQRMVEEGK
FT                   IAVIGVNMFREEEELHIELHRVDPVSRERSIKRVREVRESRDKEAWERALNELRRVADR
FT                   EDENVFPYILNAVKAKATVGEISGVLRDVWGEYKPPSIY"
FT   gene            33619..34014
FT                   /locus_tag="Vdis_0038"
FT   CDS_pept        33619..34014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0038"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="COGs: COG2185 Methylmalonyl-CoA mutase C-terminal
FT                   domain/subunit (cobalamin-binding); InterPro
FT                   IPR006158:IPR006159; KEGG: tga:TGAM_1931 methylmalonyl-CoA
FT                   mutase, C-terminal domain/subunit (cobalamin-binding)
FT                   (MutB); PFAM: cobalamin B12-binding domain protein; SPTR:
FT                   C5A214 Methylmalonyl-CoA mutase, C-terminal domain/subunit
FT                   (Cobalamin-binding) (MutB); PFAM: B12 binding domain;
FT                   TIGRFAM: methylmalonyl-CoA mutase C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49453"
FT                   /db_xref="GOA:E1QRS8"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRS8"
FT                   /protein_id="ADN49453.1"
FT                   /translation="MPKPKIIIAKLGLDGHDRGAKVVARALAEAGFEVVYTGIRQTPSQ
FT                   VVETAIQEDAKLIGISILSGSHMELVGELMRIMKERGLNIPVLVGGIIPPEDRDALLKM
FT                   GVAGVYGPGTPLREIIEIVKKLVGAQQ"
FT   gene            34011..35312
FT                   /locus_tag="Vdis_0039"
FT   CDS_pept        34011..35312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0039"
FT                   /product="LAO/AO transport system ATPase"
FT                   /note="COGs: COG1703 Putative periplasmic protein kinase
FT                   ArgK and related GTPase of G3E family; InterPro
FT                   IPR005129:IPR017515:IPR003593:IPR004360; KEGG:
FT                   sus:Acid_7059 LAO/AO transport system ATPase; PFAM: ArgK
FT                   protein; Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; SMART: AAA ATPase; SPTR: Q8R7L6
FT                   Putative periplasmic protein kinase ArgK and related
FT                   GTPases of G3E family; TIGRFAM: LAO/AO transport system
FT                   ATPase; methylmalonyl-CoA epimerase; PFAM: ArgK protein;
FT                   Glyoxalase/Bleomycin resistance protein/Dioxygenase
FT                   superfamily; TIGRFAM: methylmalonyl-CoA epimerase; LAO/AO
FT                   transport system ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49454"
FT                   /db_xref="GOA:E1QRS9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRS9"
FT                   /protein_id="ADN49454.1"
FT                   /translation="MSINELLERARNWDKAAIARLITLAEEGVEIPLNIQRRSHVIGIT
FT                   GPPGSGKSTLIYTMARRIPQDKRVAILTIDPSSPFTGGSFMGNRIRMQELTSRPNIYIR
FT                   SMATRGIRGGLNYATIAAVNILEYASADYIFIETVGAGQSDTDVKYVADTILVLVPPLS
FT                   GDEIQALKSGLMEIGDIYVVSKSDNQASESTYRDLLAMVDMMREVKGDSWKPAVIKVSG
FT                   LYGYGVDELLKLIDDRFRVLVGNGKLNESLTSRRLLEMRLYAYDILEKRLNESKELENE
FT                   VVNGKLSPQEAARRLLGMEMPRLDHVAVAVKDLNSAVEKFRKLGLRVSDPIIVEEQGVK
FT                   VVMVWLGNTRIELLETLNPGSTVAKFLESRGEGIHHIALEVNDLEEFIKRVQEAGLVLT
FT                   GKPSRGAEGIVTFIHPKSLNGVLLELVQREASNE"
FT   gene            35347..37128
FT                   /locus_tag="Vdis_0040"
FT   CDS_pept        35347..37128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0040"
FT                   /product="Protein of unknown function DUF2070, membrane"
FT                   /note="COGs: COG3356 membrane protein; InterPro IPR019204;
FT                   KEGG: cma:Cmaq_0450 membrane protein-like protein; PFAM:
FT                   Protein of unknown function DUF2070, membrane; SPTR: A8MBV2
FT                   Membrane protein-like protein; PFAM: Predicted membrane
FT                   protein (DUF2070)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49455"
FT                   /db_xref="GOA:E1QRT0"
FT                   /db_xref="InterPro:IPR019204"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRT0"
FT                   /protein_id="ADN49455.1"
FT                   /translation="MKKSRSFERGYTIVFRGGDSIKYSLILLIIVIPYLMSLYVRETII
FT                   VYLKSLVIYGVMFLSVLITLRAMVFIQSYRGFGTTLSLFSTALAVIIDLLITLVTHKFV
FT                   VGFGALSFVLPLSAMIMVLRGLEHNGNSMKKYILYPLYTLPSILLIQLISYFLIGTISP
FT                   MKYVILDLTFYVFSFLFIYYVIFKFEASYGGVDILRLFSSYLYTALFEYSEPFERELSK
FT                   RSVIRDVKVHLFMLNNNNNTYPVTIPELHAGPIAKVGGGYLISDLVSELSRYVNPVVYM
FT                   HGVGSHELDPATRVDVRRVVRAVANKVREYLNGQYVSNECAGKMPIQVQSRNFRITHIP
FT                   LCEKSIIIISRLVKSSDDIPLNVYEELKKRVKLDWDNVILVDAQNYYSDDNTWDENDIN
FT                   ELASLLSKIGELEDQRLEIKSCVSHVPKYAFGPIQFEIGDNGLITWGLDINGKKVLLVI
FT                   FDGNNLRRELADAIINEFRNGFDIVEVLTTDNHQYTGIARFTRSRGYKIVGDSISHELI
FT                   MRNVRRSVKRCLNNLAMTRVRYYPVIVEGIRLIGDSFNNMVRAAERGVMDWKKHFIVLI
FT                   VLPILTMIILGVVLGIL"
FT   gene            37187..37654
FT                   /locus_tag="Vdis_0041"
FT   CDS_pept        37187..37654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4755 conserved hypothetical protein;
FT                   InterPro IPR014450; KEGG: cma:Cmaq_0344 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR: A8MBA0
FT                   Putative uncharacterized protein; PFAM: Uncharacterized
FT                   protein conserved in archaea (DUF2153)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49456"
FT                   /db_xref="InterPro:IPR014450"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRT1"
FT                   /protein_id="ADN49456.1"
FT                   /translation="MGSEDLKRQAIRAHIAGLITRLENWVKDQKRFMDELQKYGDYIVT
FT                   QDRLSLLLSAQAMLYYIERTLKDFESWLNNPMITSIMPIDMLKELEERLRDIAIEFVKL
FT                   DIDHTSRYVDILRKMENENEIPDILRLYIEQRGIVPQRGQQGEQGEVPRFM"
FT   gene            complement(37673..38041)
FT                   /locus_tag="Vdis_0042"
FT   CDS_pept        complement(37673..38041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0042"
FT                   /product="transcriptional repressor, CopY family"
FT                   /note="InterPro IPR011991:IPR005650; KEGG: npu:Npun_F4543
FT                   CopY family transcriptional regulator; PFAM: Penicillinase
FT                   repressor; SPTR: B2IVU2 Transcriptional repressor, CopY
FT                   family; PFAM: Penicillinase repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49457"
FT                   /db_xref="GOA:E1QRT2"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRT2"
FT                   /protein_id="ADN49457.1"
FT                   /translation="MEQSERRRRLLLMIGPLEAEVIGILNELKEATAMTIWEELTKRGR
FT                   KTAYTTVLTVLSRLYTRGFINKREKVINNVRQFVYELSIPYEVKSEIIREHIGLIIKMF
FT                   GKDAIQIIKDYLNEISEK"
FT   gene            complement(38086..38931)
FT                   /locus_tag="Vdis_0043"
FT   CDS_pept        complement(38086..38931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0043"
FT                   /product="protein of unknown function Met10"
FT                   /note="COGs: COG2520 methyltransferase; InterPro IPR003402;
FT                   KEGG: pcl:Pcal_2080 methyltransferase; PFAM: protein of
FT                   unknown function Met10; SPTR: A3MXX8 Methyltransferase;
FT                   PFAM: Met-10+ like-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49458"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRT3"
FT                   /protein_id="ADN49458.1"
FT                   /translation="MPTLKDVVKPLIPRELWDKVPRSFDIVGSRSGAIAIIEIPPELEG
FT                   YKFVIGEAITKLNKHVKTVLRRIGAREGEFRLYRYEVLVPGPTEVIHREGNYLIKVDPT
FT                   KAYFSPRDQGDREDIAKQVMPNEVILYPFAGVGPYAIAILKRQPLVKLVIAIELNEYAY
FT                   YYMLDNIKLNKLEGKVLPLLGDAARLMGLFCGVDRIILTLPLGAHKFLRQSLMCVRDGG
FT                   IVHFYHLGAEENPYGEAEGLVKSYCDELGYECQVVNRRVVRDYAPYVYKVRLDIKVGKL
FT                   "
FT   gene            39028..40458
FT                   /locus_tag="Vdis_0044"
FT   CDS_pept        39028..40458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0044"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="COGs: COG1156 H+-ATPase subunit B; InterPro
FT                   IPR004100:IPR000194:IPR000793; KEGG: cma:Cmaq_0342 V-type
FT                   ATP synthase subunit B; PFAM: H+transporting two-sector
FT                   ATPase alpha/beta subunit central region; H+transporting
FT                   two-sector ATPase alpha/beta subunit domain protein; PRIAM:
FT                   H(+)-transporting two-sector ATPase; SPTR: A8MB98
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; PFAM: ATP synthase alpha/beta family, beta-barrel
FT                   domain; ATP synthase alpha/beta chain, C terminal domain;
FT                   ATP synthase alpha/beta family, nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49459"
FT                   /db_xref="GOA:E1QRT4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRT4"
FT                   /protein_id="ADN49459.1"
FT                   /translation="MSKIIESMPGIVSYSTVREVKGPLIVIEKTRGVAYNEIGEVVGPD
FT                   GEPRMVQVVEVGDNYAVAQVLTGTLGLPAKGSTVRFYGRTLRLPVSEDLLGRVLDGKGQ
FT                   PRDGLPLPPAEEYLDINGEPLNPYAREYPEEPIETGVSVIDGLNTMVRGQKLPIFSGTG
FT                   LPHNMLAAQVARQATVRGHEEEFAIIFAAMGLKSEEALFFLNEFRRTGALRRLVMVLNL
FT                   ASDPIAERILTPRTALTIAEYLAWYRDYHVLVILTDMTNYAEALRELSSSKGELPGRRG
FT                   YPGYMYTDFATIYERTGRAKGKKGSITQFPILTMPHDDITHPIPDLTGYITEGQLVLSR
FT                   TLWGKGIYPPFDVIMSLSRLMKDAVGEGKTRDDHKYVANQLIAAYSRALDVRNLALLVG
FT                   ETNLSWRERRYLRFAEQFERRFINQGYYERRTFEQTLDIAWDVISILPEDELTNVPPDI
FT                   SKRYYRRSIFESIKDVGA"
FT   gene            40558..40770
FT                   /locus_tag="Vdis_0045"
FT   CDS_pept        40558..40770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0045"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /note="InterPro IPR010985:IPR002145; KEGG: cma:Cmaq_1956
FT                   CopG family transcriptional regulator; PFAM: CopG domain
FT                   protein DNA-binding domain protein; SPTR: A8MBN9 Putative
FT                   transcriptional regulator, CopG family; PFAM:
FT                   Ribbon-helix-helix protein, copG family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49460"
FT                   /db_xref="GOA:E1QRT5"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRT5"
FT                   /protein_id="ADN49460.1"
FT                   /translation="MPKTKAKEKMVLISVHIPKQMLEELDEFVKQGIFPSRSEAIRIAI
FT                   RDLLYRENSRSKTQNVEDLILLPGR"
FT   gene            40922..41497
FT                   /locus_tag="Vdis_0046"
FT   CDS_pept        40922..41497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0046"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="COGs: COG0163 3-polyprenyl-4-hydroxybenzoate
FT                   decarboxylase; InterPro IPR003382:IPR004507; KEGG:
FT                   cma:Cmaq_0743 3-octaprenyl-4-hydroxybenzoate carboxy-lyase;
FT                   PFAM: flavoprotein; SPTR: A8MCS3
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase; TIGRFAM:
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase; PFAM:
FT                   Flavoprotein; TIGRFAM: polyprenyl P-hydroxybenzoate and
FT                   phenylacrylic acid decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49461"
FT                   /db_xref="GOA:E1QRT6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRT6"
FT                   /protein_id="ADN49461.1"
FT                   /translation="MRRIIVGITGASGVIYGVRFLEMVKKYATDSEVHLVISNTAISIL
FT                   KYEVGLDRESVLKFADKVYGENELSAPIASGSFKHDGMVIIPCSMKTLAAIAHGITDNL
FT                   ITRAADVTLKERRRLILVIRETPLNLIHIRNMELVTLAGAIVMPAAPAFYNKPRTIDDM
FT                   VNFIVGRVLDLLGIENDLYRRWTGYSEG"
FT   gene            41545..42561
FT                   /locus_tag="Vdis_0047"
FT   CDS_pept        41545..42561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0047"
FT                   /product="PP-loop domain protein"
FT                   /note="COGs: COG0037 ATPase of the PP-loop superfamily
FT                   protein implicated in cell cycle control; InterPro
FT                   IPR000541:IPR012089:IPR014729:IPR011063; KEGG:
FT                   cma:Cmaq_1255 PP-loop domain-containing protein; PFAM:
FT                   PP-loop domain protein; SPTR: A8ME76 PP-loop domain
FT                   protein; PFAM: PP-loop family; TIGRFAM: conserved
FT                   hypothetical protein TIGR00269"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49462"
FT                   /db_xref="GOA:E1QRT7"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRT7"
FT                   /protein_id="ADN49462.1"
FT                   /translation="MDVPMCTRCGRRPANYYRVSSGEKLCLNCLFRSIEDTVLRTIRKY
FT                   RLISDDDRIGIAISGGKDSLTLMYLLGKFRRQGKIPRNVELIAFSINEGHPYSCFYRMA
FT                   RVDYVQKLSEEFNIPYRVYTFKELFGVTATDIAHGLWSKGINVHMCTIDGVLRRRAMNI
FT                   IGRQLGLTKIATGHNLDDESQTVLLNVLSNDLDRFAWFGPRPEIDREGFIPRIKPLRFV
FT                   REEEIALYAYYHGIPLMELECPFVYSNPRYELKFTLAHWERDNPNVKFSLVSFGDSLAN
FT                   LMGEKAVNVPLKRCKYCGEPTSGDVCRVCELMSRAGLLERYLNHLRTLKLMDTQSPS"
FT   gene            complement(42516..43205)
FT                   /locus_tag="Vdis_0048"
FT   CDS_pept        complement(42516..43205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0048"
FT                   /product="ACT domain-containing protein"
FT                   /note="InterPro IPR002912; KEGG: cma:Cmaq_1250 ACT
FT                   domain-containing protein; PFAM: amino acid-binding ACT
FT                   domain protein; SPTR: A8ME71 ACT domain-containing protein;
FT                   PFAM: ACT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49463"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRT8"
FT                   /protein_id="ADN49463.1"
FT                   /translation="MEVLYRDFAMSFEGKDKVLGEFLIKFTADRPGILAALSNVFADHG
FT                   INILNISVNRTQLLLHFVVDLTNTDTSLNDLEKELKRFSFVEWVKYRIVEKEAFMVPSM
FT                   IMPTFRDKQVLVIELERTKDLLTNPEFRRIIRELGTYDASLLRNSNLSELIKMGQFRGL
FT                   GKVVLTERDGTITIRSCSELNDKHVMEELMIEYYTGFLSQILKSNVEAVGRSYEGDCVS
FT                   ISFKVLK"
FT   gene            43354..45786
FT                   /locus_tag="Vdis_0049"
FT   CDS_pept        43354..45786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0049"
FT                   /product="aminoacyl-tRNA synthetase class Ia"
FT                   /note="COGs: COG0525 Valyl-tRNA synthetase;
FT                   InterProIPR001412:IPR009008:IPR009080:IPR019754:IPR
FT                   014729:IPR002300:IPR013155; KEGG: cma:Cmaq_0166 valyl-tRNA
FT                   synthetase; PFAM: aminoacyl-tRNA synthetase class Ia; tRNA
FT                   synthetase valyl/leucyl anticodon-binding; SPTR: A8MA83
FT                   Aminoacyl-tRNA synthetase class Ia; manually curated; PFAM:
FT                   tRNA synthetases class I (I, L, M and V); Anticodon-binding
FT                   domain; TIGRFAM: valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49464"
FT                   /db_xref="GOA:E1QRT9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRT9"
FT                   /protein_id="ADN49464.1"
FT                   /translation="MEFKPRLQEKRWDISKEVELIRKWEEEGLFDVNIDEKRPTIVIDT
FT                   PPPYPSGRPHIGGIAHYAQIDMIARFFRMRGYNVIFPFYADRNGLPVEVQVEKTYGINM
FT                   YEVPREKFLELCRKFLDEYEGEFVSIFRRWGGSFSYWRNGTDSEEYRRVTQETFINLWN
FT                   RGLIYEASRPTLWCPRCRTALAEAEVEYREEDSYLNYIKFRVKETGEDIIIATTRPELL
FT                   PATVAVAFNPGDNRYKRLEGLHAIVPPLNQEVPIVSHPSVKPDFGTGLEMISTFGDTRD
FT                   LMVVNELKLPMKIIVNPDGTLNELAGKYKGLNVREVREVIIKDLQEAGLLVKREPLRHT
FT                   IPICWRCKTPIEIIVTREYFLKQLQFKDELIKLVQNEMIIKPPEYAQTLIDWIRSLEFD
FT                   WPISRRRYYGTEIPIWYCIDEEGNAKPIVPKPGKYYRPWKDEPPPEVKEQCPSGKLVGE
FT                   DRVLDTWFDSSISWIYATGYTKPNIRVFEKVYPHSILRPQGYDIIRTWLYYSVVRAYLL
FT                   YGKPPFKYVRISGMGLDEKGEAMHKSKGNIIDPIPPVEKYGADAARFWAAASAKLGSDY
FT                   RYSEQLIRTGHDFAVKLWNIARFVSSFPEVNDNYELTPLDLMILAKLNEVVRASLNAYN
FT                   EFDVYVPINTLYDFTWHVFADHYLEAVKSRAYNRDGLFTEKQQRGAWFTLYKVLKTVLK
FT                   LLAPIMPFVTDQIWRSLYGESIHRQLIEDPDPRFDNKEYLNMLEPFMEFNRAIWTYKNK
FT                   SGLSLNEPIDGVIYAPEVLKPLELELKAMHKIREIRFGKPVGNYEVLSESPPVYLVK"
FT   gene            complement(45779..46900)
FT                   /locus_tag="Vdis_0050"
FT   CDS_pept        complement(45779..46900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0050"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR016196:IPR011701; KEGG: tac:Ta1406m
FT                   major facilitator superfamily permease; PFAM: major
FT                   facilitator superfamily MFS_1; SPTR: Q978M5 Putative
FT                   uncharacterized protein TVG1435680; PFAM: Major Facilitator
FT                   Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49465"
FT                   /db_xref="GOA:E1QRU0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRU0"
FT                   /protein_id="ADN49465.1"
FT                   /translation="MERGLTIVLIASLAFFSVVLVRFSIPSLLPYLIGLNGINTVMGGL
FT                   IISALWVGYTIFQVIGGLIVDKYGYNVVIYVLILISIINVLYPIIINQYYLLLIVQFIM
FT                   GSLLAIAYVALISMVLSNYSRGGLGAGIYQSMFFLASSVSIMISPLLFSINRFIPFIAY
FT                   SIIVISSIIPVAKVPRRGRVGGTIYIGPGNLRILGMGFIRLSSGFSYLGFLSWSTYYVV
FT                   HVLKVSPSFSGFYAFLASIMGSVGAVIGGYLGDRVGYALPSILSSLLLAIIVSVIPRLS
FT                   ILYLLAFLMLLLGFFYGFYAAPSIAISRLTTNIGATSGFLNFMSQLGGSISPYVIGFLL
FT                   QYYDFPETLLIIGIASAALVIIGATLLFYKRIT"
FT   gene            46957..47235
FT                   /locus_tag="Vdis_0051"
FT   CDS_pept        46957..47235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0051"
FT                   /product="translation elongation factor aEF-1 beta"
FT                   /note="COGs: COG2092 Translation elongation factor
FT                   EF-1beta; InterPro IPR014038:IPR004542:IPR014717; KEGG:
FT                   cma:Cmaq_0542 translation elongation factor EF1B, beta and
FT                   delta chains, guanine nucleotide exchange; PFAM:
FT                   Translation elongation factor EF1B, beta and delta chains,
FT                   guanine nucleotide exchange; SPTR: A8MC80 Elongation factor
FT                   1-beta; TIGRFAM: translation elongation factor aEF-1 beta;
FT                   PFAM: EF-1 guanine nucleotide exchange domain; TIGRFAM:
FT                   translation elongation factor aEF-1 beta"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49466"
FT                   /db_xref="GOA:E1QRU1"
FT                   /db_xref="InterPro:IPR004542"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR036219"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRU1"
FT                   /protein_id="ADN49466.1"
FT                   /translation="MAEVYLVYRVTPSKSDVNYEELKNEIKKALEPKYKVDKVEEEDIG
FT                   FGIKALRVYIRMPEESEEHSSDEVENILSGIEGIGSIELEYFTRLGF"
FT   gene            47316..49529
FT                   /locus_tag="Vdis_0052"
FT   CDS_pept        47316..49529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0052"
FT                   /product="AAA family ATPase, CDC48 subfamily"
FT                   /EC_number="3.6.4.3"
FT                   /note="COGs: COG0464 ATPase of the AAA+ class;
FT                   InterProIPR003960:IPR009010:IPR005938:IPR003593:IPR
FT                   003338:IPR004201:IPR003959; KEGG: cma:Cmaq_0541 AAA family
FT                   ATPase, CDC48 subfamily protein; PFAM: AAA ATPase central
FT                   domain protein; AAA ATPase VAT domain protein; cell
FT                   division protein 48 CDC48 domain 2; PRIAM:
FT                   Microtubule-severing ATPase; SMART: AAA ATPase; SPTR:
FT                   A8MC79 AAA family ATPase, CDC48 subfamily; TIGRFAM: AAA
FT                   family ATPase, CDC48 subfamily; PFAM: Cell division protein
FT                   48 (CDC48), N-terminal domain; ATPase family associated
FT                   with various cellular activities (AAA); Cell division
FT                   protein 48 (CDC48), domain 2; TIGRFAM: AAA family ATPase,
FT                   CDC48 subfamily; 26S proteasome subunit P45 family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49467"
FT                   /db_xref="GOA:E1QRU2"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRU2"
FT                   /protein_id="ADN49467.1"
FT                   /translation="MMEGSHADEWIELIVKEAKQRDAQRPIVRVDPEVMRNYGIEPGMI
FT                   LLIEGKRRTAAKVWYGLPEDEGKGIIRMNAIIRKNANVEIDQKVRVKKVEAKRANTIKL
FT                   APVNMTISVDQNFVQYTKQKLRDYVLMEGDLVQIQVLGQPLTFQVVQAKPNDAPVIIDE
FT                   DTNLMIYEKPVENVNIPRVTWEDIGDLKEAKEKIRELVELPLKHPEIFEYLGIEPPKGV
FT                   LLIGPPGTGKTLLAKAVATETNAYFIAINGPEIVSKYYGESEAKLREIFEEAKKNAPAI
FT                   IFIDEIDAIAPKREEVTGEVEKRIVAQLLTLMDGLQERGQVIVIGATNRPEAVDPALRR
FT                   PGRFDREIWINPPDTEGRYEILQVHTRNMPLAKDVDLRKLAEITYGYTGADIAALAREA
FT                   AMRALRKALQSGILDVNKEDEEIRKDLEKIKVTMNDFLEAMREIVPSALREIHIEIPKV
FT                   RWSDIGGLEEVKQELREAIEWPLKYPERFRKMGIKPPKGILLFGPPGTGKTLLAKAVAT
FT                   ESNANFIAVRGPEILSKWFGESERAIREIFKKARMAAPCVIFFDEIDAIAPARGYAEDS
FT                   PAMDRIVAQLLAEMDGVSRLDNVVVIAATNRPDIVDPALLRPGRFDRIIYVPPPDLRAR
FT                   FEILKIHTKNMPLAKDVDLMELAKMTEGYTGADIELLAREAGLLAMREVNGAGEVSMKH
FT                   FIEAMKKIKPSITPEMIKFYEAWYERMKQTLARERQRAPTLYV"
FT   gene            49579..49806
FT                   /locus_tag="Vdis_0053"
FT   CDS_pept        49579..49806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_0540 hypothetical protein; SPTR:
FT                   A8MC78 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49468"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRU3"
FT                   /protein_id="ADN49468.1"
FT                   /translation="MRRPVPIEALIMDLIRDKGDMWFNDLMQALRAWYPDVTEKEVLMA
FT                   LMRLELSRLIIVQKVVRKDGATYHIRVVKD"
FT   gene            49858..50907
FT                   /locus_tag="Vdis_0054"
FT   CDS_pept        49858..50907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0054"
FT                   /product="flap structure-specific endonuclease"
FT                   /note="COGs: COG0258 5'-3' exonuclease (including
FT                   N-terminal domain of PolI);
FT                   InterProIPR020045:IPR019973:IPR006085:IPR006086:IPR
FT                   008918:IPR006084; KEGG: cma:Cmaq_0040 flap endonuclease-1;
FT                   PFAM: XPG I domain protein; XPG domain protein; SMART: XPG
FT                   domain protein; XPG I domain protein; Helix-hairpin-helix
FT                   domain protein class 2; SPTR: A8M9L3 Flap
FT                   structure-specific endonuclease; TIGRFAM: flap
FT                   structure-specific endonuclease; PFAM: XPG N-terminal
FT                   domain; XPG I-region; TIGRFAM: flap structure-specific
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49469"
FT                   /db_xref="GOA:E1QRU4"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019973"
FT                   /db_xref="InterPro:IPR023426"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/TrEMBL:E1QRU4"
FT                   /protein_id="ADN49469.1"
FT                   /translation="MGVTELGKLIPEGVRKTVEFTQLSNRIVALDAYNALYQFLASIRQ
FT                   PDGTPLMDSKGRITSHLSGLLYRTINFLENRIWPVYVFDGKPPEEKTLEIARRRKVREE
FT                   AMDKWVKLLEEGKREEARKYAQRALFLTDDMVEDAKKLLRLMGIPVVQAMADGEAQAAV
FT                   IAREGKAWAAGSQDYDSLLFGAPRLVRNLAITGRRKLPNKDEYIEIKPEIIELNEVLKA
FT                   LKLKDRTQLIDLAILLGTDLNPDGVPGIGPQRALRLIQEFGGLEKLLQGPLKNAQFPTD
FT                   PLKIRDYFLNPPYNPNYKIEFGQPDERGIVEFLVHEHDFNEERVRNAIERLKKAMGKRR
FT                   ESTLDSFFG"
FT   gene            50950..52164
FT                   /locus_tag="Vdis_0055"
FT   CDS_pept        50950..52164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0055"
FT                   /product="respiratory-chain NADH dehydrogenase subunit 1"
FT                   /note="COGs: COG1005 NADH:ubiquinone oxidoreductase subunit
FT                   1 (chain H); InterPro IPR001694; KEGG: cma:Cmaq_0303 NADH
FT                   dehydrogenase subunit H; PFAM: respiratory-chain NADH
FT                   dehydrogenase subunit 1; SPTR: A8MB61 NADH dehydrogenase
FT                   (Quinone); PFAM: NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49470"
FT                   /db_xref="GOA:E1QS77"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS77"
FT                   /protein_id="ADN49470.1"
FT                   /translation="MLGTYMEPVLSIIGSALSWVSGIISSAIQLLYSIINYILSRPDNY
FT                   IPFLWPIINFLNHVPVINIIVHLIFWRPIFDLLFVPGLVSVTIALIFIIWFERKITAKV
FT                   QWRIGPLEVSRPIGGFLQPFADLFRYTFQEFVVPIHADRNYFIHAPAIAFILSTLPIFF
FT                   IPVGPRQFTLPNGAMIEGIYGVYTGYDVLIALALITLFNIAIILIGWASNDRFTYIGTV
FT                   REALLYTGYEAILILSAVAILLIYGTADPFKIVDWQVTHLPGIIANPLAFLAFLIATLM
FT                   ATSRFPFEIPEADTEIVLGPYTEYSGIVYGLVMTMSYEKLYVLSLLMVLLFLDGWAGPY
FT                   IPYFGALSPAIWFGIKTYIVMMIMVFTRSVYGRYRPDQALKMSWSSLLGLVMAALILSL
FT                   VIKVF"
FT   gene            52327..52533
FT                   /locus_tag="Vdis_0056"
FT   CDS_pept        52327..52533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0056"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR007087; KEGG: cma:Cmaq_0305 hypothetical
FT                   protein; SPTR: A8MB63 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49471"
FT                   /db_xref="GOA:E1QS78"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS78"
FT                   /protein_id="ADN49471.1"
FT                   /translation="MVICPVCGKEYANSSSLLKHVKLKSKYDPMHMAFWLEFQKYISTP
FT                   KEDWAMLTKTDLFREFLREKGLL"
FT   gene            52603..52977
FT                   /locus_tag="Vdis_0057"
FT   CDS_pept        52603..52977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE3137 hypothetical protein; SPTR: Q8ZTQ9
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49472"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS79"
FT                   /protein_id="ADN49472.1"
FT                   /translation="MVKKRVRGVIQEALDYQLNWPIKLRELSIRLQDRSYRTAQEAIKL
FT                   YVNGLLSKDAVIEIIRLSGVSLSRYMNPRRYLVYDDNDEVIENVDDVIINEFDEVNDDV
FT                   KEVEEEYVGQRIIRRLMGND"
FT   gene            52970..53377
FT                   /locus_tag="Vdis_0058"
FT   CDS_pept        52970..53377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3138 hypothetical protein; SPTR: Q8ZTQ8
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49473"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS80"
FT                   /protein_id="ADN49473.1"
FT                   /translation="MIDELIRKYGKYMGGIDYEKVLNDIISEEDRLREIERRLIGIETG
FT                   RQTNYEKLRELEKRQLILKYIELKNQERNMLELIKELKLKGYTKTEVTKAIRRLRRIRR
FT                   QIRMIKRELKLINEEPTNTTKDLKTDVFNEQ"
FT   gene            53378..53455
FT                   /locus_tag="Vdis_R0001"
FT   tRNA            53378..53455
FT                   /locus_tag="Vdis_R0001"
FT                   /product="tRNA-Glu"
FT   gene            complement(53821..54519)
FT                   /locus_tag="Vdis_0059"
FT   CDS_pept        complement(53821..54519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0059"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: C4D3C0 Cytochrome
FT                   c oxidase accessory protein FixG"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49474"
FT                   /db_xref="GOA:E1QS81"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS81"
FT                   /protein_id="ADN49474.1"
FT                   /translation="MVRVLVVDVVTAVVVAIAVVLLAYLLILRPSMTYLTINAPYVFLM
FT                   PIGNGQYELLYYDLNGDPHDLVTYKVQSNALNQAVSEINSFNQRNMGTIINGQLFIPLS
FT                   YEVIIGNSTRVVQIPVQGNTVLLDSASYNEPTIALGLANIWYQPGMGTVLQEVTNLQQY
FT                   VQNPIFTGGAVVIMSNGIIPYSIMFAYNSIGYGGALNFTMQSIVQSVRAYFTTQVNSAG
FT                   YNWSPSLWNN"
FT   gene            54798..55910
FT                   /locus_tag="Vdis_0060"
FT   CDS_pept        54798..55910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0060"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="COGs: COG1748 Saccharopine dehydrogenase and related
FT                   protein; InterPro IPR016040:IPR005097; KEGG: cma:Cmaq_1035
FT                   saccharopine dehydrogenase; PFAM: Saccharopine
FT                   dehydrogenase; SPTR: A8MDK8 Saccharopine dehydrogenase;
FT                   PFAM: Saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49475"
FT                   /db_xref="GOA:E1QS82"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS82"
FT                   /protein_id="ADN49475.1"
FT                   /translation="MVSIGIVGLGPMGRAIAYYLARHTGHVVNGYDVSDEAVSEAKRLG
FT                   INNAVKADARNYEDLKRIAGENDVIVSAVPQSIADQVVLRLHELGKPVIDLIFMWKYNE
FT                   DLARKLVSGPIIIPACGWAPGLTNLLAMAAANELEVVEEVGIHVGGNPVDPKPPLYYEL
FT                   LFSLESTVDEYVRSATIIKDGRVVGVEPLAEIFDFRTWLVNGEFAEFYTDGLSTLLVTL
FT                   PKYFKTLRNVYERTIRWRRHLEIMRVLRDLGLLSDVETAKYVLSKSLRPGINDFSIMVV
FT                   EAKGKISGDYAVVKFESVDYAQGGFTSMARLTGFTAAIIADLVARGEIRGEGLTPIEEA
FT                   YIRNRSILSQVVNALKMENVKIYKTKTMIE"
FT   gene            55979..57784
FT                   /locus_tag="Vdis_0061"
FT   CDS_pept        55979..57784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0061"
FT                   /product="amino acid permease-associated region"
FT                   /note="COGs: COG0531 Amino acid transporter; InterPro
FT                   IPR004841; KEGG: tac:Ta0789 amino acid transport protein
FT                   related protein; PFAM: amino acid permease-associated
FT                   region; SPTR: Q9HK19 Amino acid transport protein related
FT                   protein; PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49476"
FT                   /db_xref="GOA:E1QS83"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS83"
FT                   /protein_id="ADN49476.1"
FT                   /translation="MTSSTQSQVRLRRALTMTDYFMLAFTGMVGSGWLFAALGASGAMG
FT                   PASLLSWIIAGVFFIFMVFPFAELGGLFPFSGSLARYNHYSHGTISNYLLAWAYTLGAI
FT                   TTVSVEAVAIVEYASYYIPQFWNSTIGVLTPLGLAVAALLVLVFLAIQLIGVNVYGWFN
FT                   RFITAWKIIIPGLTIILLIALYFHPDYVIGKLPGGFAPYGYSVVFSGMITTGIVWAYEG
FT                   FRQGLEYAGEGKNPQRDAPLGTILALISVIILYILLEIAFIGAINWEAAGVKPGDWQSL
FT                   ASSSWQAHPFASEAMATGIPILMGLAVLLLIDAAISPAGTLAVFLGTSGRNLYGMSRVG
FT                   YIPEFFSRIHRKFQTPWIALIIAAVIGIAFMAPFPTWYTIMSYSAVMTVYGYLQVGITN
FT                   HALRKLAPDLKRPFNPPAWYVFYPLSFVVASLLIYWSGWSYVNAIIAGVILGFPLLLLG
FT                   PYRSEIKLTRAASVIFAVVYWVTSSLLIAGWYLNWFASLGVITSFAVYWTLISLIQVLS
FT                   LFYLWFKSRHPDVKAALWVPIYNILLGVISYIGSLGPLSTPLIPYPWDYITFAILSLVV
FT                   YFIAINLAYETKDLRQIKEKGLPIE"
FT   sig_peptide     55979..56095
FT                   /locus_tag="Vdis_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            58168..60054
FT                   /locus_tag="Vdis_0062"
FT   CDS_pept        58168..60054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0062"
FT                   /product="amino acid permease-associated region"
FT                   /note="COGs: COG1113 Gamma-aminobutyrate permease and
FT                   related permease; InterPro IPR004841; KEGG: sso:SSO1069
FT                   amino acid transporter; PFAM: amino acid
FT                   permease-associated region; SPTR: Q97Z63 Amino acid
FT                   transporter; PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49477"
FT                   /db_xref="GOA:E1QS84"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS84"
FT                   /protein_id="ADN49477.1"
FT                   /translation="MVNPPEAGPEVGEKKAIQSDKQLRRALNQWDIAFLVVGAMIGSGW
FT                   LFGSLGAAATAGPAAILSWLIAGFLMIFIALAYAEIGGMLPKSGGIVRYPQYTHGGFAS
FT                   FIMGWAYFLSAVTVAPSEAIAAVTYMSSYLPQLMSNGLLTPLGTLVAAALVVFFFLLNW
FT                   YGVHVMGKTNTAVGWWKLIIPSLTFILLMALAMHTVNYSGLAGGFIPYGWSEVFLAIPT
FT                   TGIAYAYLGFRQGIDYSGEARKATDVVWGTILGYVIVMFIYVMLQVAFIGAVNWSAAKV
FT                   SPGNWQALSSSVLSSGPFYEIMATSGVAILAGFAVILLIDAIISPSGTGWIYIGTTART
FT                   IYGMAADGHLPSAFLKLNRHKIPLWPTIAALVLGLLFLLPFPTWFAISSFITTTTVFTY
FT                   IIGGPSLMTLRRTAPNANRPIKLPAASVIGAIATIAAFLIVYWSTFYYLWFAIALILAG
FT                   LPLFYMYTMVNRYGASRTAGIVSGIIYWVVLIVATYYLIYLPFAAPTGWPASLPVTMLK
FT                   LQPTHIVDFVSYVVVMIAMVVGFTLYVASTARDREIAMKHVKAGWWVVATIFSAFILSF
FT                   LGSFSVFETPIIPFPWDTIIAALVALGLYLYGSYSGILTEDLVVALRELGGV"
FT   gene            60139..61593
FT                   /locus_tag="Vdis_0063"
FT   CDS_pept        60139..61593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0063"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide dehydrogenase (E3); InterPro
FT                   IPR012999:IPR016156:IPR013027:IPR004099; KEGG:
FT                   cma:Cmaq_0249 dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; SPTR: A8MAR1 Pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation region;
FT                   PFAM: Pyridine nucleotide-disulphide oxidoreductase;
FT                   Pyridine nucleotide-disulphide oxidoreductase, dimerisation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49478"
FT                   /db_xref="GOA:E1QS85"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS85"
FT                   /protein_id="ADN49478.1"
FT                   /translation="MLGKYPVFPPTDPEFEDPPKLDKYDVVVIGGGGGGYHGAFELSKG
FT                   GLKVLMVDDKGNLGGNCLYEGCIPSKSVYMTIYLMEKIRGILNSVGNKDINAVRVLWEN
FT                   AIDHKDNVQYIRYLQHIREIKGHENVDFVKGIAEVIDEHRVRVRAIDGSWTKDVEARQL
FT                   LIATGSVPIKIPVPGADLAIGSQELFGYKTSYRKIPNDVVIIGGGYIGVEVASVLGSMG
FT                   IKATIVEMLPRILTGWDNDVVSKIEEKLKSKGVEVLTNSKVIGIKEEGGQKIVEFERPD
FT                   GSRGYVAGSEVIMAVGRKPYVEGLDKLGIVEKGHVDVESSMRTKAPNTYAAGDVIGKYM
FT                   LYHAAVKESVVAAWNILHGKPIYEVNFNSIPMAIFTEPEAAMVGLNEDAAKARGINYVT
FT                   VSYPLEDDAYAQIMGVREGWVKLIIERESQRIIGGVVYGEAASLIINEIALAVSVNARV
FT                   KDIALLAHQHPTIFEAIDRAAIRFSL"
FT   gene            61700..62029
FT                   /locus_tag="Vdis_0064"
FT   CDS_pept        61700..62029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0064"
FT                   /product="Protein of unknown function DUF2175"
FT                   /note="COGs: COG4847 conserved hypothetical protein;
FT                   InterPro IPR018686; KEGG: cma:Cmaq_0285 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2175; SPTR:
FT                   A8MAU7 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized protein conserved in archaea (DUF2175)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49479"
FT                   /db_xref="InterPro:IPR018686"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS86"
FT                   /protein_id="ADN49479.1"
FT                   /translation="MSRKIWKCYRCGEEVVEGMKFTFTKQGPIHWECFRAEVRDRFNGS
FT                   IPEDVNIMLELLDYLADGIVKIKELETRASSDELRQVLMARRKIIEGEMAKLMSELNKV
FT                   LYGSA"
FT   gene            62086..63222
FT                   /locus_tag="Vdis_0065"
FT   CDS_pept        62086..63222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0065"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro
FT                   IPR003593:IPR001270:IPR011704; KEGG: cma:Cmaq_1086 ATPase;
FT                   PFAM: ATPase associated with various cellular activities
FT                   AAA_5; SMART: AAA ATPase; SPTR: A8MDQ8 ATPase associated
FT                   with various cellular activities AAA_5; PFAM: AAA domain
FT                   (dynein-related subfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49480"
FT                   /db_xref="GOA:E1QS87"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS87"
FT                   /protein_id="ADN49480.1"
FT                   /translation="MSENYFDRIRNVYAKLNSMFFKYENEVLGALMATLSRENYLLVGP
FT                   PGTAKTTLVYALSKLLNAKWFYRQLTKFTDLEEILGPINIAKLLDGKVERIYANSIVES
FT                   EFALLDEIFNASSAILNTLLSILNERVVYDGEKVVPVRTWTVFGASNRIPDEEELQALY
FT                   DRFPLRVFTEWVSPDDTEPLIIKGWELRMDLERMEPLATMDDVQAVNKIITQYVYDHIK
FT                   DISKIISPIIANYVEHIPISNRTRVKVPMYVATYLMLHGIDIGRAELTPSLLRVGTIKV
FT                   LRYLVNNKDQLNEYTSFATVHMPEDLLRLSELLSEAKALINNEVYDEARQRIRDAKELL
FT                   NQIRSKWDAVMVKLYTDEINELEDLLKKLEEALSESRR"
FT   gene            complement(63231..63599)
FT                   /locus_tag="Vdis_0066"
FT   CDS_pept        complement(63231..63599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_2902 UvrD/REP helicase; SPTR: C5BZ32
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49481"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS88"
FT                   /protein_id="ADN49481.1"
FT                   /translation="MTFVVNVRESFWAMVREPQLLINYLRELGIDINEICREEPINMLN
FT                   CPPSEGDDFRSRFFVVSYIYLRVLGQELRELEGSGVIVEELNELLSDVLTDMRLYNAPP
FT                   RLMNAVISIIRDILRLRR"
FT   gene            complement(63596..64780)
FT                   /locus_tag="Vdis_0067"
FT   CDS_pept        complement(63596..64780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0067"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; InterPro IPR001173; KEGG:
FT                   cma:Cmaq_1246 glycosyl transferase family protein; PFAM:
FT                   glycosyl transferase family 2; SPTR: A8ME67 Glycosyl
FT                   transferase family 2; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49482"
FT                   /db_xref="GOA:E1QS89"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS89"
FT                   /protein_id="ADN49482.1"
FT                   /translation="MMILLALVILGVLIIIASVLSSLLSLYFEIKYWRGRRRAGELING
FT                   NYPWVTVIMPVRGLDQNIKGNIASVLDQDYPGRRNYIFVLDSDDDPAYGIIKDLIKGFN
FT                   VDASVLINRGGRSKGEALAFALSHVDGEIVVFVDSDALVHRHWLRNLVSSLVKGSGAAT
FT                   TYRFYVPLRRLSLGSLLRASFNMIGITAMQNPVARFTWGGSTAIWKWILDKWRIRDYLP
FT                   YYLSDDYVITHFVHREGLAIDFVPESLVLTLEDVSIKEAFTWSVRQLWYVRVYGFRGFL
FT                   LYAASYTLYVVTLPIAIALSFINAWFIVPGLLPFIFGVVKDYIRISGIKALDRFYGINI
FT                   TRGYSTLLALISILNVYFSWLAIIKTMFTKSINWRGREFTVMDAIRLMKERPLE"
FT   sig_peptide     complement(64718..64780)
FT                   /locus_tag="Vdis_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(64813..65691)
FT                   /locus_tag="Vdis_0068"
FT   CDS_pept        complement(64813..65691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0068"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="COGs: COG2084 3-hydroxyisobutyrate dehydrogenase and
FT                   related beta-hydroxyacid dehydrogenase;
FT                   InterProIPR016040:IPR008927:IPR006183:IPR013328:IPR 006115;
FT                   KEGG: cma:Cmaq_1097 6-phosphogluconate dehydrogenase
FT                   NAD-binding; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; PRIAM: 3-hydroxyisobutyrate dehydrogenase;
FT                   SPTR: A8MDR9 6-phosphogluconate dehydrogenase NAD-binding;
FT                   manually curated; PFAM: NAD binding domain of
FT                   6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49483"
FT                   /db_xref="GOA:E1QS90"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS90"
FT                   /protein_id="ADN49483.1"
FT                   /translation="MTNIRVGLAGLGVMGWRIAKNLRDAGLLIGVYNRTFDKALRFSRE
FT                   FGVEAFKTPSELARASDVIITMLSDDEAVRNVIAGSDGVLSGLRPGSLVIDMSTISPSV
FT                   SIELANTIKSRGSEMVDAPVIGTSIAVERKEIVVLVGGSDEAFNRAREVLQYTAKTIVH
FT                   VGPNGYGLYAKLINNALLGSYVVALAEVVQLGKAFGLNDSVILDVLTKLSSARSPTSEL
FT                   KVPKMLSGDYSVQFALKHMRKDLDIVNREASIRGVPIPMASLALQLYRIAERMGLSEED
FT                   FAAVLKVLVKQ"
FT   gene            65795..67471
FT                   /locus_tag="Vdis_0069"
FT   CDS_pept        65795..67471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0069"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR016196:IPR011701; KEGG: sto:ST1709
FT                   multidrug resistance protein; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Q96ZY2 550aa long hypothetical
FT                   multidrug resistance protein; PFAM: Major Facilitator
FT                   Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49484"
FT                   /db_xref="GOA:E1QS91"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS91"
FT                   /protein_id="ADN49484.1"
FT                   /translation="MRYKWVVLSNTTIGTLLAFMNNTIVIISLPAIFNGIRINPLSPSA
FT                   FQYLLWVLMGYSLVTASLLVTLGRLSDMYGRVRLYNLGFLIFTIGSVLLYLTPNTGYLG
FT                   ALEIIIFRLVQAVGGAFLMVNSAALLTDAFPPNERGFALGTNQVAGLAGSLVGLIIGGV
FT                   LATYDWRYVFLVSVPFGVFGTVWSYLRLREIRRPIREEIDWLGNLTFVVGLTLILLALT
FT                   YGLAPYGSSPLGWDSPLVLVSFALGFAFLALFPLIETRVKAPMFRLELFRIRMFTAATI
FT                   ATTLRFLAYGSLMIMLTLWLQAIWLPLHGVPYTEAPLWAGIYLIPLMLGFLLTGPVSGW
FT                   LSDRYGPRLLATLGMVIMGIGFLVLASMPYNFQYWVFAPVIFMIGVGNGMFSSPNTASI
FT                   MNSVPPQHRGAANGMRTTLQNTAQAISFALAFTIVILAFTNYLPQALANALSSAGATAL
FT                   IPYITRIPPTVALFAAFLGYDPIRTMLSMIPQNIINDTPQQAINTITKLTWFPNAIAPA
FT                   FMDSLHILFYISSALAFTAAIASALRGQIYIYEEEPQYASK"
FT   gene            67537..67614
FT                   /locus_tag="Vdis_R0002"
FT   tRNA            67537..67614
FT                   /locus_tag="Vdis_R0002"
FT                   /product="tRNA-Val"
FT   gene            67746..69800
FT                   /locus_tag="Vdis_0070"
FT   CDS_pept        67746..69800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0070"
FT                   /product="raffinose synthase"
FT                   /note="InterPro IPR017853:IPR013785:IPR008811; KEGG:
FT                   cma:Cmaq_1025 raffinose synthase; PFAM: raffinose synthase;
FT                   SPTR: A8MDK0 Raffinose synthase; PFAM: Raffinose synthase
FT                   or seed inhibition protein Sip1"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49485"
FT                   /db_xref="GOA:E1QS92"
FT                   /db_xref="InterPro:IPR008811"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS92"
FT                   /protein_id="ADN49485.1"
FT                   /translation="MWTLTNRSLTVRFINGEECAYKVLESSFKLCDSELSLNILRYDYG
FT                   SIIELSVRSDKIDLSEYPVTMDLDLNEQAQGLLALTLLNLASSFMDRAFNYYNYMAQGK
FT                   TPRSEPPPERPEYPGNANYVGKWERDPVNCWAFPTFPRGPDKIPPYTVFLLTKLGNSYR
FT                   AYLALSSGQLTGFIGPGPKLITFTGKPSRSIKGWPLVVGISKDPYNAVENAVKLASMVA
FT                   PIKHRRSKVRPRFMVGLGWCSWNALLTEDLNHESIVRIIKGLRDRGVPIRWVLIDDGWQ
FT                   ELSNGVLNSVKPDPSKFPKGFRALIDELKALGIEDVGLWFTINMYWRGVTEDFLNSLGV
FT                   EGYRVGEGYVPIPNLEGAFKLYDAWLRLLKAEGFGFVKVDNQWIVHRLYWGLANDAEAS
FT                   RAIELALQLAAASNGLDVLNCMDMAPGNYGNYALSNAMRISQDYIPMWRADAKLHTLWS
FT                   VYNSLLYSHFAYPDYDMWMSYDQSARLIAVTRVFSGGPIYITDREPERTNVELIKWITL
FT                   SDGEVIRVDEPALPTRDILFRDPYNESVLLKLASTVNEYPVIAFMNINRDGLRISEKFR
FT                   LDEMPMKLGGQYVYYKVISGEWGIIEANGSIKVELNELEVEVIVLAPLINGSKAVIGMA
FT                   EKVLPPYPLNLIKINDRIVVRTRDEGTLLYVKDNTLSRVNVKASDIIEV"
FT   gene            69769..69930
FT                   /locus_tag="Vdis_0071"
FT   CDS_pept        69769..69930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49486"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS93"
FT                   /protein_id="ADN49486.1"
FT                   /translation="MLKLAILLRFNGSLGFLKNNNVNVLISWPGSATSVLELRISQWIG
FT                   KLINSLRI"
FT   gene            complement(70139..71221)
FT                   /locus_tag="Vdis_0072"
FT   CDS_pept        complement(70139..71221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mse:Msed_0801 hypothetical protein; SPTR:
FT                   A3J1A8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49487"
FT                   /db_xref="GOA:E1QS94"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS94"
FT                   /protein_id="ADN49487.1"
FT                   /translation="MGLAYEVGIKWKVVGIIGIIAIIVLALIIASPHVKPLQLIARSLG
FT                   LVQTQTIYVPVNHTVYVNQTIVKYVNQTVPVYINRTVYVYVPTFNSSDLNSLIEYVGKA
FT                   EGTGWCWARLIALPNGTVWLVNVWIAPVSLARVSGLFKIWPYSNWNSTYGIKDVTPYTF
FT                   PIVVPINNSLNVIDLETSDYVVISNATLNYPMPNYTVVLMATPATIFVVGNRTGFGPTS
FT                   MMELASSTVSNGELQLMQYYTAGIVTIGNELVNATLPLNRTYFGYMPALASWTYFTEAG
FT                   QLVSLLSPFNDVLVPCRVDVIYVANPQLALNITVPYPDIVSSYFGYWHIGEFSPSGDPY
FT                   ATTFGYWIWGVNATPINITW"
FT   gene            complement(71527..71625)
FT                   /locus_tag="Vdis_R0003"
FT   tRNA            complement(71527..71625)
FT                   /locus_tag="Vdis_R0003"
FT                   /product="tRNA-Arg"
FT   gene            71722..72654
FT                   /locus_tag="Vdis_0073"
FT   CDS_pept        71722..72654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0073"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="COGs: COG0668 Small-conductance mechanosensitive
FT                   channel; InterPro IPR010920:IPR006685; KEGG: cma:Cmaq_1868
FT                   MscS mechanosensitive ion channel; PFAM: MscS
FT                   Mechanosensitive ion channel; SPTR: A8MBF2 MscS
FT                   Mechanosensitive ion channel; PFAM: Mechanosensitive ion
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49488"
FT                   /db_xref="GOA:E1QS95"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS95"
FT                   /protein_id="ADN49488.1"
FT                   /translation="MGGSNVTVGVGRLVARLLLEWVLLAIIGALVYVLYINIVFYLLPT
FT                   SWKGVLLTYDSVVRSVIIVTIGAVLVWDTGRRVGDYISRYDRVRGTVLKFILDTVLIVA
FT                   VLIALAVTFEKFGLSVAAFSGTAVGIIVGLAAQQTLSNVIAGIVIIMTGRYKPGDRVTI
FT                   VNWRYGIIRAMYPHEGLPNGFTGVIRNITLMFTEVISDGGWVYTIPNYVMLDALIIHRD
FT                   VAPFKRIRARIDVPSSIDPWVFEERIKEALKDGRIKSIKVKVGETWQSSNLYQVIIEVL
FT                   ADGKADGEEIKDLVLREAVRIRNELSKQQ"
FT   gene            complement(72694..74550)
FT                   /locus_tag="Vdis_0074"
FT   CDS_pept        complement(72694..74550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0074"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="COGs: COG2414 Aldehyde:ferredoxin oxidoreductase;
FT                   InterPro IPR001203:IPR013983:IPR013985; KEGG: cma:Cmaq_0338
FT                   aldehyde ferredoxin oxidoreductase; PFAM: aldehyde
FT                   ferredoxin oxidoreductase; Aldehyde ferredoxin
FT                   oxidoreductase; PRIAM: Aldehyde ferredoxin oxidoreductase;
FT                   SMART: Aldehyde ferredoxin oxidoreductase; SPTR: A8MB94
FT                   Aldehyde ferredoxin oxidoreductase; PFAM: Aldehyde
FT                   ferredoxin oxidoreductase, N-terminal domain; Aldehyde
FT                   ferredoxin oxidoreductase, domains 2 & 3"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49489"
FT                   /db_xref="GOA:E1QS96"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS96"
FT                   /protein_id="ADN49489.1"
FT                   /translation="MTVFRILRVDLSREHFTEEIIKEDLLKKFLGGRGLAAYLALKEIP
FT                   RGIDPFDPSNKLYIFSGPLSGIATISSSRVNVTTRSPLTGVYTHSNAGGNFSYWLRKSG
FT                   YDGLIIEGKADEPVYLVIKDGEPKLKPAKHIWGKWTGASTKIILEENGFPPDETKAGVA
FT                   VIGPAGENLVRFAGIRLSDYERFAGRGGVGAVMGSKLLKGILVWGTRDLNKELVDRAKF
FT                   MKVNTDIVKRIATHDTTKVLHRYGTNVLMNIIQSIGALPHYNFGGTGKLKDVTPVSEEY
FT                   IKDHYPTETHGCYNCPIGCTQMPTVKSGPFKFTVTEKYVKQEYENTWALGPNVGLTDPE
FT                   ANLKLQKLANELGLDTISLGNTLSMAIELVKNGKLNLDIDWGDAGSLEYLVYKIAYRDG
FT                   IGDDLAEGDYRLAVKYGMPQLFVGSRGQGLPAYDARALKGFAIAYYTANRGGDHLEAYT
FT                   PTWEVFGVPEKVDPFCETQECIEKQARIVKWNQDLFAVVDSTIFCKFENLMPNIDTEKD
FT                   FANLYNAAFGWDLTPQDVLTIGERIFNVERLHWVREGKWVKDELPPRMREPIPDGPAKG
FT                   HTASKMFDEGIKVYYKLRGWVDGKPTRDTLKRLGLEEFDYLL"
FT   gene            74729..75229
FT                   /locus_tag="Vdis_0075"
FT   CDS_pept        74729..75229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0075"
FT                   /product="dual specificity protein phosphatase"
FT                   /note="COGs: COG2453 protein-tyrosine phosphatase;
FT                   InterProIPR016130:IPR020422:IPR000387:IPR003595:IPR 000340;
FT                   KEGG: cma:Cmaq_0558 dual specificity protein phosphatase;
FT                   PFAM: Dual specificity protein phosphatase; SMART: Dual
FT                   specificity phosphatase, subgroup, catalytic domain;
FT                   Protein-tyrosine phosphatase, catalytic; SPTR: A8MC95 Dual
FT                   specificity protein phosphatase; PFAM: Dual specificity
FT                   phosphatase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49490"
FT                   /db_xref="GOA:E1QS97"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS97"
FT                   /protein_id="ADN49490.1"
FT                   /translation="MVKFPYWVIEGALAGSSMPLDEDTVAMWHRMRIRAVVILVEEWEF
FT                   AMEGWDFNEYINTLRKFGMDYLHVPTRDGYAPPEDVLYNIVTWIDRSIMSGKPVLVHCH
FT                   AGIGRSPTVIAAYLMYRRGLSADDAIEVVSRYNDELSITNEQYLTLVAFEHYLRSIRNA
FT                   STP"
FT   gene            complement(75216..76523)
FT                   /locus_tag="Vdis_0076"
FT   CDS_pept        complement(75216..76523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0076"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR016196:IPR011701; KEGG: cma:Cmaq_1414
FT                   major facilitator transporter; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: A8M920 Major facilitator
FT                   superfamily MFS_1; PFAM: Sugar (and other) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49491"
FT                   /db_xref="GOA:E1QS98"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS98"
FT                   /protein_id="ADN49491.1"
FT                   /translation="MFGYAPKQLTLRQSLLAAISTMLVWGLEYYDIILFASLAPILEMY
FT                   FFPSKVAIVSAIETWGAFATTYFVRPIGAIIFGWIGDVRGRRLATISDAALVGLATLAI
FT                   GLLPTYYTAGVLAPILLYLMRILQGIGLGGEAGGGASWALELTPRNIRPYINGVMYSGL
FT                   SWAVFLTSFVTLSAKSAMHQAFNVYGWRILFITGAIPALIALIIRLWGSESLEWVEQVR
FT                   SRGVVKVPLGVVLSRYWVPFIALILINLGLTIYYYGGSGYWAYVMPKIIAPKLQLPANK
FT                   AYTWALILGMYGGIGAVIGELLSGFLIRALGIRRSFIAPSTLLLVLSPFIVYLAFTLNP
FT                   LSIYASLLMGILFGLTAAPQTLYFTSIFPTEVRWSAVAFGWNLNASIGPLSTMAIVLLL
FT                   ETAPSSPMLLAIYGSVVMMIGALLVILGSLIRTREY"
FT   gene            76624..77622
FT                   /locus_tag="Vdis_0077"
FT   CDS_pept        76624..77622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0077"
FT                   /product="RIO-like kinase"
FT                   /note="COGs: COG0478 RIO-like serine/threonine protein
FT                   kinase fused to N-terminal HTH domain;
FT                   InterProIPR018935:IPR011009:IPR000687:IPR015285:IPR 018934;
FT                   KEGG: cma:Cmaq_1049 protein of unknown function RIO1; PFAM:
FT                   RIO-like kinase; RIO2 kinase, winged helix domain protein;
FT                   SMART: protein of unknown function RIO1; SPTR: A8MDM2
FT                   Putative uncharacterized protein; PFAM: RIO1 family; Rio2,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49492"
FT                   /db_xref="GOA:E1QS99"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="InterPro:IPR030484"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QS99"
FT                   /protein_id="ADN49492.1"
FT                   /translation="MSIKNLVNAYDQLDPFDLRVLRVIEIGHRKFEYVPLEVIVDWSKR
FT                   SEELIGKSLKKLNALGMVIRYRGNYTGYRLTFMGYDALALHTLAKRGIIEKVSPTPIGV
FT                   GKESDVYAGDAVGDGKVVLKFHRLGRTSFRQIRRFRAWIGNRRHITWLYESRLSAHAEY
FT                   KALVLAYNAGINVPRPITVNRHTVVMSYINGAQLSEVGDVDDPEDLYWGIIEDVKRLFA
FT                   DVGVVHGDLSEFNIMIDLDSGEPYIIDWPQWVPRNAPGALDMLRRDITNVTRYFMKRFR
FT                   LDFDVDEVYNYVIGNVEVKEESLEEALEELLGSEGVNELMGSEKEEEFEDT"
FT   gene            77677..79635
FT                   /locus_tag="Vdis_0078"
FT   CDS_pept        77677..79635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0078"
FT                   /product="Protein of unknown function DUF460"
FT                   /note="COGs: COG2433 conserved hypothetical protein;
FT                   InterPro IPR007408; KEGG: cma:Cmaq_0863 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF460; SPTR:
FT                   A8MD42 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF460)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49493"
FT                   /db_xref="InterPro:IPR007408"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSA0"
FT                   /protein_id="ADN49493.1"
FT                   /translation="MLIEELSSGPIIGIDINGRKFSYAILSNGEIIEKGIIDPQDLIKM
FT                   VKKVRPKAIAIDNIGELMELSPSIIKRLGRLPFNVYLIQVTKVRPDADEAMELLVNKYF
FT                   GLNVVKLDPDSTAEYLARLCAMGVGSIVKVYEPETKIVVKAAISTTPGGMSRNRFERNV
FT                   AHRIRYLAKEIKERLESSGLDYDMFITPESEGLRSVVFIVYADRSVVRSVVKPRKSMDV
FT                   KVIVESVPTDSIKFVGLTEQEGAESVSTAKDRKLIVGIDPGIVTGVAVLDLNGNVLTLQ
FT                   SGKNLSRRHVLRIVYQYGTPVLIAVDTAKPSDYAKKLAAMVGAVIYYPDRDLSIAEKSE
FT                   IAIKISREQGIAVKDPHMRDALAAAYKAFIQLKPKLDRVEEEVRRAYARAVDDAKALVI
FT                   KGASIKQAIDEVSKRIEVQPQQEVRLLTTEKCECECDKLREEYENTIRTLNAEIERLNK
FT                   LYSETKERLEELINNFDIEVRKDQVVRSLYARIDMLEGDIEKYKLRVKELENNMRNLMS
FT                   DFLEYLRGNKYVLIRYSEGLDLNLMVQVHNSILIMSIGELMNVGIDKLISIGINSVVLI
FT                   DVNDKNVLRPIWKRGLRVIPIGMIYNGPLNDVLFIDRSVINNAIESLGKEFLSALDEDQ
FT                   LRKMINEYRRLRSGMLE"
FT   gene            complement(79627..80862)
FT                   /locus_tag="Vdis_0079"
FT   CDS_pept        complement(79627..80862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0079"
FT                   /product="Methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG1812 S-adenosylmethionine synthetase;
FT                   InterPro IPR002795; KEGG: pai:PAE0677 S-adenosylmethionine
FT                   synthetase; PFAM: S-adenosylmethionine synthetase (MAT);
FT                   PRIAM: Methionine adenosyltransferase; SPTR: Q8ZYP7
FT                   S-adenosylmethionine synthetase; PFAM: S-adenosylmethionine
FT                   synthetase (AdoMet synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49494"
FT                   /db_xref="GOA:E1QSA1"
FT                   /db_xref="InterPro:IPR002795"
FT                   /db_xref="InterPro:IPR027790"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSA1"
FT                   /protein_id="ADN49494.1"
FT                   /translation="MGMARTITINTIDRKPVSELNVELVERKGLGHPDYIADASAEAVS
FT                   KALSNYYLEKYGVILHHNVDKVLVVGGQANPRFGGGDIIQPIYILVAGRVTTEVKTATG
FT                   VEKVPIGTIIISAIKDWIRSNFRFLDPDRHVVIDYRVGMGSTDLVGVYELGVKAIKVPL
FT                   ANDTSIGVGFAPLTDTERLVLETERLLNSREFKAKLPEVGEDVKVMGLRIGKDVKLTIA
FT                   SAIISSLVKDKDHYLNVKEEVKNKVLDLAAKITPNLTVDVTVNAADKPEHGIFYLTVTG
FT                   TSAEHGDDGATGRGNRANGLITPMRPMTMEATAGKNPVSHIGKLYNVLANRIAERIYGE
FT                   VKGLKEVYVYLLSQIGKPINEPLVANVEVLPEPGVTLSGEIRNEIDGIVNEELDNITSL
FT                   TELVIKSKVSLF"
FT   gene            complement(80862..81107)
FT                   /locus_tag="Vdis_0080"
FT   CDS_pept        complement(80862..81107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0080"
FT                   /product="Sm ribonucleoprotein core-like protein"
FT                   /note="COGs: COG1958 Small nuclear ribonucleoprotein
FT                   (snRNP) homolog; InterPro IPR010920:IPR006649:IPR001163;
FT                   KEGG: tne:Tneu_1974 like-Sm ribonucleoprotein core; PFAM:
FT                   Like-Sm ribonucleoprotein core; SMART: Sm-family
FT                   ribonucleoprotein; SPTR: B1YC35 Like-Sm ribonucleoprotein
FT                   core; PFAM: LSM domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49495"
FT                   /db_xref="GOA:E1QSA2"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSA2"
FT                   /protein_id="ADN49495.1"
FT                   /translation="MERPQQPMKTLQKLVGKHVTIRLKNNKVLRGILVNYDDCMNLIID
FT                   EGEELDQKGENVVVKYGRLVIRGTQILYITSEEAVG"
FT   gene            complement(81204..81410)
FT                   /locus_tag="Vdis_0081"
FT   CDS_pept        complement(81204..81410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0081"
FT                   /product="RNA polymerase, N/8 Kd subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG1644 DNA-directed RNA polymerase subunit N
FT                   (RpoN/RPB10); InterPro IPR000268:IPR012287; KEGG:
FT                   cma:Cmaq_1572 DNA-directed RNA polymerase subunit N; PFAM:
FT                   RNA polymerase, N/8 Kd subunit; SPTR: A8M9S4 DNA-directed
FT                   RNA polymerase subunit N; PFAM: RNA polymerases N / 8 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49496"
FT                   /db_xref="GOA:E1QSA3"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR023580"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSA3"
FT                   /protein_id="ADN49496.1"
FT                   /translation="MIVPIRCWTCGRPLGHLWEPFKQRVLNGENPEKVLNDLGVTRYCC
FT                   RRTLLAHIELIDRVLEYSKIESE"
FT   gene            complement(81478..81954)
FT                   /locus_tag="Vdis_0082"
FT   CDS_pept        complement(81478..81954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0082"
FT                   /product="ribosomal protein S9P"
FT                   /note="COGs: COG0103 Ribosomal protein S9;
FT                   InterProIPR020574:IPR020568:IPR019958:IPR014721:IPR 000754;
FT                   KEGG: cma:Cmaq_1571 30S ribosomal protein S9P; PFAM:
FT                   ribosomal protein S9; SPTR: A8M9S3 30S ribosomal protein
FT                   S9P; TIGRFAM: ribosomal protein S9P; PFAM: Ribosomal
FT                   protein S9/S16; TIGRFAM: archaeal ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49497"
FT                   /db_xref="GOA:E1QSA4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019958"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSA4"
FT                   /protein_id="ADN49497.1"
FT                   /translation="MSGQGSESTALPRSVPNTITQEVAGARVVIAVGKKKTAIAKAVIR
FT                   PGIGRVKVNGVPIEIWPIEMARMRMMEPLLLAGKELTSKVDIEVTVRGGGFMGQATAVR
FT                   MAIARGLVEYFQNLKLLELYMTYDPSMIKGDPRRTEPKKPGLKHARSKRQKAYR"
FT   gene            complement(81951..82517)
FT                   /locus_tag="Vdis_0083"
FT   CDS_pept        complement(81951..82517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0083"
FT                   /product="ribosomal protein L13"
FT                   /note="COGs: COG0102 Ribosomal protein L13; InterPro
FT                   IPR005822:IPR005755; KEGG: cma:Cmaq_1873 ribosomal protein
FT                   L13; PFAM: ribosomal protein L13; SPTR: A8MBF7 Ribosomal
FT                   protein L13; TIGRFAM: ribosomal protein L13; PFAM:
FT                   Ribosomal protein L13; TIGRFAM: ribosomal protein L13,
FT                   archaeal/eukaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49498"
FT                   /db_xref="GOA:E1QSA5"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSA5"
FT                   /protein_id="ADN49498.1"
FT                   /translation="MSSRVIVVERNPPELNEVVVDATNHVVGRLASIVAKWALEGRRVV
FT                   IVNAEKAVITGDFNMVLNWYKTRISEWLTHYNPEKAGPKIPRKPDRILRRVIRGMLPRK
FT                   EPRGRQAYKRIRVFMGVPPQYMSVDKVVIKGALLSVRPGAKYVTLEELWSHIEPKQYEA
FT                   WRKAKEAWETRMAKLKKAESKGGNA"
FT   gene            complement(82528..82896)
FT                   /locus_tag="Vdis_0084"
FT   CDS_pept        complement(82528..82896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0084"
FT                   /product="ribosomal protein L15"
FT                   /note="COGs: COG1727 Ribosomal protein L18E; InterPro
FT                   IPR001196; KEGG: pis:Pisl_0696 50S ribosomal protein L18e;
FT                   PFAM: ribosomal protein L15; SPTR: A1RSE2 50S ribosomal
FT                   protein L15; PFAM: Ribosomal protein L18e/L15"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49499"
FT                   /db_xref="GOA:E1QSA6"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR022947"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSA6"
FT                   /protein_id="ADN49499.1"
FT                   /translation="MPPNPTGPTNVELRMLIRFLRRAANEYKAAIWDYVADLLEKPTRR
FT                   RVEVNVGKINRLVNDGDVVVVPGKVLGYGVLSKRVTIAAWSFSRGALDAIKKAGAEAIT
FT                   IPELVRRNNKGSNVKIII"
FT   sig_peptide     complement(82828..82896)
FT                   /locus_tag="Vdis_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(82955..83863)
FT                   /locus_tag="Vdis_0085"
FT   CDS_pept        complement(82955..83863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0085"
FT                   /product="RNA polymerase insert"
FT                   /note="COGs: COG0202 DNA-directed RNA polymerase alpha
FT                   subunit/40 kD subunit;
FT                   InterProIPR001514:IPR011262:IPR009025:IPR011263:IPR 011261;
FT                   KEGG: cma:Cmaq_1166 RNA polymerase insert; PFAM: RNA
FT                   polymerase insert; RNA polymerase dimerisation; SMART: RNA
FT                   polymerase RpoA/D/Rpb3-type; SPTR: A8MDY7 RNA polymerase
FT                   insert; PFAM: RNA polymerase Rpb3/Rpb11 dimerisation
FT                   domain; RNA polymerase Rpb3/RpoA insert domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49500"
FT                   /db_xref="GOA:E1QSA7"
FT                   /db_xref="InterPro:IPR001514"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR022842"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSA7"
FT                   /protein_id="ADN49500.1"
FT                   /translation="MVLVKVIEKSNLYLKAVVDGVTPPVINSLRRVLISDVPVLAIDEV
FT                   IILDNTSVLYDEVLAHRLSMMPIKTDLRKLPKIEECEQELVDPSLCQVRFELNVEAKEP
FT                   MIVYSRDLKSDDPEVRPVYEDIPIVKLVPGQKIVLEAYAKLGRARNHAKWQAGLASYYY
FT                   YPKVSVVGKADDKCRVCLEVCNGALEIKEDGSIIINDVLKCTFNKWKTCEQLCPALKVD
FT                   WDENKYVFWVESFGNMPVEDMVREGFRILKGKFQEFVNELELELSRGPAPSGELVAGET
FT                   TEESTQVTGEEFNTEEGPTEE"
FT   gene            complement(83916..85442)
FT                   /locus_tag="Vdis_0086"
FT   CDS_pept        complement(83916..85442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0086"
FT                   /product="Na+/solute symporter"
FT                   /note="COGs: COG0591 Na+/proline symporter; InterPro
FT                   IPR001734; KEGG: cma:Cmaq_1077 Na+ symporter; PFAM:
FT                   Na+/solute symporter; SPTR: A8MDQ0 Na+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49501"
FT                   /db_xref="GOA:E1QSA8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSA8"
FT                   /protein_id="ADN49501.1"
FT                   /translation="MVMASPLVGPLGWGLFLGFFVIFVFLGFYGARWRRGDLSQLHEWA
FT                   LAGRRLGTFLAWFLVGADLYTAYTFVAVPSGVFASGALYFYAVPYVATVFALAAVTMPA
FT                   LWRWSRLKGYVTAADFVHERFNSKLLAGFIAATGIVAEFPYIALQIVGMQAVLTIMLLG
FT                   IVKNVKFVSDVALTISFIILAAFTYTSGLRGATLTAVFKDALVFLGVIAILVAAPFAIP
FT                   GGFASAFNAATLKALPTGVSTLKDPFFITYTTLWVGSSLALYLYPHSVNGALSAESDKK
FT                   LAMSTALLPIYGIALALLAMYGILIYGSPEAMKILSLFPPSSRGILVIPTLAVTTLPEW
FT                   LAALALLGVFVGGLVPAAIMAMAQANLLVRNIIKPLYPRITPQGETRAAKWASVIFKFL
FT                   ALGFVFIVPATYAIWLQLLGGIIITQTLPSVFLGLVTDRLDKYSLMVGWAVGLGLGVYL
FT                   FVTPHKPSTMSPLYPIAGHLMYIAIIALAINLLIVLIGTGIAMAVRRGRA"
FT   gene            complement(85442..85666)
FT                   /locus_tag="Vdis_0087"
FT   CDS_pept        complement(85442..85666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1076 hypothetical protein; SPTR:
FT                   A8MDP9 Conserved hypothetical membrane protein; PFAM:
FT                   Protein of unknown function (DUF3311)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49502"
FT                   /db_xref="GOA:E1QSA9"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSA9"
FT                   /protein_id="ADN49502.1"
FT                   /translation="MTSEVGKRVSTWRKALAGVLFIIPWILYTLLPIYNTVQPVLGGVP
FT                   FFYWFQTLWLVISSILYIIAVLLLYPSKR"
FT   gene            85749..86321
FT                   /locus_tag="Vdis_0088"
FT   CDS_pept        85749..86321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0088"
FT                   /product="metallophosphoesterase"
FT                   /note="COGs: COG2129 phosphoesterase related to the Icc
FT                   protein; InterPro IPR004843; KEGG: hbu:Hbut_0257
FT                   phosphoesterase; PFAM: metallophosphoesterase; SPTR: A2BJG8
FT                   Phosphoesterase; PFAM: Calcineurin-like phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49503"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSB0"
FT                   /protein_id="ADN49503.1"
FT                   /translation="MGVKILHISDVHGNRYYIGSIGGVIKDVDVVVVSGDFEDPEILDV
FT                   LSNYSRPVYAVMGNMDPYGIRSRVQKYLVEGRIIPIGLFYLAGYPINMEEVKDLGPRLI
FT                   LISHYPPYGTNVDKAWNGSHIGSKSVRRFVENVRPLVVLCGHVHESRGVDRLGNTVIVN
FT                   PGPLINGYYALVNINDDGTVNAELSKL"
FT   gene            complement(86410..86679)
FT                   /locus_tag="Vdis_0089"
FT   CDS_pept        complement(86410..86679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_0826 hypothetical protein; SPTR:
FT                   A8MD05 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49504"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSB1"
FT                   /protein_id="ADN49504.1"
FT                   /translation="MSINIPEDIRKLVEEVTMNKLGSIKGKTETLGFVDSVIEELRRRG
FT                   VNLSDDLEAMIRPYVVDILWSLRKKGVITMDDDLLHFTPARQES"
FT   gene            complement(86676..87674)
FT                   /locus_tag="Vdis_0090"
FT   CDS_pept        complement(86676..87674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pis:Pisl_1088 hypothetical protein; SPTR:
FT                   A1RTH8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49505"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSB2"
FT                   /protein_id="ADN49505.1"
FT                   /translation="MSSLEIDLRRKDRYEDIIRAINEYGSSVKEAVFENLPDELMVPYQ
FT                   RIRELYIQETTRGKGRVDINSLIQLYMNVPKAEELLRYLLLATVLFMGFRNLRNEVIYR
FT                   VIRRNYNMVSRLISNPDYSLINEVSMKLLNDYEGEGIKGEDVQEVSNAVHSFVYGLRKL
FT                   TKAYGTTLLRWIPKFRDINDFEKALPMFYPPRANERRKRAIRTFIRWVSHETNLPVALG
FT                   VISRSGYRRYTMIADVYSTMVTIRSGAFLVLNNDHAMKILNEILVNKDSGVTIKVDEVK
FT                   GLVRATGRLSNDPIIYERGAFRIGHEYCSRLKCNECPLNKVCMKFTWVNIK"
FT   gene            87779..88570
FT                   /locus_tag="Vdis_0091"
FT   CDS_pept        87779..88570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0091"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR016040:IPR002347:IPR002198;
FT                   KEGG: cma:Cmaq_0839 short-chain dehydrogenase/reductase
FT                   SDR; PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   A8MD18 Short-chain dehydrogenase/reductase SDR; PFAM: short
FT                   chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49506"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSB3"
FT                   /protein_id="ADN49506.1"
FT                   /translation="MDLGLKGKVALVTASSRGIGLGIARVLAQEGVKVVISARREDELA
FT                   KARETIVKESGAEVLAVRADLTVKDDVDKLVKEAMSTFGNIDILVFNAGPPKPGTFSQL
FT                   SEDDWEYATRLLLLSAVWLTKRVVNNMVSRGWGRLIYVTSLTLRQPIPNLVLSNTVRLS
FT                   LAGLVKSLAVEYGPYGITANGIMQGYIMTERINQLAQEEARARGVSVDEVIKAWSKEIP
FT                   AGRYGRPEEIGYLVAFLASDKAAYINGSMILIDGGYVRCVF"
FT   sig_peptide     87779..87862
FT                   /locus_tag="Vdis_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(88607..89422)
FT                   /locus_tag="Vdis_0092"
FT   CDS_pept        complement(88607..89422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0092"
FT                   /product="protein of unknown function DUF75"
FT                   /note="COGs: COG1938 protein of ATP-grasp superfamily;
FT                   InterPro IPR019151:IPR002766; KEGG: pcl:Pcal_1998
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF75; 20S proteasome assembly chaperone 2; SPTR: Q8ZSU8
FT                   Putative uncharacterized protein; PFAM: PAC2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49507"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSB4"
FT                   /protein_id="ADN49507.1"
FT                   /translation="MSSTTAFDIKIKSIPRDPRNTLIMACPEPSLASIVAIEYLVETLK
FT                   MEEIGSIKPRGHVPIVTVIDGAAKLPYRLFFDREHAIVVIRQHVPIPPTLYRQFVDKIL
FT                   DWAEDNAVSRVVCLTSTSLLGEQESDNVYFVSEEGHVDEYKQLGLIPLHEATITGIEAV
FT                   FLDSVLSRNINGVLLLAESKVLTAINRLIESGKLSSHKDVLAILNQTIGRYGPDVTAAL
FT                   KLIRALSRIVGFEIPTDKLAEHASKYAFLVDKNLEAYMKPPKEELPVYY"
FT   gene            complement(89447..90403)
FT                   /pseudo
FT                   /locus_tag="Vdis_0093"
FT   gene            complement(90411..91955)
FT                   /locus_tag="Vdis_0094"
FT   CDS_pept        complement(90411..91955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pas:Pars_0880 hypothetical protein; SPTR:
FT                   Q8ZUF4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49508"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSB5"
FT                   /protein_id="ADN49508.1"
FT                   /translation="MALNGLRICWDIKVKDEKRLRCDEEVGDPRTTEEVMKLINEFLNR
FT                   VEKHKAILLSNLITPFDHTISALNEWLKKIETNIEAGNDRSVAELRKTMYELSMGIREL
FT                   AQQVREAWLSKYRSELEELIVKLMKGEVTVLIKGDALNKNKSFIVNLRARHLSVAIERV
FT                   AVSGSITITLRLIGRKGIYIVAPRLLSNNLLKPAEYGLLLTDGTIDKDGYPKMNTNHLW
FT                   QIIVFSLAYPGKVRLAIDGVNLNNGDVKVKWELRAISHKTKFKSKAKITKKVLKLNYDE
FT                   FLTFLLFAVLGDGNIYIKRKKKVIDITIGGSKHELWKGIIEMMESLGFKNYGSRNTKRY
FT                   ELRSSKAVALAKEWLNNALVKVIVECLSQLPDADKLRNLITLASMRVKPHGRSMIEIID
FT                   DVWMNINVRDAGYVELRAWRRRLEDARAIQEALRRAGYEAKLREARGGFEIYINKGQAK
FT                   RSPELLIKICGALRKMYEDAISENNERKAEKIARAIITLNCPVPCSESTRLKILPL"
FT   gene            92284..92805
FT                   /locus_tag="Vdis_0095"
FT   CDS_pept        92284..92805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG0663 Carbonic anhydrase/acetyltransferase
FT                   isoleucine patch superfamily; InterPro IPR011004:IPR001451;
FT                   KEGG: cma:Cmaq_0023 hypothetical protein; SPTR: A8M9J6
FT                   Putative uncharacterized protein; PFAM: Bacterial
FT                   transferase hexapeptide (three repeats)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49509"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSB6"
FT                   /protein_id="ADN49509.1"
FT                   /translation="MPIVRVGDKVPRIGRNVFIASTAYVIGDVVIGDNVSIWPHAVIRG
FT                   DEDSIVIGDNSNIQDGAVIHTDVGFPARIGRGVTIGHRAIVHGATVEDEVIIGMGAIVL
FT                   NGAVIGSGSIVGAGAVVTQGTKIPPNSIVVGVPAKVVRQATDADREYIRNNYQAYLRLA
FT                   RMYMDNGVNL"
FT   gene            92808..93920
FT                   /locus_tag="Vdis_0096"
FT   CDS_pept        92808..93920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0096"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: sai:Saci_1904 partially protein; PFAM:
FT                   glycosyl transferase group 1; SPTR: Q4J7M4 Partially
FT                   conserved Archaeal protein; PFAM: Glycosyl transferases
FT                   group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49510"
FT                   /db_xref="GOA:E1QSB7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSB7"
FT                   /protein_id="ADN49510.1"
FT                   /translation="MTCISLITDGIDGITGPIRVAYLLGRFLIGLGVDVNVVSPYVRED
FT                   VRRDFEYVGIKVRDLGIKPLLPGQAGHLSIWLINGVKGLINYGDDCLSINLSFELPIPS
FT                   TVFYAQGYVGDLLRDLSQVFPIYYRLSYYIALPLINTADSTYHRALSFSKYVIANSRYS
FT                   AEAVMSRGVRVWGVINPPVDTELFKPVPNPTQDYVLTYVGKETQFDVLKAMANAGIRIV
FT                   AFGSKVPWMPRWFIKHQNIDYRGRVSDDELARLYANARFTVFPFIHEPFGYVPVESMAC
FT                   GTPVLTYDKQGPGETVINNETGWLVRGPEDLIRLAIKLWFNGYDESMRIKARERAMAFS
FT                   VTKIINEWLGIINRSIHSRDEDKNNKELEY"
FT   gene            93930..95351
FT                   /locus_tag="Vdis_0097"
FT   CDS_pept        93930..95351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0097"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="COGs: COG1109 Phosphomannomutase;
FT                   InterProIPR016055:IPR005841:IPR005844:IPR005845:IPR
FT                   005846:IPR005843; KEGG: cma:Cmaq_1893 phosphoglucomutase;
FT                   PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase; SPTR: A8MBH7
FT                   Phosphoglucomutase; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49511"
FT                   /db_xref="GOA:E1QSB8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSB8"
FT                   /protein_id="ADN49511.1"
FT                   /translation="MSSKLTFHFGTDGVRGVIDEEFTDFLVAVLAESTFRYWSSKYGLH
FT                   KVFVSFDARRKSRDFAHIVASVAVNHGLDVVMVNKPTPTPTAAWFGSRFGFDLTIQITA
FT                   SHNPPIYNGFKVITNKGSPAQEEDTDEIERLYSNEYEDINRSVKTLELRPIPTVDPAPE
FT                   YINYVYESVIKMFKPRSRFKIIIDPIYATSIGYTSEVLRRLGMEVTEIHNNYDPSFGGR
FT                   DPNPEPQNIPELIQEVTAGKYDIGISHDGDSDRIALVDRVHGYLSANDILPIVVERLAS
FT                   ASMIKRGIVRTVSTTHILDNIAAKYGFKVVEVPVGVKYVARAILSGEADMGGEESGGLV
FT                   YSWHIPDKDGIYTASLIVAMASEYGGLTNLISDVRSKYGRAYFKRVDLDMRNSKKFVSD
FT                   NRETLLKMLSSLGPSPRPITIDGVKVVFGDGSWILIRGSGTEPKLRIYSEALSMGRVEE
FT                   LINNAIDIVNKLLRQ"
FT   gene            complement(95363..96472)
FT                   /locus_tag="Vdis_0098"
FT   CDS_pept        complement(95363..96472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0098"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="COGs: COG1363 Cellulase M and related protein;
FT                   InterPro IPR008007; KEGG: cma:Cmaq_0950 cellulase; PFAM:
FT                   peptidase M42 family protein; PRIAM: Cellulase; SPTR:
FT                   A8MDC6 Cellulase; PFAM: M42 glutamyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49512"
FT                   /db_xref="GOA:E1QSB9"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSB9"
FT                   /protein_id="ADN49512.1"
FT                   /translation="MSSQEFIDLLRRLSEAFGPSGFEDEVRDLVIKELEPYVDDLMVDK
FT                   WGNVIGVRYGSRRDLKAMVAAHIDEIGLLIDNIDKNGFLRFRAIGGWNEVTLVGQRVII
FT                   KTVDGKKIKGVIGSRPPHVTPPGKEREAPELKDLFIDIGASSDDEVRKLGVRVGSVAVL
FT                   DRDFEVLNGGIVTGKAFDDRVGVAVMLWAARQLRGSEVTVYFVATVQEEVGLRGAQIAA
FT                   DRVYPDFAIALDTTIAADVPGVNEREFVTRVGKGPAIKVMDGGRGNVFIAHPALTNFLV
FT                   SVAEDLKIPYQLEVLIGGTTDALGIAFRRDGIPATTISIPTRYVHSPVELLSINDALNA
FT                   SRLLAEALARADEKLVQSLREKMIKVKST"
FT   gene            complement(96555..98000)
FT                   /locus_tag="Vdis_0099"
FT   CDS_pept        complement(96555..98000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0099"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="COGs: COG2252 Permease; InterPro IPR006043; KEGG:
FT                   cma:Cmaq_0867 xanthine/uracil/vitamin C permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; SPTR: A8MD46
FT                   Xanthine/uracil/vitamin C permease; PFAM: Permease family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49513"
FT                   /db_xref="GOA:E1QSC0"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSC0"
FT                   /protein_id="ADN49513.1"
FT                   /translation="MSLINWLIPPTVTNVNPRREVLAGLTTFLTMAYILFVNPTIVGDG
FT                   FELALMHVLGTNTLSAQYQALVYTVKLGVAAGTAIAASLGTLFMAFYARLPFAMAPGMG
FT                   ENSFIAYSVIPAFTTVLLGMGIVGPQAAVIALMTAITAVFIDGLIFLFTAWSGIRERIV
FT                   KSISPNLSIGISVGIGLFITFIGLSLGGFVIPGSGTPVTFNTRAFVTPSSILAFVGLIL
FT                   AIYLYIRRVPGAFLITIVTITLVSLGLGLVKPPSTLVQPPMFTTSIIPNFPNNIEWWFR
FT                   LVSLAFPVAFSLWMIEFFDGIGTIVGLSNRAGLVDDSGRPINIGRALYADAIGTIIGAL
FT                   AGTTTTVIYVESASGIESGGRTGLTSLVTGLLFLAFLPLGPIVVMIPDCATAPVLILVG
FT                   LMFVSLIPRINFNDLTEAIPAFVAMISIPLTYSIATGIGLAFITYTLTKLVTGKFREIS
FT                   VTTLIITLIFILYFVAMVPMLNP"
FT   gene            complement(98099..100438)
FT                   /locus_tag="Vdis_0100"
FT   CDS_pept        complement(98099..100438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0100"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="COGs: COG0308 Aminopeptidase N; InterPro IPR014782;
FT                   KEGG: sai:Saci_0372 leucyl aminopeptidase; PFAM: Peptidase
FT                   M1 membrane alanine aminopeptidase; SPTR: Q4JBP1 Leucyl
FT                   aminopeptidase; PFAM: Peptidase family M1"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49514"
FT                   /db_xref="GOA:E1QSC1"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSC1"
FT                   /protein_id="ADN49514.1"
FT                   /translation="MSLGVELYVVELRFRFGDLTYEGVVDVHVSSVGDLLLNAVDLGIR
FT                   SVEVDGRPVDYSYDGRVLRVRGPISGVVRVLFNGRVGDRLLGIYRAPYRDGYMITTQFE
FT                   PTGARYFIPCVDNPAAKARFRVRVLVDGDYDVIFNTPPVRVYWDGPWKVFEFAETPRIS
FT                   TYLLYLGIGRFFESRDRVGNVDVIFATPLKDRVEDGRFALDVAKGVLEFYSGYFGIPYP
FT                   LPKLHLIHVPEFAAGAMENWGAITFRETALLVGRGSTELTRRRVAEVVAHEIAHQWFGN
FT                   LVTMRWWDDLWLNESFATFMSYKAMDRLFPGWGVWYRFLADETVGSMLRDSLVSTHPVH
FT                   VPISSEEEAFEIFDDISYGKGASLLRMLENYVGEEEFRKGLSNYLRKYAYSNATEDDLW
FT                   SSIEEVSGKPVTKVMKAWVDKPGHPVIVVEEPGKGITLRQSRFILSGNTADTWPIPIVY
FT                   RFNGAVNTVLMEHDTLTLSVSSASLFLNVNGSGYYRVRYTDWSRALSNASNHFERWSVI
FT                   NDAYAHLLQGSISLSEYLSLVRSVSDIVNYLITTTVITQLGTLYSIKPSAVKEVFTEYL
FT                   RAQSTLLEGVSGMDDVRELVLSRRALVDEDYAMSIAGLIRDYQGLSPVMRQAVVNAYAV
FT                   VGERPFETLRGLYRTLVSDEDRNRVLAAMLSVTDRDEYRKSLDFLMSGEVKRQDLQFFT
FT                   VGSRNPYVRDINLGWLMNNYKRFIEAYGDPGVLSRVFTYSIPFIGLGQEDEVERFLLGL
FT                   NIQGIEMGVKAGLELMRVYSRLLHSI"
FT   gene            100617..102026
FT                   /locus_tag="Vdis_0101"
FT   CDS_pept        100617..102026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4938 conserved hypothetical protein;
FT                   InterPro IPR002355; KEGG: tpe:Tpen_1703 hypothetical
FT                   protein; SPTR: A1S0W8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49515"
FT                   /db_xref="GOA:E1QSC2"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014592"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSC2"
FT                   /protein_id="ADN49515.1"
FT                   /translation="MSKEQVNVELYVRDFSVFEETRLMLKPLTILIGRNSVGKSHLLYL
FT                   IWLLMRLEPNVPALVEVDENLRKMIMGLKEAVFKGEDELRKAIISIIREIIRGYSYFLT
FT                   ESFKKTFGVGSVELSRNKQMKILVQGSDKCKIEFKLLENKIETSYIECEDLFNNINVGR
FT                   LEKLGLKELEMENNRFIVLWSESESCRFAAGVRLDTNNIMFNYISLNSIVKYTVSACFE
FT                   PWFLGDDYVDFFVDGRAGLIRSIMKPQVKIEGLLEPDEVFRYKYFKMMEGAYGGIKGIE
FT                   LIRDFLNELGVRDIKVEFERGLYVPYVVTWNGYVIPLDIAPSGVRESLLPVLSLINGES
FT                   RVVIIEEPEAHLHPRAITRLARVIARAVNRGKWVILSTHSDYLLYGLSNLIEASGLSDE
FT                   ELKRRGLDRSDVLSPDKVAVYLVKAEPEKSASVLERIPVSIDGIEEEEFSKVATELAEE
FT                   SSLIRSMKARS"
FT   gene            102029..102385
FT                   /locus_tag="Vdis_0102"
FT   CDS_pept        102029..102385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpe:Tpen_1702 hypothetical protein; SPTR:
FT                   A1S0W7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49516"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSC3"
FT                   /protein_id="ADN49516.1"
FT                   /translation="MKGRCRIKRADCRLIDLDEYVDNITGHGDKPPHADYALICGGRVI
FT                   IVEEVDGKAELRDGRKVEESEKLLRERGEITVQNVLKVVHARAGADSMVARVFRSAKIF
FT                   LVTCCDKLSEIVRE"
FT   gene            102730..103164
FT                   /pseudo
FT                   /locus_tag="Vdis_0103"
FT   gene            103329..103417
FT                   /locus_tag="Vdis_R0004"
FT   tRNA            103329..103417
FT                   /locus_tag="Vdis_R0004"
FT                   /product="tRNA-Ser"
FT   gene            103522..103824
FT                   /locus_tag="Vdis_0104"
FT   CDS_pept        103522..103824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0104"
FT                   /product="H+transporting two-sector ATPase C subunit"
FT                   /note="InterPro IPR002379:IPR000245; KEGG: pai:PAE0754
FT                   H+-transporting ATP synthase subunit C (AtpC); PFAM:
FT                   H+transporting two-sector ATPase C subunit; SPTR: Q8ZYI7
FT                   H+-transporting ATP synthase subunit C (AtpC); PFAM: ATP
FT                   synthase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49517"
FT                   /db_xref="GOA:E1QSC4"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSC4"
FT                   /protein_id="ADN49517.1"
FT                   /translation="MVGRRFVRALVIAVLVLSLAALVVHAQASDQAQVMAARALAAGIG
FT                   FGLAALGAGIGIGIAGAASVSALVERRELFALYLVFVALAEAIAIYGLVVLFILY"
FT   sig_peptide     103522..103599
FT                   /locus_tag="Vdis_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(103871..105193)
FT                   /locus_tag="Vdis_0105"
FT   CDS_pept        complement(103871..105193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0105"
FT                   /product="peptidase M20"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro IPR001261:IPR002933; KEGG:
FT                   ape:APE_1917 peptidase; PFAM: peptidase M20; SPTR: Q9YAM6
FT                   Putative uncharacterized protein; PFAM: Peptidase family
FT                   M20/M25/M40"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49518"
FT                   /db_xref="GOA:E1QSC5"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSC5"
FT                   /protein_id="ADN49518.1"
FT                   /translation="MDLLKLLEVLVEFDTVNDPDNGRMPDPGVVDFVEGVLNGLGVKTR
FT                   VLVSHGYRSVVGVIGSGEPRVLLMAHLDVVPFVRSEWRYDPLRLTVEGDLAYGRGALDD
FT                   KGNVAAVLKALEDLVSIGKGTVIVAFTTDEEVGGENGARVVRDYLLGNGLRPNYVVNAD
FT                   GQLMVIINRRRAIFNARIRSRVERAVVNGRRETIRFQLDYKVTPPYHAAYFIGGVDTHP
FT                   VIALSQYVWLNNAYVANLRGGFVKSNVTPTWVEADVIKPCSDCPQQEVDVGLTRLVKAL
FT                   LPLTRFVPRIKAQSVYGITATPNVYRVVGDYHEFVINVRAMTDDAKAIEEAMGDALRED
FT                   FQGVEVRVEGEGGGGYLYTPRDSRLVKLASEVLTELGLEARVVEMAGASDARYFSPLGI
FT                   ETIDFGPVGGNAHGPNEYVSIKSLETTARFYSLLVRRLISS"
FT   gene            complement(105200..105988)
FT                   /locus_tag="Vdis_0106"
FT   CDS_pept        complement(105200..105988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0106"
FT                   /product="AAA ATPase"
FT                   /note="COGs: COG0467 RecA-superfamily ATPase implicated in
FT                   signal transduction; InterPro IPR003593; KEGG:
FT                   cma:Cmaq_0372 AAA ATPase; SMART: AAA ATPase; SPTR: A8MBC8
FT                   AAA ATPase; PFAM: KaiC"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49519"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSC6"
FT                   /protein_id="ADN49519.1"
FT                   /translation="MLNYFVLAYSLVVMDFLKCQVLEDLLPTGFPFGYLVLIRGDLGMG
FT                   KTLLVKLLAKSILSNYPLIYVSFDDNPESVINDLKEFSNRLFIIDGFTLSDQRRVKAAN
FT                   VIDVITELDPGQLISKVSQAVYSRNARGLIIDSINDLLINIDPRGLIAMLKQFKSLSRL
FT                   YNMITFIVAHVTTEDIDNLLNSIEYVFDGVIEMEFDENMANLGIPVRRMRVKRMKGVSH
FT                   SMNWYYFTTAKGTIVPVDINEIRNILKNTLESLGIQVQGG"
FT   gene            106442..107146
FT                   /locus_tag="Vdis_0107"
FT   CDS_pept        106442..107146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0107"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpd:MCP_0891 hypothetical protein; SPTR:
FT                   Q26592 ORF 3"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49520"
FT                   /db_xref="GOA:E1QSC7"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSC7"
FT                   /protein_id="ADN49520.1"
FT                   /translation="MFRGFGRAVLIISLFLIVYYLIYSLSLIYLKPYIHYYLSVASTHT
FT                   RVFNFAVLIIFLTSPFNAYEAVIIHVDPTTYFLMSVLLPTTLMLVFLTLYNHVVNRLGV
FT                   RPVIPITGFTVFTIAASLTDSWVVSLGRWLVLGAPSIGTSVYSIFQLTATMYIVVTLII
FT                   QVIKITRSVGFRHEIKSRLITIYALITIIIILVITAVYYVLMKYAPIANTNHAVGLIIA
FT                   TLLIYAYHKFHH"
FT   gene            complement(107275..108168)
FT                   /locus_tag="Vdis_0108"
FT   CDS_pept        complement(107275..108168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0108"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcm:Bcenmc03_5669 UreA ABC transporter,
FT                   permease protein UrtB; SPTR: Q1BP30 Inner-membrane
FT                   translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49521"
FT                   /db_xref="GOA:E1QSC8"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSC8"
FT                   /protein_id="ADN49521.1"
FT                   /translation="MGFGLISSFVTVYGNGSHMSLIDLVMISLVKAAFIIVGIVILILA
FT                   MWLSYDGNVWHAIISDFGVFLLIMGFVMLFTPGSSYVTPAGPIVGSGGTLMAIGLQEYF
FT                   RAVSTSPDLRIEIVQDKPILNTFPDLCGTNRPAQQNAVGYLRLRVRNIGRGAAKNCVAQ
FT                   VRASLSGSAGCSLSPDYNDWVDLVWAGNRDRVDINPNDVRIFNLIVMPLDNGSKPFYAN
FT                   NLNMATVCGGSPPYAWFARPDVFLLGCLNRVQDCLTKCTYEVEVQVTCENARAEPVRLR
FT                   LTIGDDWKSTSIQEVK"
FT   gene            complement(108179..108475)
FT                   /locus_tag="Vdis_0109"
FT   CDS_pept        complement(108179..108475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nth:Nther_2312 diguanylate cyclase with GAF
FT                   sensor; SPTR: Q81GG0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49522"
FT                   /db_xref="GOA:E1QSC9"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSC9"
FT                   /protein_id="ADN49522.1"
FT                   /translation="MQQLRRRLRIPDWIFTILLLVFTILFAFILLLSVISIGISITIVQ
FT                   LPLPSSFRSVFAAIIVLIIFINIYLISVYWSAHKLISPRGNKLFLFNNILFCN"
FT   sig_peptide     complement(108362..108475)
FT                   /locus_tag="Vdis_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            108669..109241
FT                   /locus_tag="Vdis_0110"
FT   CDS_pept        108669..109241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0110"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dae:Dtox_4109 protein-tyrosine-phosphatase;
FT                   SPTR: C8VYQ8 Protein-tyrosine-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49523"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSD0"
FT                   /protein_id="ADN49523.1"
FT                   /translation="MWDDEILGQVAFKSITYMPGNALMISNVLKNAMSSARITGFVQLS
FT                   QQAIDRIEELRMRSNGDITMKLSPSFVSFFTDYNRGDTVKVVHTEGSQDSFVALKMASS
FT                   LLSGSVTTITCNVNVNGYKWVSEFLPKLIGSGYLVIELPLLPMPSDLGKEFNEHVIAVV
FT                   ESLRIARDELHKNLDKGSALTSIKTPY"
FT   gene            109256..109549
FT                   /locus_tag="Vdis_0111"
FT   CDS_pept        109256..109549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0111"
FT                   /product="FO synthase subunit 1"
FT                   /note="KEGG: mtp:Mthe_0221 FO synthase subunit 1; SPTR:
FT                   A0B5P5 FO synthase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49524"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSD1"
FT                   /protein_id="ADN49524.1"
FT                   /translation="MGVIGKRLGIDMGSGESSKDRLRKLIPGIVRNGKLAELIIESITR
FT                   IKSIATVGPEPTQPHYRPGSEPLTPIEVNDIIGITTYITNILLTEIKNLGRI"
FT   gene            complement(109783..110478)
FT                   /locus_tag="Vdis_0112"
FT   CDS_pept        complement(109783..110478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0112"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q20273 Protein
FT                   F41E7.1, partially confirmed by transcript evidence"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49525"
FT                   /db_xref="GOA:E1QSD2"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSD2"
FT                   /protein_id="ADN49525.1"
FT                   /translation="MSGCGDCYIVGTVHVMPVNGESLLRIMPCITHVVYEGVRDDITLG
FT                   WLLRNMRYLPLVIAFKLHFRFTNKLLALLYGFYQLIRRGKFSVGSDVESVEATFGKHVK
FT                   YVWGDYALTRLLIRLDDYVKPSWIILGVSILLPLVLIALLMITPHGNLIRIIYLALSLL
FT                   VLLSILLMAMPIRFLADKTLMLRNERAAEVAAELIKSGARVLIVFGKDHVRGIREVLRR
FT                   KYGIECLEL"
FT   gene            complement(110559..110939)
FT                   /locus_tag="Vdis_0113"
FT   CDS_pept        complement(110559..110939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pas:Pars_1507 ABC transporter related; SPTR:
FT                   A4WKZ6 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49526"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSD3"
FT                   /protein_id="ADN49526.1"
FT                   /translation="MAISKGDLALCADELRSMGFDAGRLTISVRDYVLSRVCQLIRDGK
FT                   TRVDDWVNNELRRYGVPFINVRFEDLGRYVRVFVDLASIEELAYEGPLRCDPKDINGLP
FT                   YRVALVMCELVKEHLRNYLGMT"
FT   gene            complement(111377..111655)
FT                   /locus_tag="Vdis_0114"
FT   CDS_pept        complement(111377..111655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0114"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbf:CLI_0787 hypothetical protein; SPTR:
FT                   A7GBA3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49527"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSD4"
FT                   /protein_id="ADN49527.1"
FT                   /translation="MVGFSSSFSEGSFLDGLLDVIGRLVGFESRTGYLTRLIHARHSDE
FT                   GFLRYAIIDALTSMGVGEYEVERQYGNKGGRRDHGSRCKAVKNTTAS"
FT   gene            111740..111928
FT                   /locus_tag="Vdis_0115"
FT   CDS_pept        111740..111928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49528"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSD5"
FT                   /protein_id="ADN49528.1"
FT                   /translation="MPTWLYHLDEFRLVSDYDFNYTINELIGIALSKAEELSIKPTTVC
FT                   HLELNNLSVCRALRFTG"
FT   gene            complement(112280..113389)
FT                   /locus_tag="Vdis_0116"
FT   CDS_pept        complement(112280..113389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0116"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CCAAT-box DNA binding protein subunit B; SPTR:
FT                   Q7RBW2 CCAAT-box DNA binding protein subunit B (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49529"
FT                   /db_xref="GOA:E1QSD6"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSD6"
FT                   /protein_id="ADN49529.1"
FT                   /translation="MRGSVVLLVIAIVSLAIVLLLIVPAQIVLGPLYKPVLKYHQYILQ
FT                   VSGPIIGALISVIAVLSNDLVKYYASTSTLRLSLGIGGEVDPGLDVEVFDPTRRISAMI
FT                   INDGNAIIRDAKASLTIKVKKGNEEKYHLGDVLLHRNKFDEYIKKYNHIKEILESPNCQ
FT                   NYLANRVNPHVVGESLPWALPERIVVRPSIRLRSKVISKKKLTEKLLDAEKIEKSNEKS
FT                   NKKSNSFLTNIVKEFLDILKDLPLPWFFTDYQHITSISPGQRNRLLIFDYVKLSDDKYL
FT                   IMPYSEYGGGGPSDPSVRPYRACLILTKDIEFVFEITVHGEGSRRPLRFNLCITVNKLN
FT                   QLESTVQCIIKGGDYNQLLKTLNNLKCQS"
FT   gene            complement(113500..114225)
FT                   /locus_tag="Vdis_0117"
FT   CDS_pept        complement(113500..114225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0117"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sep:SE0082 hypothetical protein; SPTR: A5BAL4
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49530"
FT                   /db_xref="GOA:E1QSD7"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSD7"
FT                   /protein_id="ADN49530.1"
FT                   /translation="MGEELRHCRIEHFKCDELGMRVYERLVEDWRHYDNLLWQIPFGTA
FT                   TVVGVVLTLIYHYLTGLGPGTIMLKLGLLFILLIFVLTMMALSIKIRYFQVERAKCIEE
FT                   IEQKCANVNVPYETEEAHKIVSKSEAHFESLVGRGTRAYYLQVILFIAIMAVILVVMTA
FT                   TAQQSSTQQVLGNITSLPSNMPQLPYWAQTALLSFIAIFMILLFITLIMILVIFILTTL
FT                   CTAIPVKVCKEYFSKLKEK"
FT   gene            114417..114611
FT                   /locus_tag="Vdis_0118"
FT   CDS_pept        114417..114611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0118"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dda:Dd703_0235 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49531"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSD8"
FT                   /protein_id="ADN49531.1"
FT                   /translation="MVEQLRHYREFLQPRHMALAILTSPTTAIPKTELRQLGVEVFQEI
FT                   TNTKIQDEFKNYIISALKE"
FT   gene            complement(114621..115370)
FT                   /locus_tag="Vdis_0119"
FT   CDS_pept        complement(114621..115370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0119"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1421 hypothetical protein; SPTR:
FT                   A8M927 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49532"
FT                   /db_xref="GOA:E1QSD9"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSD9"
FT                   /protein_id="ADN49532.1"
FT                   /translation="MVFLLFDIETCPAGDTPSINDEVIGFGFRECGKDGKCYDNYIVTV
FT                   SDYECNSISDCEGKILNTFLGKVDEYLRRAKEDVEKTNEKARGSGYSVLVIGWNIRSFD
FT                   LPVLANRLYRQGLMKNIDEALELIGIKPHLIYLDLYDFIKSIIFPRTKINLEEVVNAAS
FT                   RCLKEGVVASHNEGEESKKSMLKMCRKIKGEFRGRLSDNDRNELGKYIKDRLTHDLNQL
FT                   SILYKVLVSKINIKKCLMSELISIMKK"
FT   gene            complement(115372..116541)
FT                   /locus_tag="Vdis_0120"
FT   CDS_pept        complement(115372..116541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sso:SSO1712 hypothetical protein; SPTR: Q97XL4
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49533"
FT                   /db_xref="GOA:E1QSE0"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR023398"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSE0"
FT                   /protein_id="ADN49533.1"
FT                   /translation="MLPSDLGDVYVSACGELTRLCPRLVPSPLWGISLANIANMSPYIA
FT                   DAMCSGCGDAVRRVRDWWFSLNRNGPCEVCGAPGAEIDEEWDYVVKGNEGIAVITHLRR
FT                   LCRNCHLAKHQGYAKVHGLSEAAINHLARVNGVDVSTARRIVREVFGVWHTLNGVNWVV
FT                   RINNDIGLPSDLRVKVEELMNTMLSMHCSRWDGWFHCLNTGGVCEKALQETLQLLKDVE
FT                   DYDRLISTVEERLEKAGITVLKDELLFLINQNEVRRLLLMGRLDDDMLYVPVIGGKWMV
FT                   FIRRRDIYGKVFIEIINELIRRDLHYESKTLFNPRDNEGGIPLIFYVPSFLALNVVINV
FT                   ANVINEVLIRYGIRTKAYFKPELFTNKSIYRGTTGLKPYIYIANVGKGD"
FT   gene            complement(116630..116860)
FT                   /locus_tag="Vdis_0121"
FT   CDS_pept        complement(116630..116860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49534"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSE1"
FT                   /protein_id="ADN49534.1"
FT                   /translation="MDCAYLVIRWVGGVYVIEGFVPTRYISASATPTNPQIPINDLRRF
FT                   DAEEPIPITIHFRYKRIADLIPTERLRLRIT"
FT   gene            117002..117697
FT                   /locus_tag="Vdis_0122"
FT   CDS_pept        117002..117697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0122"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: cma:Cmaq_0864 methyltransferase type 11; PFAM:
FT                   Methyltransferase type 11; SPTR: A8MD43 Methyltransferase
FT                   type 11; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49535"
FT                   /db_xref="GOA:E1QSE2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSE2"
FT                   /protein_id="ADN49535.1"
FT                   /translation="MFEAGRYDSWFLRNNYVLESEVLLLKYMLEPGPGRALSVGCGSGL
FT                   FEFILRTRYGIVISDCVEPSPAMAEVARARGLNVRIGYAEELPFEDSTFDTVILNGVLD
FT                   YVKDDVKAVREAYRVLRPGGHIVVADVIAEGSYGLLYRLAELLGSWDDPYIARVRPLNP
FT                   YPIEYVRQARWHTVDEIRRLLEDAGFIIVKVAQTLTRHPRYSNESVEYPIDGYDRGDYV
FT                   AFKGWKPGP"
FT   gene            complement(117776..117958)
FT                   /locus_tag="Vdis_0123"
FT   CDS_pept        complement(117776..117958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: zgc:172108"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49536"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSE3"
FT                   /protein_id="ADN49536.1"
FT                   /translation="MCCLGEFVLSGDTGFWGVGIDNGEVILYLDESLAKRRVKVPSEVD
FT                   GVKVRVIRARRPRAL"
FT   gene            complement(118107..118361)
FT                   /locus_tag="Vdis_0124"
FT   CDS_pept        complement(118107..118361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0124"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: B8YGH2 M protein (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49537"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSE4"
FT                   /protein_id="ADN49537.1"
FT                   /translation="MQPVYMECDGDYHVEVLDREVRVIRQVRVLNNDLLKPRYRVTYVI
FT                   TSEKPKTVKVRYACRDEINEVEATLGKTMRYMIELLTRD"
FT   gene            complement(118518..118615)
FT                   /locus_tag="Vdis_R0005"
FT   tRNA            complement(118518..118615)
FT                   /locus_tag="Vdis_R0005"
FT                   /product="tRNA-Arg"
FT   gene            complement(118772..118945)
FT                   /locus_tag="Vdis_0125"
FT   CDS_pept        complement(118772..118945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49538"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSE5"
FT                   /protein_id="ADN49538.1"
FT                   /translation="MSPAKAIDEALVIIGKARMGRISCNEALDRLWEILVNLDFELKIA
FT                   NTVDGEVLELKS"
FT   gene            complement(119230..121749)
FT                   /locus_tag="Vdis_0126"
FT   CDS_pept        complement(119230..121749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0126"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vsp:VS_0525 hypothetical protein; SPTR: B7VJ76
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49539"
FT                   /db_xref="GOA:E1QSE6"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSE6"
FT                   /protein_id="ADN49539.1"
FT                   /translation="MLGLTLVVVVMVGSLLVRALNAVIRGREFRVDVEDLVWYAIALAL
FT                   VTNFYGLIPSSLYSTNTAINTIDGLLSAYNGLIGSLGMADAVLSVVVNVGLPIAEAAMY
FT                   VVTGSGLGSIILVIDVIEHLVTLVINYVVRVLSTLVAALWLTKYAVLIGGVLRLFMPYM
FT                   APLLVIPRVRSTVAIPVAIYLILGVALPLGINTTYSSPVISMPSTMSVVPTNVGFINIE
FT                   VVDELGRSVPSVLCINGYGFTYSEVVGLPNGVGLIALPIYTLRIQPILYKVNCVVALFM
FT                   RFNVNYLIAISPGFNNRTVFIRLPLIAVFNGDSLVALFNYEWNGIGNAGVNVNDGYAVI
FT                   NVTTPCSGNITVIAYASQVLVRPINPIGGNCSITYSTVQGTPTNIVPQSWINSIIRNHE
FT                   LFCQDLEQVLNPSIIYQGTTVPQQVVSAILGIVNESCGGLGNYTSAINELRSFRVTASL
FT                   TCRGTCNETVISIVIIGIKPYRLNYYALWNGSYITWLNDSLMIIKNAELNPFNLGTLIG
FT                   LLINTTYYSALFLGIIGLAAMTPRIRRWLDLMSIVKIRPNVHYEDVIAVVSPLISKGVK
FT                   GRVKQGDSVRRHVRLRRVHEILRYRYVRHALRAGYWAVRNLPRIAVAPHVLLPALYGVS
FT                   LSREYLMRRVSTIERESLRTALRSVISTVLSPSLVLRPYSLTNPLLRQGINVLGKYVGL
FT                   KVSDASRAYQSLRKHLNPSIAFFLALRSVIRGVDKYVVNAVDEVWHSLNRPLDALAMIS
FT                   ARFGVLRLIDRELATLIVDEALRELVGRRGSLVNVRILINDTVVKPEEVIKVGDYVDVV
FT                   VVTDEGNVAVKAWVVKELLRVVGSIRT"
FT   sig_peptide     complement(121693..121749)
FT                   /locus_tag="Vdis_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(121756..122151)
FT                   /locus_tag="Vdis_0127"
FT   CDS_pept        complement(121756..122151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_2855 inner-membrane translocator;
FT                   SPTR: Q5KYC2 ABC transporter (Permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49540"
FT                   /db_xref="GOA:E1QSM3"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSM3"
FT                   /protein_id="ADN49540.1"
FT                   /translation="MIYLAQWTPGLSSLLIVIGLGLSVSRLRGVGSLFVAVGLGLYVVV
FT                   VGGAAVIASQPFYGAMISDKVIQSIINPRSFETTWCQNVGLSVSGFGDVLSAYNRLAVY
FT                   IAQADVIVIILYAMLFAVIYAIRSALS"
FT   gene            complement(122244..123995)
FT                   /locus_tag="Vdis_0128"
FT   CDS_pept        complement(122244..123995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dth:DICTH_0798 chromosome segregation SMC
FT                   protein, putative; SPTR: B5YDQ6 Chromosome segregation SMC
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49541"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSM4"
FT                   /protein_id="ADN49541.1"
FT                   /translation="MTTRPQSNEPPAQGAAPWDPTPSPVGLGGGQNQPSSTAPAAGAVR
FT                   DTASGGVETPKQREIDNNVGGAAMGLGPLDIKLKRNSFYFGIKHGRKYICGNTVNDSDI
FT                   INRYVSLLAEAIDRMFKWRIWEPWWIDIYKMEWQAKKRNVYERLRGVYNDDVVNGILNV
FT                   FDEFISYIDRFREYWIENGIEVKEIIDNLVGGKAEVVIWENMSGLSVYGKNILLNVSKT
FT                   EGVVLHLVLKDLEGMTIEIPNIFMRVMSKDEYEKFIRELLIPLKVGFAETDESVDESKP
FT                   VMGTSKPWQAVLWSLIYYGRVHMHIHSVNVNKYDVTVTWHLRSLDHKSLKGFLKDTEKL
FT                   SKLSREALLAILFTAVLGDGSAFIADNGHYAKPVIEIVMSSEKYKMWKPLLEKLKSTGF
FT                   SWNKVPRTDRNSVNVVFNGSHAIKLARGMISILPSIIKDVIDALAVKTWINIKQIAEFE
FT                   PKFRKGMQIIVIADHAFSVTIKEGTVELRHHAKDEKEVKEILEKLKSIYGDEFVSQINV
FT                   YPEKGGKYLTIVVPMRLIERYDDIRVQVIRVLCQKLRMIKSERKEQIIVKHLTRLTLPI
FT                   KGGGRGN"
FT   gene            complement(124734..125375)
FT                   /locus_tag="Vdis_0129"
FT   CDS_pept        complement(124734..125375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A0DSS0 Chromosome
FT                   undetermined scaffold_62, whole genome shotgun sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49542"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSM5"
FT                   /protein_id="ADN49542.1"
FT                   /translation="MVMSMVNAWNESVRLASILLKRLRDYDEKSVKRYFTKDCLRYDLA
FT                   DRHYDKRIKRCLRTWYFRALITIASLLHPLVKAYGKKIAESAIKEVDLSRIDVRESLIK
FT                   DLSNAVYDAVIGYVMNNVRRISSISNDVVISKLINSGIGDLLAQITRIELLLKNCSKEG
FT                   KVIYEGEELDCTDLLLYNMELSQILAELQRLARKYDISIELTKHPWWLWL"
FT   gene            complement(125909..127285)
FT                   /locus_tag="Vdis_0130"
FT   CDS_pept        complement(125909..127285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0130"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR002464; KEGG: tpe:Tpen_0728 helicase C2;
FT                   SPTR: A1RY50 Helicase c2"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSM6"
FT                   /protein_id="ADN49543.1"
FT                   /translation="MANLRSDQLDVANKLLALLRERGIVGLQAPTGWGKSYVASYVIRQ
FT                   LGGKWVWASSLINALAQASRALGEFGVRHFLSTGRERLCTRGFRHSDFVVRRPCGFCQL
FT                   NKPVPLVKALINASDYAEVRDLAEQGRLCPYNVQEALIRELLGRYDDIVVLMNYSRLGK
FT                   YAGKVGGVIIDEAHNAVIPKLVSLSRRGVELLLGRLGVEDLDVRSAELVRGVLSELLPA
FT                   MAMDGEVNEIVSMDDLVAFIESSITYYDQDSDALVGVRFEGLELPSNKRVLLMSATLPP
FT                   SILTSIPVVRVEPSQLVRARLGSVVMTTENVERLKSEVARQVNDLLSDGALTVIFTTSS
FT                   KEVLIENAVYEDEVRREDVCRRNLVLRFFGRFAEGVRLNCYRRAVLLTLPLLPSNVMRR
FT                   LEARGLRSTDLVVMKTVQAIGRLMPNEVIDVVLFDRRFRRYCAELTNYGIQCTKQQNPG
FT                   "
FT   gene            complement(127290..127817)
FT                   /locus_tag="Vdis_0131"
FT   CDS_pept        complement(127290..127817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hde:HDEF_0810 peptidyl-prolyl cis/trans
FT                   isomerase (trigger factor), molecular chaperone involved in
FT                   cell division; SPTR: C0GT80 AAA ATPase containing von
FT                   Willebrand factor type A (VWA) domain-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49544"
FT                   /db_xref="GOA:E1QSM7"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSM7"
FT                   /protein_id="ADN49544.1"
FT                   /translation="MEGDEEFMRLREYVDRRLGEFREELLDYLDSMRSRSLESVRKEVV
FT                   KILVREIEDLRRQLLNEVGSGSINDVVRRLDELGEEINELRRLISSQSNQPSVVDVVRR
FT                   EVGAVEARLRWLIIDKINEVEARRRREGARRAVLLLLGVAVGIAVVVAVASELAPWLIP
FT                   LIIIAALALVRR"
FT   gene            complement(127807..128073)
FT                   /locus_tag="Vdis_0132"
FT   CDS_pept        complement(127807..128073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hpp:HPP12_0770 phosphodiesterase; SPTR: A5ARB2
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49545"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSM8"
FT                   /protein_id="ADN49545.1"
FT                   /translation="MRLFKKFLDEELEKYRVNIRRNDGGKTYKITTARVRRFMSRYLPE
FT                   NIITSVMIALSQYLPAILYEEGYEIVHKSKGKMIIRKVIIDGG"
FT   gene            complement(128238..128747)
FT                   /locus_tag="Vdis_0133"
FT   CDS_pept        complement(128238..128747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0133"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu4056 hypothetical protein; SPTR: Q7N047
FT                   Similarities with bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49546"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSM9"
FT                   /protein_id="ADN49546.1"
FT                   /translation="MRWEALAFYIEPRELLFCGKAVVGVADVDMDDCAIAVSSIKHAVI
FT                   SVEDLHGLTDLIRQGIKPLTAYPSHYMALVTHLLGRVGIPRYAFKVVNADPHITPFKAV
FT                   GAEGIIRNIAYLHGVLNIVARNWVRMGRPKASYAIHAMLRASGYNADRDLANRYRGSIP
FT                   CRVKLY"
FT   gene            complement(128729..130063)
FT                   /locus_tag="Vdis_0134"
FT   CDS_pept        complement(128729..130063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcl:Pcal_0763 AAA ATPase; SPTR: A3MU72 AAA
FT                   ATPase; PFAM: Type IV secretion-system coupling protein
FT                   DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49547"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSN0"
FT                   /protein_id="ADN49547.1"
FT                   /translation="MFIRRQGRINQQVGQVGSAGRDDPCRPSLRDMINDPARHLFHFMV
FT                   LDETHALIFGSIGTGKTTLIKNALMSVPCDYAVVVFDAAGTYEGYTDYYAPYPLNPLDY
FT                   LSDIEALDVIEEVLTMRFPRLPYVMTPAMEYMFMRAYGELTGQADDQLGNQPIPQAVSD
FT                   RGRAVGEVSISGLIKHLNDLVSGGALAREDEVNSARGLIRRLTYFNHWLFGRTHPLINR
FT                   LINGGLRGKSIGIDLSWFSPVQRWFYVLSLLAILNSMQARDLILVIDEAHLYFRLGEST
FT                   LTTSVRVGRNYGRYFALITQSPFDIPREFISMNKLFIEFPTLYFNPENIIFREPGFKAH
FT                   YGRDVYYNAEKTWSAIPPAHWENPLTAVMHIHITNRQMRNEHREPYNLLTVEVDPTIKP
FT                   KTGTTTLRKCAEAHGVRLDVIRESGFTDAKMKDRLEGVWECVGRP"
FT   gene            complement(130035..130907)
FT                   /locus_tag="Vdis_0135"
FT   CDS_pept        complement(130035..130907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0135"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1573 hypothetical protein; SPTR:
FT                   A8M9S5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49548"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSN1"
FT                   /protein_id="ADN49548.1"
FT                   /translation="MLRLVLGRLDYGGITTGVTFRFTGDARALSGVPDARLNALGKALI
FT                   NRVFRELNINCDSTHLESLSQVFEDCGFAMPASVKFTSEFNTDELKAILHSAPISIIEP
FT                   ISTIIGLALASSLRVNVEFYSDLWPRLTDALAQLKALGIDIAVHSSVFDVNRVFIFDEV
FT                   IRRLVRIPRIDELRETTEFNSRVEVIGVSRRFVEVPARQFSLAEPTEAWVSNDVVNAVE
FT                   VLIKDLGGVATLKALGDLVGQEAVIKALSMGYVVFNPSDMTVRATTKALTLIRRLGWSS
FT                   DVHKETRAD"
FT   gene            complement(130925..135256)
FT                   /locus_tag="Vdis_0136"
FT   CDS_pept        complement(130925..135256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1735 hypothetical protein; SPTR:
FT                   A8MAI1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49549"
FT                   /db_xref="GOA:E1QSN2"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSN2"
FT                   /protein_id="ADN49549.1"
FT                   /translation="MDPLGYALLIEGLVVMIYGVVRGGVGVRRFIAAGTALILAYALPT
FT                   LLGIAPPGSPTYLILYREVEGLVGDWSLVYYSSAYAGLAWAVGMTVLNVVAVISTLGIG
FT                   AIPLQGFTVIQGLGFIIDPIADVIFAVMHVAQVMTAVLHTIAYLAWFSYAIAPLVIGIA
FT                   AALMVMDRTRAAGAALFIVTLTILFITTIAAKDAMIASKNQLMNETTALMNWLTQNAPN
FT                   AVVRGFLILGSPYPYLVGGVLYGVNYTVIGRSVALTEYPVSGFTAFTGSVTPINAFGTP
FT                   EITNTTFLWLLVNPGHDCLLLTYAGNQSTAEPCDSAAYLSSNATYAEVIEFGNPPFNVV
FT                   TATLNGSTLYTGAWQWLDSPSKYSVLNGNNTAAINFTINVPPMRCINVTNPRTGVTHGE
FT                   CFPGVASATLWYFAGDALINVPTRVGNSTTCQYSVLNSTLYRTVSINDEESELRDLVSK
FT                   INEEVTIGREITGMGRNLSLALPNPEPVGYSQVEITVTCINHSNETVTVPGVITIIGNI
FT                   NNPWFGTDPIGLTPSTTWVINSMVVGSQRLLTGWSYFNGLLLGVGYFIPKWLAEAVAIL
FT                   GLLDAAMWIANLPTPLSPAWSVLSNVVMDLSLILYLRVAGVSRVLGRLFRRVRSSVASR
FT                   VRGLREGVALRMRRGGRLGGVVGPLMVIHHEFAKAVSALRGSRPNHPAWRRLSRHLPSP
FT                   WDPSPLARPVSAAMEDVESMLRGKAVVYGQRHRRALAGLARVGAGVASFVGEYPIWREA
FT                   GMRGRLHEVVGLRFRGGAVLDRRVYSRGGGAGDDLPAHLVTRAVARRIGIKRAVEDAFA
FT                   SLSMPRPFEVKAVKDPRLRGLMESLVSKYWLGGGKGLVVKNSRLDSARLLAIALTPYVR
FT                   ELHGKALTGIRRLSEVKGVINALINGELHRLVELSQLMGVEHGRARELLDKALGNRARE
FT                   LMSKHMRDRQVRELARGDVKLIIDALHNLRGGVALSRDVLKPLLEAFRDDAKAIEVINS
FT                   WWVRHTERINKALSGGASSEDLMIINRLSVRELTKALSPFVGARFREALESRAWGAAVK
FT                   EALPMAIGEFLRNVNYGGWVREQVRGFMEFGRFMGEYGGLLRHGVDALVGDKSFSEVFP
FT                   RIASIVRSDLLVDSVVRLHLAVTARDGVINRLSVGGRASVIGLIDYADSIRKQPLVALL
FT                   ELLSELGVDVNRAIEWQSFSEEYGRLRIGPGELKALARALRALHEDGFVDMESVEGVAR
FT                   DLVIKASMAKPNSDVFREFHKDLWGLVLSSDQAKHVRGGFIGVDSISDDGLRHLLARYM
FT                   PPRLAIEVLSQVRDYAVGEAEVMLRGLASRLSSEVDELRGRLRDLEAKLSDLVGSGGLG
FT                   GAEELSGEVGELRRRLAIYGSALGAVNNALNALSHTGAVDLRIQLLRSSINALRDSLGR
FT                   IINEFRDAELGLKVVNLMEAVVVAEALIDGLGRYVGDQPNK"
FT   repeat_region   135393..136111
FT                   /note="CRISPR"
FT   gene            complement(136442..138532)
FT                   /locus_tag="Vdis_0137"
FT   CDS_pept        complement(136442..138532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0137"
FT                   /product="protein of unknown function DUF87"
FT                   /note="InterPro IPR003593:IPR002789; KEGG: cma:Cmaq_0645
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF87; SMART: AAA ATPase; SPTR: A8MCH9 Putative
FT                   uncharacterized protein; PFAM: Domain of unknown function
FT                   DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49550"
FT                   /db_xref="GOA:E1QSN3"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSN3"
FT                   /protein_id="ADN49550.1"
FT                   /translation="MPEIDPRIYLAILIGVIVMGIVYRPLILLLPLAMLYRDFREWLVE
FT                   SILTLIYPGLAPRLVLGEDYVYDARGRLMHVFYSAEPMFDISRLTGAQYVGLFDELIRR
FT                   LNLGTNEAIAFIRLGGEKFIRLSRVVRGEDELQDFMNWLTARENLLRQYFVLRQLGGEE
FT                   LRRLVGFPTTPSKARLITALVTLLLASYLLFRVYGLITIAAIAAITVKSLGNYSVIRGG
FT                   QFSVLRRRLATSNKIYTMPSDDDVRAVASAVANYLQNYALIISGNPEFRAVTSTRVARE
FT                   YEKLVVQERGKALPAVSRWRVVLDRITQNAEEPVRVMILSDRDLPDTNMRMAWLRGQLP
FT                   LWSMPTIDELSHDVAIVPIFHGGRLIAESSRARVRLGRDREGSELEIDLDALPSGHMLV
FT                   VGPTGMGKTWTVSTILHRLMNSGIKALILDPHGEYLRIQGIEPIDVTRKFINFFELDGL
FT                   TDVERVHRLITEFSILGIDAKPMLPDLRLIYSNGIYRDFFKAMEFLRAATDDDSVALAL
FT                   DRLMSHLRGAEVVPVSELLNNKALLFGSVRASPDVMAFMMGVVADHVYSHVMSMSIGEQ
FT                   LRQLLIIDEAYYLLNSPLAELLVRGVRKFGLGTVFITQTLTGIGSDVLQNIPLIIVLGG
FT                   NDAYVASVSQALQLTSEDMKWLVTALPPHMQGLTTKALIITEPIKRLGIIELEPRIKEA
FT                   QQ"
FT   gene            complement(138568..139071)
FT                   /locus_tag="Vdis_0138"
FT   CDS_pept        complement(138568..139071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_0646 hypothetical protein; SPTR:
FT                   A8MCI0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49551"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSN4"
FT                   /protein_id="ADN49551.1"
FT                   /translation="MRLLRRDGLRSLEREIVELGRVKLRMARVKSIISDNRELARFVNS
FT                   WSLRCAEPLRDYCRSVLSRLVNYFTPESINELLSEVLARGLSVEAVLILLSQCDLLQCG
FT                   DYAVREYVETGRVDVNQLMGILQGEGVRISPEDLKAVINGDYRVNQARSNRLSWLPRFI
FT                   RPHR"
FT   gene            complement(139068..139424)
FT                   /locus_tag="Vdis_0139"
FT   CDS_pept        complement(139068..139424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_1429 hypothetical protein; SPTR:
FT                   C1FEP1 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49552"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSN5"
FT                   /protein_id="ADN49552.1"
FT                   /translation="MSNFLRSLISRGDQDGRSGVQPVVDSLPAPPPGPQGQPLPFPMPG
FT                   QAILESVLAEIDRLSSIERAIIVTRLLNSDEPLRGVNPEDWVRLIEERVGKAYGDAFRR
FT                   WLRARCGCGVGEGQ"
FT   gene            complement(139486..139632)
FT                   /locus_tag="Vdis_0140"
FT   CDS_pept        complement(139486..139632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49553"
FT                   /db_xref="GOA:E1QSN6"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSN6"
FT                   /protein_id="ADN49553.1"
FT                   /translation="MVNEEVISHVVPFVLLLMSDCTVSMAYSVIKSVDWSISCLNGDQD
FT                   LNT"
FT   sig_peptide     complement(139555..139632)
FT                   /locus_tag="Vdis_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            139698..139889
FT                   /locus_tag="Vdis_0141"
FT   CDS_pept        139698..139889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49554"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSN7"
FT                   /protein_id="ADN49554.1"
FT                   /translation="MIAVPLRVGIEIKKEYVYSITIVNAQNHCDVLRNIKTHCESTYGR
FT                   GHPACQGLETAINHLCKT"
FT   gene            complement(139890..140567)
FT                   /locus_tag="Vdis_0142"
FT   CDS_pept        complement(139890..140567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: B0EFI3 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49555"
FT                   /db_xref="GOA:E1QSN8"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSN8"
FT                   /protein_id="ADN49555.1"
FT                   /translation="MSAWLNELISGIVGFVGGIVGYVVSTRLKPEFKLVGITGNELDIN
FT                   FYGQNVTVIQCGARLEVRYHWRIGERFVTRNATGWVGVLRDNNIELHGASAAWALPNDP
FT                   VSTNIVGRESLILFRLVPAWGPLGNIKPNSVCQNINQFVNKQYILVFPPGNVMCARYHI
FT                   NQPQLFSQCASDVDENNTIKFRAAAENANGIECNARLGDVIRACLESYCRNKVPMKNNV
FT                   KCL"
FT   gene            complement(140624..141442)
FT                   /locus_tag="Vdis_0143"
FT   CDS_pept        complement(140624..141442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1192 ATPase involved in chromosome
FT                   partitioning; KEGG: cma:Cmaq_0648 hypothetical protein;
FT                   SPTR: A8MCI2 Putative uncharacterized protein; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49556"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSN9"
FT                   /protein_id="ADN49556.1"
FT                   /translation="MLRPRYAVMAFFSGSKGGTGKSTLAANLAITMSQSLRANVLLIDL
FT                   GIDSSQTSSRTLGIVPERRGALDFLVGAVSDVNQLVSRSTYMPSVLVVPPGSVKSYQLT
FT                   LGVNESFNRWVYLVNSLVMATGSQLVLIDLPANAPMPILIPALVTSQIINIVLDHAAYS
FT                   EYVLREIDDTYIQPMITQLRYRKIINVILNKALPSLDSVESRVRGYAHNGEVFTVPTSP
FT                   IAQYLTATMKPAVLYEPKGSLTQFKKAIETITNTLTRQAKALLTGSISLS"
FT   sig_peptide     complement(141329..141442)
FT                   /locus_tag="Vdis_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(141442..143004)
FT                   /locus_tag="Vdis_0144"
FT   CDS_pept        complement(141442..143004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0144"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG0630 Type IV secretory pathway VirB11
FT                   protein involved in flagella biosynthesis; InterPro
FT                   IPR001482; KEGG: cma:Cmaq_0886 type II secretion system
FT                   protein E; PFAM: type II secretion system protein E; SPTR:
FT                   A8MD64 Type II secretion system protein E; PFAM: Type II/IV
FT                   secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49557"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSP0"
FT                   /protein_id="ADN49557.1"
FT                   /translation="MHVSRPRVISQGLVRHQIIEFGGIRTDVEVHLIQSSQYGVHDYVA
FT                   YVIDDVPDWLIALPLDRIVDWFGSGVRLERAVERGLRMIGVKPSRESVDLAVKVFNRWF
FT                   NYYGALTPLLLMDDVTDIHINKANTRFGLGGVYIEHALLGRVQVIIGWEPYEVRRSGKA
FT                   VKTITFDLNAFIDYLMRRVAQRTRTAITTYNPVASVVDPEFGVRVSAESEPVSPGSMSI
FT                   RVLPRRPWTLPELIRRGMIGIEDSARLWLLADHKVPILITGPMGSGKTSLQNAVAFMLV
FT                   TKSMALIMDVAELFLPHHQVVKPMFERVAYAHGIRGIDKAELIRQALRSGVDVIVLNEA
FT                   RSRDEFRALAEAVTLGHGALTTFHAEDYRAAEVRLANMGLEAEELLKLSVVVEVGMSRD
FT                   VRFNPETGVYEVVTRRFVRRIHNTEPYMNALVKDYGPDYVSRQLELRTAFLTKAVNANI
FT                   DHEQLAGLLYVFYKQPEAVLKAVDVTAEVNTEQFSGEVKPLPLPDELLSLDSEAFKANE
FT                   GGN"
FT   gene            complement(143010..144083)
FT                   /locus_tag="Vdis_0145"
FT   CDS_pept        complement(143010..144083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_0362 hypothetical protein; SPTR:
FT                   A8MBB8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49558"
FT                   /db_xref="GOA:E1QSP1"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSP1"
FT                   /protein_id="ADN49558.1"
FT                   /translation="MDVGEVVADLVFIVRAPVDGVDNAVNESAKLSRAWRRIATVMRAF
FT                   NNPWALPRGFRRELLSIANSYFTAGSDPSITFLALMSKFSNWLNQQLDWQGKALTAVII
FT                   IAVMLGVASFMAILGAPPTVSIIGIALLPIIHHYQVELVRYDYTKPAMAGLIGGLTAFT
FT                   LGNYLVGLGATRLWFITALGFGVGFAVLYMPQFIRFVANYLGLPQRVLSSFNDLLTVPN
FT                   PQPPRPLTVVERDLKPLWDYAYGVGVREFVERVNMVVDSLIDFIRRSVMMGFIYGPFIA
FT                   VGYAFMVFTAYVLAGIHATAITGLGMPISLDPQLVNATLMPLAITTSILVGKAMHSVGL
FT                   GISLVPIFLAPLIPLIW"
FT   gene            complement(144164..144604)
FT                   /locus_tag="Vdis_0146"
FT   CDS_pept        complement(144164..144604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1574 hypothetical protein; SPTR:
FT                   A8M9S6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49559"
FT                   /db_xref="GOA:E1QSP2"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSP2"
FT                   /protein_id="ADN49559.1"
FT                   /translation="MSTKVESRARGGEFTVLWLVVTLVGMVMALVVMYVVYGGVSRSLG
FT                   MANAPMVTATTSSGVLFVNIKDAGVGSLRVESVILYAGQGQATCSLTTYYLDGQQLSGG
FT                   LPITLKPGQTLTITYSNCNPGVDEVTSVAVITSSGTYTAAVS"
FT   gene            complement(144638..145411)
FT                   /locus_tag="Vdis_0147"
FT   CDS_pept        complement(144638..145411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0147"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_0162 putative monovalent cation/H+
FT                   antiporter subunit A; SPTR: A4T2U5 NADH dehydrogenase
FT                   (Quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49560"
FT                   /db_xref="GOA:E1QSP3"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSP3"
FT                   /protein_id="ADN49560.1"
FT                   /translation="MNLDELFSGVVGFIIAMVIMAMAVGGVIYGYYQYVQSQVLANYLW
FT                   PVVDVVPYEGGYYMAVVNAGHEPFFVKAIFLSDGSHIEVRSNVLYHDQAWFYQASDLPS
FT                   AVMVCSAIKPSVCVIARASGWSMIDDAPSGSGWVNITLIVDPFSEGSVSWVGVGDNKGV
FT                   SGSIGLDESNNPYFGGYAVKDIFTYGPLLIEVTYRYYYLAYNNSTTPLECWLETSPGVQ
FT                   PILLSKTEGLNYIQFTYMLIASPNTDLTIHVKCNG"
FT   sig_peptide     complement(145343..145411)
FT                   /locus_tag="Vdis_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(145447..145743)
FT                   /locus_tag="Vdis_0148"
FT   CDS_pept        complement(145447..145743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_0320 hypothetical protein; SPTR:
FT                   A0NIR7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49561"
FT                   /db_xref="GOA:E1QSP4"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSP4"
FT                   /protein_id="ADN49561.1"
FT                   /translation="MKSGITSVTTAVIVALAIIAVTGLIAISVSLGKSMIDRARWAGLM
FT                   GSYEPPKPVTQVGGNGPVLDGYCLVYTVNNGYYNITYYSCPSIPMNNTVVSSQ"
FT   sig_peptide     complement(145648..145743)
FT                   /locus_tag="Vdis_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(145791..146201)
FT                   /locus_tag="Vdis_0149"
FT   CDS_pept        complement(145791..146201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0149"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1736 hypothetical protein; SPTR:
FT                   A8MAI2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49562"
FT                   /db_xref="GOA:E1QSP5"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSP5"
FT                   /protein_id="ADN49562.1"
FT                   /translation="MGTITHIVLQTGNTINATQVVNEVVSTVVSPIFNALLAIGGLALL
FT                   IGIGMILYNTVEYIVHPTSFGRSGALNEIFGHHKRIIGGALGIWLSIYIIFLIASMIGA
FT                   SSANPASEATYVLILMFKNLANYLRMAIGSPT"
FT   gene            complement(146223..147092)
FT                   /locus_tag="Vdis_0150"
FT   CDS_pept        complement(146223..147092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1575 hypothetical protein; SPTR:
FT                   A8M9S7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49563"
FT                   /db_xref="GOA:E1QSP6"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSP6"
FT                   /protein_id="ADN49563.1"
FT                   /translation="MSASPSLGILGVGLFGSIAASVLIHGFVKYLHGPTPEVRREGVDE
FT                   VLDVVVGSVMLGTLYALLLAPGSSFLPWLTHEIASAIPVGSTTLANYLPSAGDPQALLR
FT                   WGYLTAFRYFNETTGFYATFWGTVLTLNLVPVTSPLSWYLQQSTWYLQTMITYTIINLG
FT                   FIYALNLIAYNAWWLLPLGIGLVIVRQTRSLGTFIVAFLIIVAVLGPLLSAYTVASLSK
FT                   PLAQLGASNLWSDVTGSLKLIIDQGYSQALVMQTFDVTVDVALAMALAASYGLYRVFDE
FT                   AIIDVLPL"
FT   sig_peptide     complement(147036..147092)
FT                   /locus_tag="Vdis_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(147125..148705)
FT                   /locus_tag="Vdis_0151"
FT   CDS_pept        complement(147125..148705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psp:PSPPH_0362 methyl-accepting chemotaxis
FT                   protein; SPTR: Q48PK4 Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49564"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSP7"
FT                   /protein_id="ADN49564.1"
FT                   /translation="MAIEAIELSLDLDVKGREEMTLREFRSRFRIPPWHPCPCSEGDVG
FT                   RLLDDAYLNRLLDSRQRRALLPVIVIGNYVLTSTCLYRAVASMEHPALDRVRVMVWSLG
FT                   DYDESERFAVMALAAELCHVHEDRDDREIKLDFARELIKNYVIDHAINSPAEALKLIDE
FT                   LGRGFHTTELAKVFSKYIRANIRTGENYIRALILNNDFINELRNIVEKLLSNNGGNIGS
FT                   NAVHDESNRERFRRDFVSSPENVDRENVEQGSANNLNDEITKRLRVLKISGLLRGGDVN
FT                   STDLRALFRLSLRDLEVLARRLQGMPADSGLGLVKRVIALINEGRLGDAKVLIYTGDVR
FT                   FSDSVVGNVASDEANSEAGVGDSPEAGPGVLFRRYFEFTCDDDTCPVIRELSNASRDWR
FT                   VDSMARASIMLAARLASKAGSDALSEALNSLANYLGDAGLAEALLGLVRAYERDRAIVK
FT                   PLIKLLSGGEVLGALRLISNDVEAMLNAVRESSANAVCETLQYVVADLVNLIPSNLRGS
FT                   VEVRVNCWQ"
FT   gene            148754..149737
FT                   /locus_tag="Vdis_0152"
FT   CDS_pept        148754..149737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0152"
FT                   /product="Rad51 domain protein"
FT                   /note="COGs: COG0468 RecA/RadA recombinase; InterPro
FT                   IPR020588:IPR016467:IPR013632; KEGG: pcl:Pcal_2031
FT                   RAD51-like protein; PFAM: Rad51 domain protein; SPTR:
FT                   A3MXS9 Rad51-like protein; PFAM: Rad51"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49565"
FT                   /db_xref="GOA:E1QSP8"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSP8"
FT                   /protein_id="ADN49565.1"
FT                   /translation="MTRKKTESINEPSELSRLTELGFSRQTIERLMSVGVRSLRHILLF
FT                   NAEELQELLGSPDTELPRRLINTARELLAEAPTATTARERIEALSKAPILKTGVDGLDS
FT                   AVGGLRFGVSHEFAGEFGAGKTIMALQAAVASIGQFGFRVVYIDTEKTVDQYLGSNLIK
FT                   NMCSRFGVDYEKVINDYLLIYNPATVDDLEDFIKLRLADLVLSNNARVIIVDSITALYR
FT                   AQFRGRERLAERQQRLHYVLDWLRRLSIRAGVLVVYTNQVMTSPTGFIEVKLPVGGNVL
FT                   AHTVNARWLMTRASKAKNEGVMKALDVPGLPPGFEIRYSIMDDGLH"
FT   gene            149862..150635
FT                   /locus_tag="Vdis_0153"
FT   CDS_pept        149862..150635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: B9HHX4 Predicted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49566"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSP9"
FT                   /protein_id="ADN49566.1"
FT                   /translation="MGAYPGDARSRGLVVVNDDGFPVDAVSGVVLRDYVFEGTEEHPAR
FT                   PVRFDYGNTGVLASQNPLNKLIRYFGADMVVGVRDGAEARARLVRALADEVEAVLRGHG
FT                   IQYHRSQCEALAEKLLGLGVKPSIAVKVLDCALDPECDEYGPELRRPVEGAFEDVFNQS
FT                   LGPNAVVKAQIITALNRWFLNDVISPGEVYGEYQELSALARALGRRVYRRSLIKAAIAS
FT                   VIARALGIERARELLRDVGEEQAVELLRELRRAEG"
FT   gene            complement(150632..150757)
FT                   /locus_tag="Vdis_0154"
FT   CDS_pept        complement(150632..150757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49567"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSQ0"
FT                   /protein_id="ADN49567.1"
FT                   /translation="MSIKDGIKPLSDPNNRGFTCIEVGRDYGDWEVVLDVCLNMP"
FT   gene            complement(150754..151299)
FT                   /locus_tag="Vdis_0155"
FT   CDS_pept        complement(150754..151299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A4RMK9 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49568"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSQ1"
FT                   /protein_id="ADN49568.1"
FT                   /translation="MLVFRDGVIRRRNLFVYGFDRPSRPVPVGLGSVALVVRGLVVVAS
FT                   VVPRVFEVRESPIGLGDVLVRGRVRRGFCWDGNFIWPPESAESLISLVDSGYALVIERV
FT                   AEAPNVVRAYRRLVDRGYLRADTILNIQAMTSTTPVLVGIIEVEALGVGKPFWRFPRPC
FT                   LAGQYINNALTKLGVRVV"
FT   gene            151627..151944
FT                   /locus_tag="Vdis_0156"
FT   CDS_pept        151627..151944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0156"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1811 hypothetical protein; SPTR:
FT                   A8MB00 Putative uncharacterized protein; PFAM:
FT                   Ribbon-helix-helix protein, copG family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49569"
FT                   /db_xref="GOA:E1QSQ2"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSQ2"
FT                   /protein_id="ADN49569.1"
FT                   /translation="MRFRSVRVREDVYEVLARLSEINGTSINELIRQLLTAYLAINEIK
FT                   EMLRQCLGRLSIGTGLNAVSTEPIKDSIREVNEPLIEFEGNPWVRIIRARVVNGEGREG
FT                   H"
FT   gene            151919..152500
FT                   /locus_tag="Vdis_0157"
FT   CDS_pept        151919..152500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0157"
FT                   /product="zinc finger SWIM domain protein"
FT                   /note="InterPro IPR007527; KEGG: pai:PAE1404 hypothetical
FT                   protein; PFAM: zinc finger SWIM domain protein; SPTR:
FT                   Q8ZX85 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49570"
FT                   /db_xref="GOA:E1QSQ3"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSQ3"
FT                   /protein_id="ADN49570.1"
FT                   /translation="MVRVERDIEGLAVERLRARFPGKGNSWIKRALRRFEGGSVRQLGE
FT                   DAWVVSGDPRLGDRYPSYVVRLRDGRYHCTCFETSWGLRRSAEVCTHIAAVILHREYSK
FT                   LMQPVYAAVMTMECDGDHHVEVLDREVRVIRQVRVLNNDLLKPRYRVTYVITSEKPKTV
FT                   MVRYACGDEIGEQEITLGKTMRYIIELIMR"
FT   gene            complement(152624..152725)
FT                   /locus_tag="Vdis_0158"
FT   CDS_pept        complement(152624..152725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49571"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSQ4"
FT                   /protein_id="ADN49571.1"
FT                   /translation="MSKIIYSNALISNVVDEESVRGLLRCIAWPQVN"
FT   gene            153169..153819
FT                   /locus_tag="Vdis_0159"
FT   CDS_pept        153169..153819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tac:Ta0077 ethanolamine permease related
FT                   protein; SPTR: A1HSQ2 TRAP dicarboxylate transporter, DctM
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49572"
FT                   /db_xref="GOA:E1QSQ5"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSQ5"
FT                   /protein_id="ADN49572.1"
FT                   /translation="MTTLTIKDLYIPIGCFIIILLLIALIVTTQTALALSMHYGDLIFN
FT                   MVLFLTSPFNLHEFIAVKVNPSVVFYELFLTFMDLLLAMSLIGYRFSEFRNVIFSMFAM
FT                   FLTIVVANYLAFGIHYVIWREPLTGISGIATDSSIIILIMSIDAMLKTWRREPINTYEL
FT                   ALTLASPPFAIVTLYLALISPYWINHVIDIISLTPTLAIMLKILNIKIFKMMR"
FT   sig_peptide     153169..153270
FT                   /locus_tag="Vdis_0159"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(153952..154971)
FT                   /locus_tag="Vdis_0160"
FT   CDS_pept        complement(153952..154971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0160"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="InterPro IPR003593:IPR011704; KEGG: dth:DICTH_1964
FT                   methanol dehydrogenase regulatory protein; PFAM: ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase; SPTR: B5YCB1 Methanol dehydrogenase regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49573"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSQ6"
FT                   /protein_id="ADN49573.1"
FT                   /translation="MGALNTQSLIDGLYMREDNGECTVSVRVLIDVLGPGNYNRFRTLL
FT                   VRYGFRIERSRSYTWAIINRPCAEARRIIIDVVNSLIGGKGWGEAEATKCEPKAIGEVT
FT                   SYLSSRVLKLVPSLGEAVDDLIINLEAGNHVVLLGGPGSGKTLILDAIAEVANNPLYVN
FT                   MADASAAGIEDLIIEAGCVDYLLLDELDKARNIALSPLLQLLDHGGRLRITKHGKAVSL
FT                   EMPWLRAVAAANPFNPRVRSANWWAPLMDRLVPIEVPQPSVDELIGFMESITNARMPGW
FT                   VRQVVEEYMGRVTLRKAEQAAKYIVKAMERGKSEETIKAKVEKIMRSYSELVGDLSTS"
FT   gene            complement(154981..155859)
FT                   /locus_tag="Vdis_0161"
FT   CDS_pept        complement(154981..155859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A3QA86 ABC
FT                   transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49574"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSQ7"
FT                   /protein_id="ADN49574.1"
FT                   /translation="MGQLGRVRWCWFVDEVARVDGLDNAPSLMTTVTCEDILLMRISLD
FT                   TLAGGAARFTAIRGFARDYLGITSHRVLYRMLRRLCEYGLVKFRRGSTCRSSDYDCAVS
FT                   KTGCRIMSILPTSIGLVLASTTSLAFFTYLDMYTKYVSNELSGEASDAMNLVKESIINL
FT                   FNLGAYDTYDKTLARSMHQAAMSTFMSMKNITELMAIADAIGLDTPESTYAFRAVVFHK
FT                   YNVNKFLRFVLVGLIHKALRYGFNINEVSGLIKDLLNDRVDEVRKHLDLVIKLAKASRQ
FT                   EGVSLLERLMQ"
FT   gene            155996..157186
FT                   /locus_tag="Vdis_0162"
FT   CDS_pept        155996..157186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pgn:PGN_1396 anaerobic ribonucleoside
FT                   triphosphate reductase; SPTR: Q7MV40 Anaerobic
FT                   ribonucleoside-triphosphate reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49575"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSQ8"
FT                   /protein_id="ADN49575.1"
FT                   /translation="MSTGGLGNKCNRCDRRCELNQLQGRGCGSVTIGDEVIDYGDLCVD
FT                   IGDVIGILEHGDIDLAEALRQFINTKSFNADLCELCGDYNQRITCTENLAIYCSDEDKI
FT                   YYNIDRVAEWLTKLYITNMGTLMKQLASELKDVLIKNSNFKLGVPLGLVMRIAAEATVD
FT                   VAMTYLLSHERYHWAHGPGEFPPEEEVMAAAYGMYTAYTESLNPLVKFISMISKSLPEG
FT                   HAHLRFRAFSLPGTTRYLLSTLLKGYFKHLTLARLAYDNALLKDYSGFTKYLDPIPSEP
FT                   RLVILSNGIITVPIIGRSYEIIANFAMNDDQYVQIIHDDRRILDVEMSIKSVEPKFTGE
FT                   PRIRRGEVREEYKHCEVCIDLKPSQWLIPIESIINYNYLKISQVTPEVLKAIVNGD"
FT   gene            157176..158396
FT                   /locus_tag="Vdis_0163"
FT   CDS_pept        157176..158396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to conserved hypothetical protein;
FT                   SPTR: Q9U6W2 Cry1A toxin receptor A"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49576"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSQ9"
FT                   /protein_id="ADN49576.1"
FT                   /translation="MVINVAQSLPAMASVGNIVRNWNDWVKNFFNAYIAPLNQCAEELL
FT                   KQFGNINNEFVEYVRLIHDLTDKILSRTGVIADSAITPCSIERFLEYAVNSSAGHNPFM
FT                   FFAWSIRTTTPIHFRAYYGDPSNYTTILSNLGYDKIQNAPQPVSLCPGCNPSEYSLHGY
FT                   PDWLINGNVEYVPGYYPRLSLKFEENAWNKFISSASTLGGLLARLNEAIWSMINDATWL
FT                   SSLYYYSQNNQIIPLRSSLIDYAMKVSKSLEPISAQYVNHYVCRGGDVDSKFDVFCRNV
FT                   VTSVYADINTISRSLTTLLDALHNKFNSDTARDEPTYHIYLVNNNDRNCKAGRFEYGLY
FT                   YVPMPWCSYMDMVIPQVMLGRLELVSINMNSLINELSKAYVSEERQRIIQFLNTYTGTY
FT                   TVLLRWL"
FT   gene            158393..160060
FT                   /locus_tag="Vdis_0164"
FT   CDS_pept        158393..160060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0164"
FT                   /product="Competence CoiA family protein"
FT                   /note="InterPro IPR010330; KEGG: pho:PH0588 hypothetical
FT                   protein; PFAM: Competence CoiA family protein; SPTR: O58329
FT                   Putative uncharacterized protein PH0588"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49577"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSR0"
FT                   /protein_id="ADN49577.1"
FT                   /translation="MMGTTYLTHEQQIVQQLLRRKYFLVHGGGARELNPGEVAQLGIQT
FT                   QQYAHVPIQQPQVVQSLAPQHAAPQYAVPTPPQRLPERPQPLGDIFYVSSIELAGPINV
FT                   RKLPLIIPQVTPISAQSINVYRMTPQIPTPQLTFSPVASIILNEEALEAMGLSKNEFVL
FT                   RLVSTASVIGRGLTTLQYLVGSGEFVDFLNGRLGPSSKKAVILLWDLHDNIHYDFIREL
FT                   LLRRMRELGDEPEFVRSVIDSAGSVSNGVKTDLEVSSNVNQLLMIRCMLDKEQLMNLNW
FT                   FKDRLRELMSRRGSTYVVIICERSATNVVGYVVNAWSEICKGEGAHSPIERLCNYVVDK
FT                   LHVPFIILQPPATAEGIKLAYLINGVKPPDNPSNIFDVAFGDALMRYSSRLNEIKSDYE
FT                   LYVERGENESAEHFKLKAFIYHYLVKTRFNGKPEDSIGQIRTEYAVCSGVKADVAYGGE
FT                   VYEVETLFGEGENSVKKVQETVMKYKGCGAISKVHIVLEPLTTVMHLKELWGLMEHFNN
FT                   LRRRGLLPFGVSIETINVDREELVPLKDFIRELGEALS"
FT   gene            complement(160176..160304)
FT                   /locus_tag="Vdis_0165"
FT   CDS_pept        complement(160176..160304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49578"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSR1"
FT                   /protein_id="ADN49578.1"
FT                   /translation="MPTRVKVVALETASGRYVERELESRINEAIREVENGVAELLM"
FT   gene            complement(160336..162354)
FT                   /locus_tag="Vdis_0166"
FT   CDS_pept        complement(160336..162354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0166"
FT                   /product="AAA ATPase"
FT                   /note="COGs: COG0433 ATPase; InterPro IPR003593; KEGG:
FT                   pai:PAE0245 hypothetical protein; SMART: AAA ATPase; SPTR:
FT                   Q8ZZI5 Putative uncharacterized protein; PFAM: Domain of
FT                   unknown function DUF87; ATPase family associated with
FT                   various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49579"
FT                   /db_xref="GOA:E1QSR2"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSR2"
FT                   /protein_id="ADN49579.1"
FT                   /translation="MQSPDLMARAREIEDFIHSKGVGDAVIGRVTMGDYVSVGVEGHRI
FT                   IIDVPFNNYVNSGIRVGDFLGIATIIHRTLVLGRVTEVRRSHVIGFTRTTPVLEVPEDY
FT                   TGIATPATVMLEPLTECPMDGFEACDPSPVHTPIDPLSIVFRPTPTFIKRMLQLPSSGV
FT                   LIGWLYSGGRVVRGVDVLLPEHVLYEHMLVVGTTGSGKTVLLKNLALSILSSIPESTVV
FT                   ALDLQGDYPLMALPPDRVVDDLIFKPVDSLTIVAPITRDYLRVNRDIIEDYGDYYVGEV
FT                   EGSDATLTDVEDPGKYAQAIGYGLLRALLEQTYGGSKIEVDPRNYTASVRVQGNEAVLD
FT                   GVEAVVTVDGRSFRLRLIPWALSFSSIYRDLPRVFPVFSQRVSLLFPKVIDRAMDYIRA
FT                   GVNCEERVGERGREKCRVEDRRQGRLATKAVGAQEGSTGIDELLSNDACIELAAACMKL
FT                   APSQRDNIFRGLSMIGGLGIMDVRFTSRDGRYAVVFNEPSNYADVLRGLVILDLRLFRE
FT                   NPGAASIIVYRFLSRVFEERDNELRGGRQPRPTFIMIDEAHNYFPQTVGRGDEDFNKDT
FT                   VETMINKLTRLGRVRRIGVIFATHTPGDLNDLILQLTNTKVALRSEVEVLERVGLREYA
FT                   GEIMYAQDGVAVVRSYALRTHAVMIKAPPQVRHRSHK"
FT   gene            complement(162341..162643)
FT                   /locus_tag="Vdis_0167"
FT   CDS_pept        complement(162341..162643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0167"
FT                   /product="NurA domain protein"
FT                   /note="InterPro IPR018977; KEGG: pai:PAE0246 hypothetical
FT                   protein; PFAM: NurA domain; SPTR: Q8ZZI4 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49580"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSR3"
FT                   /protein_id="ADN49580.1"
FT                   /translation="MFWYVYSGLGSRVFRVEVLRSTYDGMRDVVEGLVKWLARNIGVDG
FT                   LPYVIGVVDKYAKSLTRGLYLAFYELARRSQVSFTYDTEVEVRQLLSEVVGSAVA"
FT   gene            complement(162712..163506)
FT                   /locus_tag="Vdis_0168"
FT   CDS_pept        complement(162712..163506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0168"
FT                   /product="NurA domain protein"
FT                   /note="InterPro IPR018977; KEGG: sin:YN1551_2261
FT                   hypothetical protein; PFAM: NurA domain; SPTR: C3NJN0
FT                   Putative uncharacterized protein; PFAM: NurA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49581"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSR4"
FT                   /protein_id="ADN49581.1"
FT                   /translation="MPSGVLGIFNKLLTSLTTSSGKLSAITEAPPTEDQNFRTEVINAE
FT                   PKHVEGLGGAPPRRLIVIDGSSRRLGSLSFRVFIAGVAIYGLRPPIELYPGLGGAPQVR
FT                   FLAVKAPSEDVLRRIEEDGELGGFVMVKSHDGKYFVGDYNEDDISDEVRMGLETWALDK
FT                   VHSELGRAGSEYAVVVDGPTYLGLGEKGGLAMRRVSAIGRLEGLGVPVIGVVKRVENSR
FT                   KLCSDEVLSEFGLLDTINPRHCSDPLVIQSIGSGRVRGSSTQ"
FT   sig_peptide     complement(163432..163506)
FT                   /locus_tag="Vdis_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            163600..163812
FT                   /locus_tag="Vdis_0169"
FT   CDS_pept        163600..163812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49582"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSR5"
FT                   /protein_id="ADN49582.1"
FT                   /translation="MRLRLIASDGALGYYELPSRPDDPWKPMKLIVRVGPREYYIVEAY
FT                   PEHLSGRWVIAMPIIKDEIELISIA"
FT   gene            163904..165310
FT                   /locus_tag="Vdis_0170"
FT   CDS_pept        163904..165310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0170"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR019825; KEGG: ade:Adeh_4176
FT                   UDP-N-acetylglucosamine 2-epimerase; SPTR: C7DDJ3
FT                   Ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49583"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSR6"
FT                   /protein_id="ADN49583.1"
FT                   /translation="MLLRGLGLVVVMGGVEFIGVDLDSIDGRLRAVIDYAIKAWMGVEV
FT                   GGESVRGLFSDDVDYRLFTGLGFRDLAGIAVSRHYAVLVMGVGEHYHPTYVVGVNDGGK
FT                   LFINGGGWAYADHCSAEPSFMRHFLSGGALRVVGVDDSEVKGLLGFDLDAGYEGVDLGS
FT                   ALGSRVRVRGDLVLQVLPIEDYVDEITRAAEEQYVNAASHVIMRRAMNALDKYGIAATL
FT                   DGDVLMVEASGLGGDVNSILNEIAKLLARDLVIDDMLTNGHPDVEVKRVASDWVLVHYG
FT                   YSGLNEWFLELGVRYMEYLGVGLITIKPTAQPSGCRYVVGCGDLPRLVRESLWGGEGVQ
FT                   EVDIGGYEITYHGLPRSVTLSLKPSFMGKPLMITANAEPSDLGVTRDLVIEHPRHGTYK
FT                   AVLTEARMIRASRVTDTLTPYKNALRLRKMTAKAGGIAEYALPQGVRGITLGINLSRPI
FT                   TKNCDAENDE"
FT   gene            complement(165357..166196)
FT                   /locus_tag="Vdis_0171"
FT   CDS_pept        complement(165357..166196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0171"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR011991; KEGG: pis:Pisl_1930 hypothetical
FT                   protein; SPTR: A1RVU5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49584"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSR7"
FT                   /protein_id="ADN49584.1"
FT                   /translation="MGGRRGLYLALLKYVVEKGGSARFSELCSFLNMSRGACGNYLNYL
FT                   IKRGLIERVGVGVYRVTDAGKQLVESDYTMVKIAKLVEENLVSKYGIIIPSDAEALEAF
FT                   IVEFEARPRIDPERLIDDLGWLGPESGIVDIGEFDEESFREAARASNGWSKVHYINGNS
FT                   HFFNIFDPPGYNVIVRIDGGGSSLGIWTAVIGPHEFFKPYSPSMLIRLAASYSIYYIHL
FT                   IDAMVRVKQNSRLLVKSIMTLRADSMGNIKSIKYATVPSNYTVEELINSLIAQPEGD"
FT   gene            166345..167526
FT                   /locus_tag="Vdis_0172"
FT   CDS_pept        166345..167526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pis:Pisl_1929 hypothetical protein; SPTR:
FT                   A1RVU4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49585"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSR8"
FT                   /protein_id="ADN49585.1"
FT                   /translation="MAECTPRIREVRYWDEAWWEEGFKGIDEAYSRLRGLLDAVKEVEL
FT                   KLTGSDLSQLLRSQQMRDFTMKVILGGFRQECVNKTLNADDVKGCFNSNALARFYREVF
FT                   GIGLSNDDIAKFVNVAQYVGLEKAGEGLRIVSMRSYVMDTLNGILTSFINVYKVAGRQV
FT                   PNPMRYNVDKPEDLAQAFIDTTNALLKLLPLYNPFTFFIQSLDFTPKPYLRLMYCDKLF
FT                   SSDVTNLMAKYGIRLTTLLKPSISKELDEELAIIGHEENSLGRHLLATVWHIYELTYWL
FT                   KGKDYVKNIDDEFRKYVEKYSIYLDEFYRRLTGSGFEGVCSMMLDINIYYGSNINIYGR
FT                   SIFGRDVFSFSRRGCGEIRMSLSYSEFLELFSPLMFLGLIFRHPLSNEIFTVG"
FT   gene            167532..169388
FT                   /locus_tag="Vdis_0173"
FT   CDS_pept        167532..169388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pis:Pisl_1928 hypothetical protein; SPTR:
FT                   A1RVU3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49586"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSR9"
FT                   /protein_id="ADN49586.1"
FT                   /translation="MSIEVAVGEVDEGVVNVIYRLRGGEQVGVSGLPTSQGVLEYGFKV
FT                   HVAKPDLGLPKEPRLEITPLDSTTPSITPIGLRPGNPVEALFIIPSGLLMSVNINYETP
FT                   QLPQSSLLSPIPSLPAVNVEFVKEATVELVGLEDLLPKIRPVLSPQLGAVDVSFIEVGR
FT                   VGLNLDPSTSILPSGRPSMLNPVEVSFQQAMASMDISTTVPLTESQRQVNTTTLTEEEI
FT                   KTAQAVEEVYSAEEHPILGLGNVTPEKPVIILAHRPKEEKANYIEFLKRFLREVYRVRV
FT                   GGLPAPKHVSNPLDLRLLLPIEVGAGGRLFILDLTSELGSHPKFDTDLNRLRDRLRELF
FT                   SQGFGFIVLYGDEDSLRSIRGSLWREFNIWRPVDVSIMGEDVGLLKLLTHLMWGDVEGS
FT                   VRDEAGAGLDVVTVYLEDEFWRRLGEVARDFNVLVKVRPSSSPDEGGRESMTHYLTKAF
FT                   VVRHLIDELKREFMESGLGEDDAFKKALDCVETEYQYPLEKENIRLDIYVKQNCGSRLS
FT                   GLAVEVETLYGTGTVVHKLLETVESRVGAGVKGLWVVVPNPQAVIYLPLLLRLRNHVRS
FT                   KYGDIELYTLDIHNGKLVKLTEVAKKILNTVKEVSEKQKQQT"
FT   gene            complement(169617..170666)
FT                   /locus_tag="Vdis_0174"
FT   CDS_pept        complement(169617..170666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0174"
FT                   /product="transcriptional repressor, CopY family"
FT                   /note="KEGG: hya:HY04AAS1_0825 hypothetical protein; SPTR:
FT                   B4U8Q1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49587"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSS0"
FT                   /protein_id="ADN49587.1"
FT                   /translation="MVRKRAGVTSGLRAQEIDVLDYLSSKPSDYSASFKEIFEFLHKKY
FT                   SVKSKGTVGRLLERLVKADLIERSGKGIYKLKLSNYSAIKRTLYDINNQILNELSYFKP
FT                   VILPRDLGTLSGMDLLLSRFETNAQNTNKIINIINAIPRVINCKYLAREYHYNPYYHQN
FT                   NTEYFGLVILGEAFASSYENIELSEIEKHEELFNVLKQGGDGCRHDGSNLYIYSTTELK
FT                   VDSSIVKPVKFVTMVILNKGFRYMGVVSSATYGDEQLSDGTYESIIRLLIMISLVNTMK
FT                   FLSLFRLFSNNVIPRSMIYTESRKGFIHYIPFTQGYDLTKLINTIMKIENLEPSNVPNT
FT                   LLTLTKEPH"
FT   gene            170775..171650
FT                   /locus_tag="Vdis_0175"
FT   CDS_pept        170775..171650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sim:M1627_1524 hypothetical protein; SPTR:
FT                   C3N5Y1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49588"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSS1"
FT                   /protein_id="ADN49588.1"
FT                   /translation="MLVSQMGQVELEGVDEVPLKTGLEWVPEEGVEFKGRSGVDWHGGF
FT                   CEGMVYDVLAYYKPYTHNRDWGIYYVVPSIANDLERLIETMYHQGINEELIALTVAIYP
FT                   SLITIHEVCHHTLENVRRLMGLRNIYESHDEGLCEYTAFKLIEGSGIAHPYPLVALLNP
FT                   LTPMDIHFHGDHIHVITRFGDFVIPFPISIRWRWGVRYPLMVSGGDVRRALTILYKWWG
FT                   RGNDPIYRPRISNNYTAEFLRNYWLQLRGDLVPFMDHALTNKPVKESLWTKLNTDDKRI
FT                   SIITKCGDKA"
FT   gene            171647..175006
FT                   /locus_tag="Vdis_0176"
FT   CDS_pept        171647..175006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0176"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hbu:Hbut_0359 hypothetical protein; SPTR:
FT                   A2BJS0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49589"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSS2"
FT                   /protein_id="ADN49589.1"
FT                   /translation="MINNEETILKNGIEINNKMSKSLPCSPWIDYTKAHENIRNELENT
FT                   ITNYVIKQVKGIRTPVIVAPYGSGKTTLLRHLLCYSIGQGIPAIKINLLDFVSFLESQN
FT                   ISDINEDNLIGYISLFCTKAIEQTINCLQSSGQNCLSYVRSIIDEFSTININKDIAIEV
FT                   LSKFLKTKDQRCVLLIDEIEEGYEHLRKIVRFGTTPFRGIFDLVYQGLPRIFPILAFGP
FT                   SSIYSEIVSNAGSWRVVSYVIPMIMPTNITQRVTNLSPYISNLIWWIGKGRPGHVDKLL
FT                   QMKIHVEAQNALTNCQGILETDAVKNLQGTYVVGNIPYIDQAAYRRIETSLNNDERNLF
FT                   RILSVLVGPVPESMLSKCIDMNKIKYSKLPEYFIKSTQLIKVDDALNILKKVLLNLGYT
FT                   INDFARDILYALFYSWSDHDMMILDKRGLTELIGIAKDMAIEFYQNDLFNALSKLDLDA
FT                   LYTELLNSKRDSNEHYYALAPLTTLGAIYPPVLLMPLIGCCKEKSLDDLYRIFDKFTIK
FT                   DLLNLSDRLQEEIINYAHMRGMDNETIQNMNKYKVVFVLSKYIKNDEFIKQIKKLLTND
FT                   YIHGIVFIPLPYNEDPSSIVSSLRELWQDYIDVGLIDIMYPSARAILFLMGLIYNKYVR
FT                   CDVKYTDRELGMYDQFMRAIIELLKEIIINRLPSKRNKIAQAIVSSRTTEAIKEELENI
FT                   LSEGYNKVGSGKERYLLLLAGAEHRNILEQYLNTLIAKKSGKYASSTGIIEDVVKRFKE
FT                   LINTLHDHGIEIKHEVTSGFESFLDNAWDYYDDIRSRWDQIYDQIQSGDVFNKVLEVLN
FT                   DLYTISNLPKEAETRQLIEEEFNKITKKVIGNNENNIKSLITWIVLQKMLNKHPDKLPF
FT                   NDEEECKDSTEELSSSLSKLGDLDNIVSDIDKILNKIGKYIDNKSVGILNELEKIKEII
FT                   NNTKDSINEVSHYIEDCTNRLVALNTVEKMWFLEFIMRGWSSGRKRNKGLMANLLDNIS
FT                   SIIDDINSSLLNNLKTVLRNLNDIEADLEELKKLTASDNELSLGSVFAIADYGALIERY
FT                   RKDLEQVLLNSGTIPELAQKLSILKDAVNDLANTIKTIRRDNEVLALIKKIEYNINRLS
FT                   KEIQEIEGGEIS"
FT   gene            175003..176274
FT                   /locus_tag="Vdis_0177"
FT   CDS_pept        175003..176274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0177"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q4YRU3 Putative
FT                   uncharacterized protein (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49590"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSS3"
FT                   /protein_id="ADN49590.1"
FT                   /translation="MSISLSIKEYTNKLNSNYQQIKNSLKELNNILESLMELISLAKKL
FT                   RLKVPPFPSIEKIELDQNKLSNVINGLRNYSNNVILVIMNQLLPGLSNDINDCEIITDM
FT                   LNGTKNILKDFIDSVQDLWKYRNELKYLRQCIKGYCDLVTRVIHDGELKEEVKVLSEIF
FT                   SIKDKLNGISLPITKGLNQCIDNVINNVIKDCNLPSFNDIEKSLKNMLDLLTYFDNMIS
FT                   VVNGLRTLQYNEYSQQKGDYCPEIAKIFDDFMSTIKGLNLNELTLKCGTPEELIGLVKE
FT                   IEDKRDQYVKNIRDSQAQVMNYLNRFKKVLSNSELREEFENTHNSLEKITNQLITEISG
FT                   KSVEGENIRQILDELQNKLNSILQFICEKLIPGLGLKDEEFKVIVELIRKGGIADFKDL
FT                   SDVGRDIIIELCEKGILRCQVSLG"
FT   gene            176279..179206
FT                   /locus_tag="Vdis_0178"
FT   CDS_pept        176279..179206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0178"
FT                   /product="helicase domain protein"
FT                   /note="InterPro IPR014021:IPR001650:IPR014001:IPR011545;
FT                   KEGG: siy:YG5714_0561 helicase domain protein; PFAM:
FT                   helicase domain protein; DEAD/DEAH box helicase domain
FT                   protein; SMART: DEAD-like helicase ; helicase domain
FT                   protein; SPTR: C3NAU6 Helicase domain protein; PFAM:
FT                   Helicase conserved C-terminal domain; DEAD/DEAH box
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49591"
FT                   /db_xref="GOA:E1QSS4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSS4"
FT                   /protein_id="ADN49591.1"
FT                   /translation="MICYKFDKPLIPSVEELFRECGKDVNFMNNYIINSVLSYIERKEQ
FT                   DLVLGMQYNDWVIIDSSAKDEIKEQIINYITKFAIACNGTNRNKDYLKKVREEVDSNRV
FT                   VEKALCYLYAFGIYGDCISRYLLIKPPDGDEVPDYEIPGLDNEVVERAKDVFNKCVEKL
FT                   SKWREYWVRSRFIEIVRDLYLLKQRFPDKSVFESYMLIDRVFAYAYPRNLPLGVYTVSD
FT                   VCGDGTSTINLKKLTYSFFKSYHDYLIGAVNENIDEEFEEFWEIFCYFLRKAFSDRRFY
FT                   RFQIRGVETAIKKLLGIFNTSESRGAGKIDYLIIAAPTGSGKTEVMVLTVLIAALARKI
FT                   ILIRHGLDDEKNVPIALMVYPRRSLANDQVSRLIEYLSIINERLKNKLLLTINYTDIRD
FT                   KREYEDAINSVKVGAKPVPLQLKYGVLASLIKDGENYYVELRFLTCPRRFTSGSGSIYP
FT                   RFRVVRRGDRYEVDDSVVYCGDNALSFIALTKDRVRERLGDIHITIFETLRHNLFSRSF
FT                   ENLFGICRKAGDNKVVFDYPLIIVLDEIHTYTDIPGVRYTYMLRRVLNRIRYYSENCNG
FT                   DGLPGNLVIGMSATIPNAGEFLSKLFFSEDIEKNINDYLITVDDEETIPLGNEYFIITV
FT                   PTRGAPVDALTVSIQTIMNTFYNIPSIPIDSGYVKKGIVFLEEFNVLRRMKRELWNREQ
FT                   GAIYRVVEINNEEVAFGLQDLRNPRNRYFYEVTLEDYGDDAKVVDNIRRGKISRVISAR
FT                   SWLDGELWWGYMLDTIINYYPKNNLSDYVTTRFNRVVEYSSRKRGDLRRADIVVSTSSL
FT                   EVGVDYSDVVLIYQHGAPPNISSLIQRAGRGGRRLFENPLMRIIVGIQLSPDLPHQSWL
FT                   FEIFTRVKDLRKAIDYDKLFLPKASEEIMKQVLAELALEYYVLNNGKLTNNWECRLTGW
FT                   LKKNKENIINYSQWVFANVEKSRLNSFIDEIINYLDKNCRDQSGR"
FT   gene            179221..181965
FT                   /locus_tag="Vdis_0179"
FT   CDS_pept        179221..181965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0179"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mcp:MCAP_0860 hypothetical protein; SPTR:
FT                   Q2SR11 Membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49592"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSS5"
FT                   /protein_id="ADN49592.1"
FT                   /translation="MSTLQKIIESSKLLRNYIPDRLFAESNLPQVKVVLDGKVIAVEDA
FT                   SLVVSSSGYIPGKPTYRALPTTGTFIPLDNSRFDENIRPIITRISYNDRKLYEPSPGYP
FT                   SRYSIDEIEIPDEYKYLLYLLKEVLKTDYLPIEFYALSKINPLRFRCPASKKKRISLDN
FT                   THWLFFSRARTNVEVTNNISFSHSFYAYLDRSNSFPRFSIYNPQGLIKPIKQYNICGIL
FT                   DAEIYTVKNAFYGIYAVDVYAVLKGKYVVGDSKGGWCRYTIKSSDIKTPRDNTSSTSMY
FT                   CISTKNGCRYSNYFVKIFVDGDHNNWNPVILGYEIKNTRMLTLDIKDLIRKIASSIVNI
FT                   GEVEQGQDLKLDYEYKTLSTNTAVVNLLRHYLSHDLVITYYLTRLGFTKIDKYVNLSIL
FT                   INDLFLGNKLTVKLEKDDVKDLASDIINDFIKSFDKEIRQSWISLLRYVLSTVKGERLE
FT                   TYRIFRECKNNKNTQRYCIPHEEAENIWNNIEKRIEGILKNYSEIPSYFGVRTTYWYVG
FT                   AIIDIIKHTLSHHLIRTISTRYSVNPSKLIEYYYEMRGDAKVSIMERDSGGIGVLNVAF
FT                   ESWEKSDKELRERQVAIEDLILSLGKCLVGTPEDLLHFALLNDDIRERLCSGKDNDVRE
FT                   GIREIIRRLNIIVTPDEFEETIKLWKSIYEEADRLTRILRNGNNYLGNEPCKLLRAVHE
FT                   LRHELEKKMRRFPDMDELMAYMLENIDEYSILNDLLTKMLERGLRTSGRFREFLHELYG
FT                   TNDYVKRFIGGVNFILRSRIQDIDHLKELVRNSNDIVSKYGTKALEKITECVGKRRDGD
FT                   DTCKAVIHALKLLGRALRAVLMRISLLSCNGACGMCYVNTKSCSRFGAPFIQARTLDRR
FT                   VLKVLASELVRHMSDIVRDYYGVNKDVDVIVELGGEPRTLRCE"
FT   gene            182007..182732
FT                   /locus_tag="Vdis_0180"
FT   CDS_pept        182007..182732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0180"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001736; KEGG: pmx:PERMA_0491
FT                   hypothetical protein; SPTR: A3IFP4 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49593"
FT                   /db_xref="GOA:E1QSS6"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSS6"
FT                   /protein_id="ADN49593.1"
FT                   /translation="MSIEELMRRFLHESFGSKYIYIISPWITPFTLSSRFIHYPYVSSN
FT                   NVIDVLKALSNSGVGVKVLMRCIDDSMDIQLIRVLTNLVRERQIILNNEVKSFFRDRID
FT                   DFLNRANAMIDLARDLKDAVRFDLGADDKLLTWYRLHTKLYINDHSVIMGSANFTRGGI
FT                   LDDGNWECVSHFTKEENTEIYNYALRVAQHYFSISKGFSDCERRVVRIVNEFGGVVNEP
FT                   IYSIEDLIEYLERVRDSLY"
FT   gene            complement(182724..182972)
FT                   /locus_tag="Vdis_0181"
FT   CDS_pept        complement(182724..182972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0181"
FT                   /product="protein of unknown function DUF165"
FT                   /note="InterPro IPR003744; KEGG: cma:Cmaq_1915 hypothetical
FT                   protein; PFAM: protein of unknown function DUF165; SPTR:
FT                   A8MBJ9 Conserved hypothetical integral membrane protein;
FT                   PFAM: Uncharacterized ACR, YhhQ family COG1738"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49594"
FT                   /db_xref="GOA:E1QSS7"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSS7"
FT                   /protein_id="ADN49594.1"
FT                   /translation="MSRLRGGVLRRVGYSDPVSMLIDSLVFVPLAFYGTIPNNQLVLTA
FT                   LYQALGKVMLTPLTMTAVWINRHALRYGLIEQRRRSI"
FT   gene            complement(182994..183464)
FT                   /locus_tag="Vdis_0182"
FT   CDS_pept        complement(182994..183464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0182"
FT                   /product="protein of unknown function DUF165"
FT                   /note="InterPro IPR003744; KEGG: cma:Cmaq_1915 hypothetical
FT                   protein; PFAM: protein of unknown function DUF165; SPTR:
FT                   A8MBJ9 Conserved hypothetical integral membrane protein;
FT                   PFAM: Uncharacterized ACR, YhhQ family COG1738"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49595"
FT                   /db_xref="GOA:E1QSS8"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSS8"
FT                   /protein_id="ADN49595.1"
FT                   /translation="MVGVITMGAVLTALGLFYLSSVVTYFVTSSILWALYRLGRHDYLL
FT                   PISFMLYMLLLTTSQYLASKIGAIGPIMFPMGLITYSASVAILDYVTLRYGRGYGYAVV
FT                   RIAIITQLLIALLNYLVIEFPPAPIWKMQGAFAEVMTVNIRVVIASVVAFTT"
FT   gene            complement(183452..185299)
FT                   /locus_tag="Vdis_0183"
FT   CDS_pept        complement(183452..185299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0183"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR002616; KEGG: mae:Maeo_0227 hypothetical
FT                   protein; SPTR: A6UTJ7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49596"
FT                   /db_xref="GOA:E1QSS9"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSS9"
FT                   /protein_id="ADN49596.1"
FT                   /translation="MRRLKFILPDWDDIVDSGYDFISEKPSEGFKRDKYVNGARLWELV
FT                   GNVIDGVLVSISVITKTKLNGIRSAGGVRGFMRLPSSMQVIGDCGAWQYRYMDVPPYTI
FT                   SEVLQYYEALGVDYGVTLDHIPLFGDSQRRIEITINNAIKMLEAWRGGNYGFRLMASVQ
FT                   GLTIDDYVNNLERLYKVGYRHFAIGGLARRDTKFIDELVTRIREVVSKLGDVEKVHFLG
FT                   ITRLSVIPKLRKLSNYVGEVSFDSSTVLRIAWTRELGNYLTTDGKAYTAIRIVERDDEL
FT                   MRKLRLYDEGRITYDEVMSALRSYVARIGHTHYLPYYAALLRDMPWKKCDCGVCRSIGI
FT                   DVVIFRGNNRNRRRGFHNVYVFSKLLNRDELITKFTIPKLEVSTNGEGATALSSDLAVK
FT                   LRGARRVLIITNCTSSKTVNINEVQKALMKHSLRMPSFDIELEDRYREVLRGFIKPAGE
FT                   MYGGSFRAIKNLADELRRLGKVVDLYIISARYGLIREDYPIIPYEASLKGRDKEWIRNW
FT                   SRRMGVEDKLMRVVGNGYDLVIVALPREYAHAIEGVLNRLVHEENAVLILPKSAVGKVN
FT                   GVRAAIIIAGSLSARLRKIRELREIVESLAKSTLDQWLV"
FT   gene            185508..186164
FT                   /locus_tag="Vdis_0184"
FT   CDS_pept        185508..186164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0184"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: trq:TRQ2_1241 preprotein translocase subunit
FT                   SecA; SPTR: B5SEV7 Nadh-ubiquinone oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49597"
FT                   /db_xref="UniProtKB/TrEMBL:E1QST0"
FT                   /protein_id="ADN49597.1"
FT                   /translation="MRPFTLRGIYEFLNLLRSGGSIGGDRRLREFLRASLDLGFVSEVN
FT                   GTYVITERGSRFMSAMEVGDATTIHALLMDSLESYRRVYELVSRGVTKPSELIRLTGYN
FT                   AVVIDIVMRLIREVEALSPGSPLSKDLYARFEEVLLSKYRELSRRRWSRYVPITELVRE
FT                   VRNELNIPNRVVNAFLEEFIRRMGSKVVLTGAPGKGGRGSMEINGRRFTYIMIGD"
FT   gene            186167..187117
FT                   /locus_tag="Vdis_0185"
FT   CDS_pept        186167..187117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ton:TON_1600 hypothetical ATPase; SPTR: B6YUA5
FT                   Hypothetical ATPase; PFAM: Archaeal ATPase; Protein of
FT                   unknown function (DUF2791)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49598"
FT                   /db_xref="GOA:E1QST1"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QST1"
FT                   /protein_id="ADN49598.1"
FT                   /translation="MRTLLPIPSIEDAEHIFDPHGITEELTKYVNLVASGPSGAGVIIG
FT                   NYGFGKTHVMLHLMSIVRKRFTNSVIIYVNTPGQSILNVYRALMVGVLDGGLLDRAVNG
FT                   LGTPIRDLVLLLREGGDEARYARQWLLGDPAPQGFRAKYGLPSTRVNDELAVKFMVEVI
FT                   NALTGVGYGPVLIMLDEFEDVITIGPTRKLQYLSQLRVFIDNLPSKTLFMVSSTPAGWD
FT                   EIVNTYPALARRLSSFIIYLRPFNIDETRQFINEFTRWRGIKIPLSDELVRTIYEFTEG
FT                   NPGEVVKAVNLILMEFGGVGSLDIARVKELLSRHV"
FT   gene            187120..188034
FT                   /locus_tag="Vdis_0186"
FT   CDS_pept        187120..188034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0186"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR002616; KEGG: mtp:Mthe_1660
FT                   7-cyano-7-deazaguanine tRNA-ribosyltransferase; SPTR:
FT                   A3IZM8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49599"
FT                   /db_xref="GOA:E1QST2"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:E1QST2"
FT                   /protein_id="ADN49599.1"
FT                   /translation="MPRLYITWYAEPEDPHYWRFFRVGGITVSLKSLLKMPRWKFTRVL
FT                   SQGFRRFFNYDGPLLVDSMLTEVHAPRSNMHGDIPQSHVLYLQYLLGSDILIQRDYPLI
FT                   HVDDPGLRTKLFNRNLAMAEAALRFGDLVGKDVMLVVHGWNLNTYIKCAEYYRDLGVKY
FT                   VGIGSLVPHRSNTKFLINVVKGVREVLGSHVHMHLFGISTIELITQLGNYVDSVDVSTP
FT                   AIAGAKKELIVWDGSRLIRVKTTTVTGIKIMSELIERSSDELERKLLLGILNARSLRDK
FT                   NLHTMIYNAYIITKYWNSVIDKQ"
FT   gene            188080..188481
FT                   /locus_tag="Vdis_0187"
FT   CDS_pept        188080..188481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0187"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_0828 cytidine/deoxycytidylate
FT                   deaminase family protein, putative; SPTR: A0Q3R7
FT                   Cytidine/deoxycytidylate deaminase family protein,
FT                   pytative"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49600"
FT                   /db_xref="UniProtKB/TrEMBL:E1QST3"
FT                   /protein_id="ADN49600.1"
FT                   /translation="MGGIEDKVEKCLQGLCGEFIIRRVNCKDLGDIDHGVYIVISGSDY
FT                   VIGYSRDLKRRLRMYCLGQLDLRGVIRLLMGRLDNLPPGMLGKGDVIGRRSNLSKLIND
FT                   MMSNAQVLTVKCASMVDKELYIKLRDCLK"
FT   gene            complement(188493..188912)
FT                   /locus_tag="Vdis_0188"
FT   CDS_pept        complement(188493..188912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0188"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mfe:Mefer_1193 hypothetical protein; SPTR:
FT                   C7P8X0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49601"
FT                   /db_xref="UniProtKB/TrEMBL:E1QST4"
FT                   /protein_id="ADN49601.1"
FT                   /translation="MPSEVKDLCEKISKLEEKIDGLFSEYETSSLSEDELRKVFEEPLS
FT                   RYKEVVDELLRKLGVSDDRINIVNDALDMLIEDSGMITDPDPHDYWWSGWRFLASVIGM
FT                   LCGKQPYLGAGAPDEEFGEDYVKALWRLPCEVRGP"
FT   gene            complement(189183..189653)
FT                   /locus_tag="Vdis_0189"
FT   CDS_pept        complement(189183..189653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mei:Msip34_1395 hypothetical protein; SPTR:
FT                   C6XDL5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49602"
FT                   /db_xref="GOA:E1QST5"
FT                   /db_xref="UniProtKB/TrEMBL:E1QST5"
FT                   /protein_id="ADN49602.1"
FT                   /translation="MPGKVLVVGVVVAVVVIAIALILLMHPFASKPSVAYLTVNAPYAF
FT                   LRPLGSGQYELFYYDQQGNLHDLGTYNVSSTVLSEAVNEINSFNQQNAGTMINGQNFIP
FT                   LSYEVVIGNSTGVVKIPIQGDTILLDKVNPGYWTVLVTDQNDLTKIAYALPT"
FT   sig_peptide     complement(189549..189653)
FT                   /locus_tag="Vdis_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            189855..191141
FT                   /locus_tag="Vdis_0190"
FT   CDS_pept        189855..191141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0190"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="COGs: COG0422 Thiamine biosynthesis protein ThiC;
FT                   InterPro IPR002817; KEGG: pai:PAE0333 thiamine biosynthesis
FT                   protein ThiC; PFAM: thiamine biosynthesis protein ThiC;
FT                   SPTR: Q8ZZC0 Thiamine biosynthesis protein thiC; TIGRFAM:
FT                   thiamine biosynthesis protein ThiC; manually curated; PFAM:
FT                   ThiC family; TIGRFAM: thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49603"
FT                   /db_xref="GOA:E1QST6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:E1QST6"
FT                   /protein_id="ADN49603.1"
FT                   /translation="MNNYNIRVGLKVKAVAKHEGVEEVKLARRIASGKVILIRNVKLPD
FT                   KVSAVGLGLTTKVNVNIGTSSEVVNLEAELEKVKIANKWGDTLMDLSTGGDLDEIRRAI
FT                   IRESKLPVGTVPTYQAFIDSFKKKGGGAYFTEDELFDVIERHLRDGVAFMTIHAAVTRE
FT                   LAIKALRSDRVIPIVSRGGDMLIGWMLHNDAENPLYARWDYVLELFREYDATISIGDAL
FT                   RPGATADSHDEFHVAELIEAARLVKRTRKAGVQVMVEGPGHVPLNEIIWDVKLMKKLTD
FT                   GAPYYVLGPLPTDVAAPYDHIAGAIGAAIAGAAGADLLCYITPAEHLGLPTPRQVEEGV
FT                   IAFKIAAHVADTIKLGRRARAWDDEVSRFRGKLMWREMINRLIDPEKAWAVYTQYGEPK
FT                   VRGCTMCGGYCPMLMVMQQIKKVKGEVNG"
FT   gene            191134..191640
FT                   /locus_tag="Vdis_0191"
FT   CDS_pept        191134..191640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0191"
FT                   /product="putative 4Fe-4S ferredoxin protein"
FT                   /note="KEGG: hbu:Hbut_0290 putative 4Fe-4S ferredoxin
FT                   protein; SPTR: A2BJK1 Putative 4Fe-4S ferredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49604"
FT                   /db_xref="UniProtKB/TrEMBL:E1QST7"
FT                   /protein_id="ADN49604.1"
FT                   /translation="MGEAWLWSTWVKAGRLRNADVAIVAACLPFVNPKLYQEITRNKVV
FT                   LLACPEREHSALYGKIASMIRSSRPRSITVVSIDGSPHCALLHASVNEAEYILDEDIPR
FT                   RHYVVVDGEELREISPNAVRVARYLSIVEELIRKNPEALEELAKHSLEYRNSLARASKG
FT                   DAPRA"
FT   gene            complement(191718..192191)
FT                   /locus_tag="Vdis_0192"
FT   CDS_pept        complement(191718..192191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0192"
FT                   /product="PaREP1 family protein"
FT                   /note="InterPro IPR010268; KEGG: cma:Cmaq_1549 PaREP1
FT                   protein; PFAM: PaREP1 family protein; SPTR: A8M9F3 PaREP1
FT                   protein; PFAM: Archaeal PaREP1/PaREP8 family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49605"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:E1QST8"
FT                   /protein_id="ADN49605.1"
FT                   /translation="MSIPESLINEAMKRGIDIIDLISKALNLDPSERSKAHLELAERFL
FT                   RDGMELIDRDPVQASEKLYKAAEEAIKAMAVALGLDEARTAEAQGRWAATLLFDAVDSI
FT                   SSRLNNREIRLWWRAAWFLHVEGFHEARLRPRQVREDVEYVEDIVKLARSIVK"
FT   gene            complement(192258..193334)
FT                   /locus_tag="Vdis_0193"
FT   CDS_pept        complement(192258..193334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0193"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="COGs: COG0002 Acetylglutamate semialdehyde
FT                   dehydrogenase; InterPro
FT                   IPR016040:IPR000706:IPR000534:IPR012280; KEGG:
FT                   tne:Tneu_1837 N-acetyl-gamma-glutamyl-phosphate reductase;
FT                   PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   Semialdehyde dehydrogenase dimerisation region; PRIAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; SPTR: B1YB54
FT                   N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-
FT                   aminoadipyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase, dimerisation domain;
FT                   Semialdehyde dehydrogenase, NAD binding domain; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase, common form"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49606"
FT                   /db_xref="GOA:E1QST9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037535"
FT                   /db_xref="UniProtKB/TrEMBL:E1QST9"
FT                   /protein_id="ADN49606.1"
FT                   /translation="MVSGRYKACVVGASGVTGGELLRLLLNHPGIELACATSREFKGEY
FT                   VFRVHPNLRGRTSLTFSDSTIDNVLKRDVDVVFLALPHGQSIEWVPKLYEAGLTVIDLS
FT                   ADFRLKDPNAYVEWYGWEKPHPYPDLLKRAVYGLPELHREELRGAKLIAVPGCMATAAI
FT                   ISLAPVVKAGLVDTERIVVDAKISSSGAGAHAPRLDLHPFRTYVIRPYEVVHHRHTAEI
FT                   EQELSLLINRQVRVAFTPHAVDLVRGILTTAHTWLIKPVQEPDVWRAIRAMYGNEPFIR
FT                   IVKDRAGFQRYPDVKYVIGSNLVDVGFEIDNRLNRLVVLAAIDNLMKGASGQAVQAMNV
FT                   ALGFPETTALDQVPLYPV"
FT   gene            complement(193321..193995)
FT                   /locus_tag="Vdis_0194"
FT   CDS_pept        complement(193321..193995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pis:Pisl_0275 hypothetical protein; SPTR:
FT                   A1RR72 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49607"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSU0"
FT                   /protein_id="ADN49607.1"
FT                   /translation="MEQKIHSELVNRGFRVAIINTRDDEVRHRDGKAVLLLDDVFEAFV
FT                   ISGLFDDTLNPRDTYILAINRALLFRELSELGYPIPDLTIALNPNVVGKVIKGLGRAYL
FT                   ATPAPSLGLDGNVTTWEGGKSVAEHRMYMANPLARINMVIKAPDRVINAQVVGDECLNC
FT                   GDLRPWVLKISRDIKCLLCTYVIGAYGNEYLVLGIEPRVDLTMDLTDKVMSTIVRWYNG
FT                   EW"
FT   gene            complement(193968..194129)
FT                   /locus_tag="Vdis_0195"
FT   CDS_pept        complement(193968..194129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49608"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSU1"
FT                   /protein_id="ADN49608.1"
FT                   /translation="MLITPEIIKKIFKSLVITVSTGESSLKREPRLIKTSYSYSVNTAQ
FT                   WNRKYIVN"
FT   gene            194201..195019
FT                   /locus_tag="Vdis_0196"
FT   CDS_pept        194201..195019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0196"
FT                   /product="alpha-L-glutamate ligase, RimK family"
FT                   /note="COGs: COG0189 Glutathione synthase/Ribosomal protein
FT                   S6 modification enzyme (glutaminyl transferase);
FT                   InterProIPR011761:IPR016185:IPR004666:IPR013816:IPR 013651;
FT                   KEGG: pcl:Pcal_0115 alpha-L-glutamate ligase; PFAM: RimK
FT                   domain protein ATP-grasp; SPTR: A3MSD6 Alpha-L-glutamate
FT                   ligase, RimK family; TIGRFAM: alpha-L-glutamate ligase,
FT                   RimK family; PFAM: RimK-like ATP-grasp domain; TIGRFAM:
FT                   Lysine biosynthesis enzyme LysX; alpha-L-glutamate ligases,
FT                   RimK family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49609"
FT                   /db_xref="GOA:E1QSU2"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSU2"
FT                   /protein_id="ADN49609.1"
FT                   /translation="MLYDTMRVEERLILKELKDLGANVALINIDNISLSLNNSGDFGIV
FT                   LVRPMSHSKAGLVARILNIHGVRTINKGLAIENSWNKAIAISTLARAGIPTVPTRLILS
FT                   INAQGDGVSYPAIVKPIHGSWGRLVSLVGNAEDLAMIMRHKAVGDSYSRIAMIQPFIGD
FT                   GTDYRVFVIGDEVAASMVRKPGPGDWRSNVARGGIAHAVKLSADAYEIAIKAVKALDLD
FT                   YAGVDLLYSEEGGYMVNEVNAIPEFKGLMSVSGVNIARKIAEYVINTARR"
FT   gene            195027..196205
FT                   /locus_tag="Vdis_0197"
FT   CDS_pept        195027..196205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0197"
FT                   /product="Acetylornithine transaminase"
FT                   /EC_number="2.6.1.11"
FT                   /note="COGs: COG4992 Ornithine/acetylornithine
FT                   aminotransferase; InterPro IPR005814:IPR015424:IPR015421;
FT                   KEGG: cma:Cmaq_0767 aminotransferase class-III; PFAM:
FT                   aminotransferase class-III; PRIAM: Acetylornithine
FT                   transaminase; SPTR: A8MCU6 Aminotransferase class-III;
FT                   PFAM: Aminotransferase class-III; TIGRFAM: acetylornithine
FT                   and succinylornithine aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49610"
FT                   /db_xref="GOA:E1QSU3"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR037537"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSU3"
FT                   /protein_id="ADN49610.1"
FT                   /translation="MSNDLLRFEDEYLARYYSKKPINVVRGYMQYVWDSNNNKYLDMHT
FT                   GFGVAFLGHRNPRIINAIKDQLDRIITVPLTFYNEARAEFIREFMRIVPSSFGKVFLQN
FT                   SGTEAVEVALKIARKISKKAEFLAFLNSFHGRTMGSLSVTGNEKYRKAFEPMPYKVRFA
FT                   PFNAVDQVDKLVTEDLAAVIVEPIQGEGGVNPAKPEFLRALRQVTRERNVLLIFDEVQT
FT                   GFGRTGRVWAFENYGVEPDIFTAGKSIAGGLPIGVAVVRREFGDVFEPGEHGSTFAGNP
FT                   LVMAAAKAGVEVLINDNVPERVRAVGDRFMRVLEDELNGSKTVLRVKGMGLMLGVELRK
FT                   RADPYIDRLIGMGLLTSVAGGTTVRLLPPYCITDEDLDMAVRALKNALSDSS"
FT   gene            complement(196177..197556)
FT                   /locus_tag="Vdis_0198"
FT   CDS_pept        complement(196177..197556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0198"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="COGs: COG0119
FT                   Isopropylmalate/homocitrate/citramalate synthase; InterPro
FT                   IPR000891:IPR013785; KEGG: cma:Cmaq_1917 pyruvate
FT                   carboxyltransferase; PFAM: pyruvate carboxyltransferase;
FT                   SPTR: A8MBK1 Pyruvate carboxyltransferase; PFAM: HMGL-like"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49611"
FT                   /db_xref="GOA:E1QSU4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSU4"
FT                   /protein_id="ADN49611.1"
FT                   /translation="MVPIEAPTGQNPPLQGRDEPLMRLLRRENIDYEELENSILRQWPL
FT                   PPRLITDGVNIDPEPPSQLFITDTTFRDGQQAFYIYYSIGDAVRLFRLLADLDNGSGRI
FT                   IRSEFFLYTGRDRELVRTVRGLGLEWPRVIGWGRARVEDVRLVKEAGLDEMVMLMSISD
FT                   IHIRYKFNSTRDRVVAKYLEAAEYALKEGIRLRCSLEDVTRSDVIGFVIPFVEKLLKLS
FT                   ERYGVEITIKLPDTTGIGVPYPFAPLPYSIPKLVWVFRRVLGIPSEFLEFHGHGDYYMA
FT                   VPNAVAAWLYGASINNGTLLGIGERAGNVPIEALVIWYARIKGSFDGMNPRVISKIVEE
FT                   FRSLNYQVPRYQPLVGENAFTTAAGIHVDAQLRNPMTYLSMDPSIIGREARILIGPYSG
FT                   RSSIAYWLRRRGVEPTPELINAVYERVMRIYDDGLRREPLSDDELNKILSEVMMSQTMH
FT                   S"
FT   gene            complement(197625..198698)
FT                   /locus_tag="Vdis_0199"
FT   CDS_pept        complement(197625..198698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0199"
FT                   /product="N-acetyl-ornithine/N-acetyl-lysine deacetylase"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro IPR011650:IPR010175:IPR002933;
FT                   KEGG: pai:PAE2798 M20/M25/M40 family peptidase; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; SPTR:
FT                   Q8ZUG2 Acetyl-lysine deacetylase; TIGRFAM:
FT                   N-acetyl-ornithine/N-acetyl-lysine deacetylase; PFAM:
FT                   Peptidase family M20/M25/M40; Peptidase dimerisation
FT                   domain; TIGRFAM: N-acetyl-ornithine/N-acetyl-lysine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49612"
FT                   /db_xref="GOA:E1QSU5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010175"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSU5"
FT                   /protein_id="ADN49612.1"
FT                   /translation="MFSDEAKLKLLMEALNIYSPTGGEHELAEFLVELMTMNGFEAKID
FT                   EVGNVIAVKGSGEPVLWLHAHMDTVPGFIEVRREGSKVIGRGASDDKGPLMAMVIAFME
FT                   SELSRGTLVLTAVVHEEGDSLGTRHLMVSNHVPRPTGIIVGEPTGIDKVVTKYRGGTKL
FT                   EVSVRTKGGHASNPDLDSNSILIAMNVYRDLWNALMAGTSYENFLVTPTIMNCGEAENM
FT                   IPSNCRLILDVRIPPGRSCKDVENAINQLRTKYGEFVAINMRWCTEPVEVPVNNASARA
FT                   VSRAIIKVLGRGPTLARKWGTSDMNDLASLTRNIVAYGPGDGAFSHSLEEYVLIDDYLR
FT                   AIDIYKQAVVEFMNIYK"
FT   gene            complement(198701..199558)
FT                   /locus_tag="Vdis_0200"
FT   CDS_pept        complement(198701..199558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0200"
FT                   /product="lysine biosynthesis enzyme LysX"
FT                   /note="COGs: COG0189 Glutathione synthase/Ribosomal protein
FT                   S6 modification enzyme (glutaminyl transferase);
FT                   InterProIPR011761:IPR016185:IPR004666:IPR011870:IPR
FT                   013816:IPR013651; KEGG: pas:Pars_0291 lysine biosynthesis
FT                   enzyme LysX; PFAM: RimK domain protein ATP-grasp; SPTR:
FT                   A4WHN7 L-2-aminoadipate N-acetyltransferase; TIGRFAM:
FT                   lysine biosynthesis enzyme LysX; alpha-L-glutamate ligase,
FT                   RimK family; PFAM: RimK-like ATP-grasp domain; TIGRFAM:
FT                   Lysine biosynthesis enzyme LysX; alpha-L-glutamate ligases,
FT                   RimK family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49613"
FT                   /db_xref="GOA:E1QSU6"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011870"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSU6"
FT                   /protein_id="ADN49613.1"
FT                   /translation="MVLIEVVHFIYDAIRLDEKLLIREFDNLGINYRLVNAENLAFEFP
FT                   GTNEVATAFIRTVSQHRTQLLAQMYEVIGGRSINPYASIMIGNNKAITLAILNRLGIPI
FT                   PNTVVALSSESAIKALGVVGYPAIIKPVHGSWGRLVSLVGSNEDLTLLARHRSSMENPQ
FT                   YETYLVQEFIRKPGRDIRVTVVGDEAVAAIYRYAVGDDWRTNTARGGKAEAVRIDPELE
FT                   DISVKATKAIGAYYAGVDVVESDGGYKVLEVNTVPEFKNVQRVTGVNVARRIAELVMGI
FT                   VKRG"
FT   gene            complement(199569..199745)
FT                   /locus_tag="Vdis_0201"
FT   CDS_pept        complement(199569..199745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0201"
FT                   /product="putative lysine biosynthesis protein"
FT                   /note="KEGG: pcl:Pcal_0371 putative lysine biosynthesis
FT                   protein; SPTR: A3MT39 Putative lysine biosynthesis protein;
FT                   TIGRFAM: lysine biosynthesis protein LysW"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49614"
FT                   /db_xref="InterPro:IPR005906"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSU7"
FT                   /protein_id="ADN49614.1"
FT                   /translation="MPTKISCQVCGADIEIPDDVLDGELVSCPSCGQKYQVVIQNGLIQ
FT                   LKLIKVEEEDWGE"
FT   gene            complement(199837..200649)
FT                   /locus_tag="Vdis_0202"
FT   CDS_pept        complement(199837..200649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0202"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="COGs: COG0548 Acetylglutamate kinase; InterPro
FT                   IPR001048:IPR004662:IPR011148; KEGG: pcl:Pcal_0372
FT                   acetylglutamate/acetylaminoadipate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; PRIAM:
FT                   Acetylglutamate kinase; SPTR: A3MT40
FT                   Acetylglutamate/acetylaminoadipate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: Amino acid kinase family;
FT                   TIGRFAM: acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49615"
FT                   /db_xref="GOA:E1QSU8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037529"
FT                   /db_xref="UniProtKB/TrEMBL:E1QSU8"
FT                   /protein_id="ADN49615.1"
FT                   /translation="MLVIVKVGGSVIRKGVDTLIREIPELLNNGHRVVLIHGGGYFINE
FT                   LMERMGLKPKFVTSPSGVTSRYTDLETLRVYVMGMMYLNKELVSRLQGVGVNAIGLSGV
FT                   DGGLLRARRRESMIIIDERGRERVVDGGYTGKIEGANKDFIMRLLNDGFTPVIAPIAMD
FT                   IKTGGALNVDGDQALEVLSTSLTPNYAVILTDVDGVLINGKVINKVSAAEAQELFKSPE
FT                   VRGGMKRKVYTAAQLAGRGIYTIISNGVINRPITTAINGFGTHVLPQR"
FT   gene            complement(200731..201927)
FT                   /locus_tag="Vdis_0203"
FT   CDS_pept        complement(200731..201927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0203"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; InterPro IPR015424:IPR015421:IPR004839;
FT                   KEGG: cma:Cmaq_0643 aminotransferase class I and II; PFAM:
FT                   aminotransferase class I and II; SPTR: A8MCH7
FT                   Aminotransferase class I and II; PFAM: Aminotransferase
FT                   class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49616"
FT                   /db_xref="GOA:E1QT24"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT24"
FT                   /protein_id="ADN49616.1"
FT                   /translation="MRGFSQSIAFLRESPTRRIDAIRERLKREKRDIINLSAGQPGIPP
FT                   PIEVRSLLAKQLVEDNSMELYGYTPSQGIIELREAVSEDLKRLGGIDVNPDNIVIITGG
FT                   QEGMFATFMTILNPGDEVILLDPTYFGYKPIIEYFGGKIKRLGLSMENGFKIDIEKLKE
FT                   LITDKTKALVLVSPDNPTGNIIDRDTAKAIADLAVDKDFWIVSDEAYRTLIYEGEHTYI
FT                   YRYAPDHVISINTFSKDPGIPGWRLGFIYGPSDAIPKLKLAAEEMTYCPPVIAQKFVAA
FT                   YLRSEVRLKHLKYIIEEYRSRRDAAVKALREYLPESRFVVPRGSMFIFVDLSHYIRDSE
FT                   RFAEALLERYGVTVIPGTYFSDIYRSAIRISFVVESIERIRMGIERISNAINDLRGSL"
FT   gene            202059..203114
FT                   /locus_tag="Vdis_0204"
FT   CDS_pept        202059..203114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0204"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="COGs: COG0505 Carbamoylphosphate synthase small
FT                   subunit;
FT                   InterProIPR017926:IPR002474:IPR006274:IPR001317:IPR
FT                   011702:IPR006220:IPR000991; KEGG: cma:Cmaq_1295 carbamoyl
FT                   phosphate synthase small subunit; PFAM: Carbamoyl-phosphate
FT                   synthase small chain; glutamine amidotransferase class-I;
FT                   SPTR: A8M8Q3 Carbamoyl-phosphate synthase, small subunit;
FT                   TIGRFAM: carbamoyl-phosphate synthase, small subunit;
FT                   manually curated; PFAM: Carbamoyl-phosphate synthase small
FT                   chain, CPSase domain; Glutamine amidotransferase class-I;
FT                   TIGRFAM: carbamoyl-phosphate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49617"
FT                   /db_xref="GOA:E1QT25"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT25"
FT                   /protein_id="ADN49617.1"
FT                   /translation="MVLQDGSVYRGYAFGADNETVGEVVFTTANVGYPESLTDPSYRGQ
FT                   ILVFTSPLIGNYGTSPDQWESDAIQVSGAVIFDLTTPSHYTSIMSLDEWFRREGVPGIY
FT                   RVDTRALTVKLREVGVMMGAMANDVNRAMKLLRDAPRYDDIDFTRLVSPSAPIYYGDDD
FT                   KPCIGIIDCGVKMSIVRNLLSRGFRVVRYPCHMWRNALNDCDGILLSNGPGNPNLLTYL
FT                   SDVVTDVIRDRKPTLGICLGHQVIALGIGARIYKMRYGHRAINKPVLDLIRNKVYITTH
FT                   NHGYAVDPQSIRGSGFKVWAIQPDDNTVEGLIHERLPILTTQFHPESKPGPLDANWVFD
FT                   EFARMVLNHGR"
FT   gene            203104..206196
FT                   /locus_tag="Vdis_0205"
FT   CDS_pept        203104..206196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0205"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="COGs: COG0458 Carbamoylphosphate synthase large
FT                   subunit (split gene in MJ);
FT                   InterProIPR005479:IPR011761:IPR016185:IPR005480:IPR
FT                   006275:IPR005483:IPR013817:IPR013816:IPR005481; KEGG:
FT                   cma:Cmaq_1296 carbamoyl phosphate synthase large subunit;
FT                   PFAM: Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   Carbamoyl-phosphate synthetase large chain oligomerisation;
FT                   SPTR: A8M8Q4 Carbamoyl-phosphate synthase, large subunit;
FT                   TIGRFAM: carbamoyl-phosphate synthase, large subunit; PFAM:
FT                   Carbamoyl-phosphate synthase L chain, ATP binding domain;
FT                   Carbamoyl-phosphate synthetase large chain, oligomerisation
FT                   domain; Carbamoyl-phosphate synthase L chain, N-terminal
FT                   domain; TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49618"
FT                   /db_xref="GOA:E1QT26"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT26"
FT                   /protein_id="ADN49618.1"
FT                   /translation="MDVRKVLVIGSGPIKIAEAAEFDYSGIQALKAYKEEGLTTVLVNP
FT                   NVATVQTTRVFADRVYLVPIKPEFLEMVIERERPDAIACGFGGQTALSACINLNDLGIL
FT                   SKYGIKVLGTPIEGIRSALSRQLFKDLMNKHGIPVLPSKTTYSLNEALSAARELGYPVL
FT                   ARVSFNLGGAGAFVAHDDDELISKYHKALAMSEIKEVLIEKYIGGWKEIEFEVMRDQYG
FT                   ESVAVVCMENVDPMGVHTGDSVVVAPCLTLTNDEYQRARLISIGVANAINLVGECNVQV
FT                   AINPRGPEMYVIETNPRMSRSSALASKASGYPLAYIAAKLTLGYRLSELINRVTGKTVA
FT                   SFEPSLDYVVVKIPRWESDRFGVDEPLGPEMMSIGEVMGIGRTLEEAWQKAVRMLDIGE
FT                   PGLVGGRIYHEASIEEAVKMVRERKPYWFLYAAVLLREGFSIDEINEWTGVDKFFLYAI
FT                   KRVVDFYEGLRRGEQLPLEEAYVLGFSEEQLRRATGNDPARRLPVVKQIDTLAGEWPAA
FT                   TNYLYLTHGGEVDDYTGPGVDAVVTGAGVFRIGVSVEFDWSVVNTVLMLKRLGYRVGVL
FT                   NYNPETVSTDWDFADKLFFDQLTPETLRNILIKERPRFVVLWTGGQIGQRLYGKARSWL
FT                   TENVKILGTSPESVDLAEDRSKFSKLLDELGLDQPPWAYASTIEELIGLVERWLDYPVI
FT                   VRPSYVLGGTYMGIARNRQELLNYVNKATRISPEHPVVVSKFIGDGVEAEVDGVSDGNS
FT                   VIVVPVEHVEPPGVHSGDSTMVIPPRGVDYRLNDGWRIKMAEASLRIARALSIVGPFNI
FT                   QFIARDKLYVIEANVRASRSMPFTSKATGVNLMNLSVKAALSGLGMDREFMVLRPRRWW
FT                   VKASQFSWSRVRGSYPRLGPVMYSTGEVASSGRAFEEALLKAWLSTTPSRIPRRNALVY
FT                   TYDEQYVKPIDEIRNRLGRWLVVLDDTEEVRAMLKQGSVDILMTGGDTMDKDYVTRRLA
FT                   ADTATPIVLHPSLGLELTRAFEWLRGGGKYIIEELLEAELG"
FT   gene            complement(206193..207545)
FT                   /locus_tag="Vdis_0206"
FT   CDS_pept        complement(206193..207545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0206"
FT                   /product="Argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="COGs: COG0165 Argininosuccinate lyase; InterPro
FT                   IPR008948:IPR003031:IPR000362; KEGG: cma:Cmaq_0766
FT                   argininosuccinate lyase; PFAM: fumarate lyase; PRIAM:
FT                   Argininosuccinate lyase; SPTR: A8MCU5 Argininosuccinate
FT                   lyase; PFAM: Lyase; TIGRFAM: argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49619"
FT                   /db_xref="GOA:E1QT27"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT27"
FT                   /protein_id="ADN49619.1"
FT                   /translation="MYRRELLGPGSVDKVSYMSSIVDDAEIFRYVIIALIAHVNELERG
FT                   GIISGDVAGRIRDALRDVWRGGYDPGKLVGYEDVHEYIEAELIRRLGSIGGWIGIGRSR
FT                   NDHVATAIRLRLRRALLDLMLITLRLREVALNKAVEVYDKVIIGSTHRQPAQVTTLGHY
FT                   MLYLDDLSRDFLSELMHVYGLVNKSPLGSGPLAGTMVGIDRFREAVELGFDGVVDNTIY
FT                   ATGSRYFVISAASAIVNYLVEVGRFINNLEMWLMPQLNYVSADPSHLATSSIMPHKRNP
FT                   ATLEVFRARIGEAVGHLVAMYSILRPVESGYQLDLQELTRHMWSIVKIALEGLLIFMDF
FT                   INGIKVNEDGVKESLGKYVVTAAEYAEAVAMRERRPFRDVYNEVARELRSGVKVGLDVN
FT                   ESLMKPVHGSSNPRQVIDDARARLNEVSELMTKVNLMVSKLDEVENKLLTT"
FT   gene            complement(207672..207908)
FT                   /locus_tag="Vdis_0207"
FT   CDS_pept        complement(207672..207908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49620"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT28"
FT                   /protein_id="ADN49620.1"
FT                   /translation="MVNKLFSLIEYLVVNMVRFLSGSLYVNLMTTRLEFDTVIKRRKIR
FT                   EGYEIEYIMIPKALRGNKSLAGKEAHVIIEVKD"
FT   gene            208796..208969
FT                   /locus_tag="Vdis_0208"
FT   CDS_pept        208796..208969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0208"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_1221 C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49621"
FT                   /db_xref="GOA:E1QT29"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT29"
FT                   /protein_id="ADN49621.1"
FT                   /translation="MGRLGGIVPGRAFFWVWEVFISYLVLRNVEILKGKCGIMRIGSVI
FT                   IPMHGWLRLHRQ"
FT   gene            complement(209108..210211)
FT                   /locus_tag="Vdis_0209"
FT   CDS_pept        complement(209108..210211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0209"
FT                   /product="Methionine synthase vitamin-B12 independent"
FT                   /note="COGs: COG0620 Methionine synthase II
FT                   (cobalamin-independent); InterPro IPR002629; KEGG:
FT                   rxy:Rxyl_0933 methionine synthase (B12-independent); PFAM:
FT                   Methionine synthase vitamin-B12 independent; SPTR: Q1AXH8
FT                   Methionine synthase (B12-independent); PFAM:
FT                   Cobalamin-independent synthase, Catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49622"
FT                   /db_xref="GOA:E1QT30"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT30"
FT                   /protein_id="ADN49622.1"
FT                   /translation="MGFEEVRTTHVGSLPRPPNLSPQNLDRAIEDVVKMQVEIGLDEVN
FT                   DGEYRRQSFISDLTELPGFGVTELYWENSAGDRRFIPVILRTIGYDPSKPILAREVEGI
FT                   KRALEKIGVRRRIKVTILAPSFMARVYPDPDWMPAKPRELIDKYRQQVRQYYPTIDDYL
FT                   DDVKKIIINEVRAALDAGADVVQFDAPDILQFDVYGEYNPDKGRAKERVRRAVELNNEV
FT                   LSKLPTEHLEIHSCWGNFNNSQFNTLGHYDDALPELYDLKVGVLGPFEVFDGIRDFEEL
FT                   KYFKQYAVPRDKKLALGIVSVKSRNVEPVEVIRRRYEAALEVVNGDPNKLIVAPGCGFA
FT                   SSATNPVQTLESARRKLRNMVLAVKGQ"
FT   gene            complement(210314..210810)
FT                   /pseudo
FT                   /locus_tag="Vdis_0210"
FT   gene            complement(211030..212262)
FT                   /locus_tag="Vdis_0211"
FT   CDS_pept        complement(211030..212262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0211"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="COGs: COG0137 Argininosuccinate synthase; InterPro
FT                   IPR018223:IPR001518:IPR014729; KEGG: cma:Cmaq_0765
FT                   argininosuccinate synthase; PFAM: argininosuccinate
FT                   synthase; PRIAM: Argininosuccinate synthase; SPTR: A8MCU4
FT                   Argininosuccinate synthase; TIGRFAM: argininosuccinate
FT                   synthase; manually curated; PFAM: Arginosuccinate synthase;
FT                   TIGRFAM: argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49623"
FT                   /db_xref="GOA:E1QT31"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT31"
FT                   /protein_id="ADN49623.1"
FT                   /translation="MEPQGRRGFLKPVHRKPSKIALAYSGGLDTTVAIHWLREKFNAEV
FT                   ITVTVDVGQDDDFRDIEERAYKAGAIKHYTIDAKRDFAEGPVAMAIMANALYEDRYPLG
FT                   TALARPLIAEKVVEVAKREGCDAIAHGSTSKGNDQVRFNEALMALAPDLMIIEPAKIWG
FT                   MNRAEEVEYARKHGIPIPSVHSRFSIDDNLWSRSIEGREIDDPGVEVPEDAFKWTVPPE
FT                   KVSEPLMLEIEFREGLPIAINGEKMDLVNLILLLNKVVGAHGFGRVDHVENRVVGFKSR
FT                   EVYEAPAALTLIETHKDLEKLVYTPLEYRFKRFVDQTWADLVYGGLWHEPLREELDTLI
FT                   RSMNRWVSGVVKVKVFGGLTILGRESPYASYNKDLVDYVSGWYPSEEEARGFIRMHVLH
FT                   SLTAYRARHKA"
FT   gene            212475..213575
FT                   /locus_tag="Vdis_0212"
FT   CDS_pept        212475..213575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0212"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="COGs: COG0082 Chorismate synthase; InterPro
FT                   IPR020541:IPR000453; KEGG: cma:Cmaq_0530 chorismate
FT                   synthase; PFAM: chorismate synthase; PRIAM: Chorismate
FT                   synthase; SPTR: A8MC69 Chorismate synthase; TIGRFAM:
FT                   chorismate synthase; PFAM: Chorismate synthase; TIGRFAM:
FT                   chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49624"
FT                   /db_xref="GOA:E1QT32"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT32"
FT                   /protein_id="ADN49624.1"
FT                   /translation="MGSVFGHVFRVVTFGESHGPAIGVVVDGVPAGVAIDESFIKRELE
FT                   RRRFCHLPILNPRCEDEEFQILSGVKDGFTEGTPIAVVIWNKRAISDYYNELWMKPRPG
FT                   HADLAYYLKFGRFYDHRGGGRASGRETVARIVAGAIAKTVLKQTIGVEVSSHLVELGGV
FT                   AISREDYTFEDVVKSWEKPLPMVDDEAMKRAIDVLINAVKDGDSVGGIGEVLTTEVPPG
FT                   LGEPVFDKLKADLAKAVMSIGSAVGVEFGLGFRLARMRGSEANDQIVLRGGRPRLETNR
FT                   IGGILGGMSIGEPIRFRVAFKPTPSIRKPQRTVDLERMIETTITFRGRYDVSTAPKAIL
FT                   AAEAMTAIVLVDHAMRAGLIPRVVKR"
FT   gene            213618..214739
FT                   /locus_tag="Vdis_0213"
FT   CDS_pept        213618..214739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0213"
FT                   /product="ATPase"
FT                   /note="COGs: COG1672 ATPase (AAA+ superfamily); InterPro
FT                   IPR011579; KEGG: sid:M164_1017 ATPase; PFAM: ATPase; SPTR:
FT                   C4KGB0 ATPase; manually curated; PFAM: Archaeal ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49625"
FT                   /db_xref="GOA:E1QT33"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT33"
FT                   /protein_id="ADN49625.1"
FT                   /translation="MLFDIRVKESLRDLFDRDDEIEKLRASLNEPLVVVFGLRRVGKSS
FT                   LIKAVLNEYAPSNYFYIDLRRFEESGYVSYRDFVKALEDSINARVRSRRLLSMLSRIRG
FT                   VSISGFRVSFSWGRDRVMLADILDSINDWAGDEGLRAIIVLDEAQELVKARGFNVLPVL
FT                   AYAYDNLRNLTFIITGSEFRVFTKFLKLNDPESPLFGRAYVSITLKPFNEEQAVEFLRR
FT                   GFKEHGIEFDRAEEVYEELGGNPGWLTLFGYRALRMGFNEALNETRREAVDLIRREICN
FT                   FINEGRHLAERRYLRILEVCVSGCRWSTIKMALEAMEGRELNNSIVDSLIKALLDYSLL
FT                   IKEGNTYVLPDKLMRDAVIGLRCFVNAVNSDNV"
FT   gene            214862..215866
FT                   /locus_tag="Vdis_0214"
FT   CDS_pept        214862..215866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0214"
FT                   /product="Chorismate mutase, type II"
FT                   /note="COGs: COG0287 Prephenate dehydrogenase; InterPro
FT                   IPR002701:IPR020822:IPR016040:IPR003099; KEGG:
FT                   cma:Cmaq_0808 chorismate mutase; PFAM: Chorismate mutase,
FT                   type II; Prephenate dehydrogenase; SPTR: A8MCY7 Chorismate
FT                   mutase; PFAM: Prephenate dehydrogenase; Chorismate mutase
FT                   type II"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49626"
FT                   /db_xref="GOA:E1QT34"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT34"
FT                   /protein_id="ADN49626.1"
FT                   /translation="MLSELRRSIDNIDEELIKLIGERIRLATEIGKVKRSLGLPVIDRD
FT                   REGEVIAKWVEGLSRFGVDAETAIGIAQSIIRASTRAQLVGRLGIGVTIIGSGRVGRTL
FT                   AKALGRVADVVLQRHDEELVPNDVIILAMKPTDESINILSRYSGRLRGSIVMDSFSVKT
FT                   PMFRLIEDESLRAGFHYISIHPLFGELSNPIGETVILIPSKTSGDKLEIAKDLFTGAGL
FT                   NVVVLSSPEEHDRFMAYLQVAHHVLLLTLYAALRRIGVDLNTQLVTHSLRYTFKALERV
FT                   LEQVEVSSELFRLNPYSRSVVGELGDLLKEVVEGLDKGDMTGVLGHDNQGIQG"
FT   gene            215841..216836
FT                   /locus_tag="Vdis_0215"
FT   CDS_pept        215841..216836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0215"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="COGs: COG2876 3-deoxy-D-arabino-heptulosonate
FT                   7-phosphate (DAHP) synthase; InterPro
FT                   IPR006268:IPR013785:IPR006218; KEGG: cma:Cmaq_0807
FT                   3-deoxy-7-phosphoheptulonate synthase; PFAM: DAHP
FT                   synthetase I/KDSA; PRIAM: 3-deoxy-7-phosphoheptulonate
FT                   synthase; SPTR: A8MCY6 Phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; PFAM: DAHP synthetase I family; TIGRFAM:
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49627"
FT                   /db_xref="GOA:E1QT35"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT35"
FT                   /protein_id="ADN49627.1"
FT                   /translation="MIIKVSRDKVDDIASLLDKAGAKFSVVRVYGEDLVVTWPDVKVDA
FT                   NAIKSVDPNAIIVEVKAKYQLASNAWRGRTIVDVSGVRIGGDEVVVAAGPCAVESYEQV
FT                   RDTAIAVKEAGAKLLRGGAFKPRTSPYSFQGLGVDGLKILRRVGDEVGLPVVSEVMDTR
FT                   MVKTAAEYVDMLQIGARNAQNFDLLKEVGKSGKPVLLKRGLGNTVEEWLQAAEYILLEG
FT                   NGNVVLCERGIRTFEHATRFTLDLGAVVAVKRLTHLPVCVDPSHPAGKRDLVIPLALAA
FT                   IAAGADMLLVEVHPRPWEALSDAEQQLTFEMFRELMIKGREVARAIGRSL"
FT   gene            216833..217879
FT                   /locus_tag="Vdis_0216"
FT   CDS_pept        216833..217879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0216"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="COGs: COG0337 3-dehydroquinate synthetase; InterPro
FT                   IPR016303:IPR002658; KEGG: cma:Cmaq_0806 3-dehydroquinate
FT                   synthase; PFAM: 3-dehydroquinate synthase; PRIAM:
FT                   3-dehydroquinate synthase; SPTR: A8MCY5 3-dehydroquinate
FT                   synthase; PFAM: 3-dehydroquinate synthase; TIGRFAM:
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49628"
FT                   /db_xref="GOA:E1QT36"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT36"
FT                   /protein_id="ADN49628.1"
FT                   /translation="MREFTYRSRDGDVKVLINIDHGEALERITKDYTGCVVYASGNIAN
FT                   RVKATCPVIPIVDGEEGKSIETALGIVRSAHEVGIDRDGLFIGVGGGSVLDVVGFSASI
FT                   YLRGVDYVNVPTTMLSMVDASLGGKTGVNALGLKNVIGVIRQPRYIIIDLSFLDSLPMP
FT                   NYLDGFAEVIKYGVTMDRELLNGVMGNADGLINRDRALLEDVIYKSLRDKASIVEVDEL
FT                   DKSGVRAVLNYGHTVGHAIESATNFSVSHGKAVALGMVCEARVGVRLGYTPRDVPNLLM
FT                   NALSMFNLINEVDVDVNKLVGAMLRDKKRSGDFIKLPVVIDVGRWDVVRVGIKELTELV
FT                   ISECRSMP"
FT   gene            217861..218670
FT                   /locus_tag="Vdis_0217"
FT   CDS_pept        217861..218670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0217"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="COGs: COG0169 Shikimate 5-dehydrogenase; InterPro
FT                   IPR016040:IPR011342:IPR013708:IPR006151; KEGG:
FT                   cma:Cmaq_0805 shikimate dehydrogenase substrate binding
FT                   subunit; PFAM: Shikimate dehydrogenase substrate binding
FT                   domain protein; Shikimate/quinate 5-dehydrogenase; SPTR:
FT                   A8MCY4 Shikimate dehydrogenase; TIGRFAM: shikimate
FT                   5-dehydrogenase; PFAM: Shikimate dehydrogenase substrate
FT                   binding domain; Shikimate / quinate 5-dehydrogenase;
FT                   TIGRFAM: shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49629"
FT                   /db_xref="GOA:E1QT37"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT37"
FT                   /protein_id="ADN49629.1"
FT                   /translation="MQVYAVIGYPLDYTLSPNIHNYVFRELGVDAVYVPLKVSPDRLGS
FT                   FVDFARDSLSGFNVTIPHKVAIVRLIDGVVGPARELGSVNTVVNRGGELLGYNTDYIAI
FT                   KQALSDRGYSGGDALIIGAGGVARAVALALRDLGCSRVYVMNRTVERGRELCSLINSWG
FT                   IDCVALDFQRNINIKARLLVNATPLGVNGDFPIDPGSTGAGLVLDLAYKPSGITGLIRL
FT                   ARERSIPYIDGLEILVRQAIEADRIWLGPFEEPTWYDVLEKLRDGLI"
FT   gene            complement(218680..219372)
FT                   /locus_tag="Vdis_0218"
FT   CDS_pept        complement(218680..219372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0218"
FT                   /product="3-dehydroquinate dehydratase, putative"
FT                   /note="COGs: COG0710 3-dehydroquinate dehydratase; InterPro
FT                   IPR013785; KEGG: cma:Cmaq_0674 3-dehydroquinate
FT                   dehydratase, putative; SPTR: A8MCK8 3-dehydroquinate
FT                   dehydratase, putative; PFAM: Type I 3-dehydroquinase;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49630"
FT                   /db_xref="GOA:E1QT38"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT38"
FT                   /protein_id="ADN49630.1"
FT                   /translation="MSTWDKLLASKPVLVCAVPLKKPSFYYLPTSCEAVELRLDYMDNL
FT                   GLTQEVKRVIEDYVSHYPTIVTVREREEGGGRAVSPEVKYGILEFSKGVGAVPDVEVDL
FT                   LVKYPDMYGDVAEGSILSRHVFSRDVSAYDLAVKDLDTARRFKALIYKVFSINDNDFLN
FT                   LLRLLNVSDINVAVIPRNPTYRAISIMMGSALMYCSVRGKTGPGQLSIGLCNKVKLLKN
FT                   SLSMFNRE"
FT   gene            219436..220260
FT                   /locus_tag="Vdis_0219"
FT   CDS_pept        219436..220260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0219"
FT                   /product="shikimate kinase"
FT                   /note="COGs: COG1685 shikimate kinase;
FT                   InterProIPR020568:IPR010189:IPR014721:IPR006204:IPR 013750;
FT                   KEGG: cma:Cmaq_1857 shikimate kinase; PFAM: GHMP kinase;
FT                   GHMP kinase domain protein; SPTR: A8MB45 Shikimate kinase;
FT                   TIGRFAM: shikimate kinase; PFAM: GHMP kinases N terminal
FT                   domain; TIGRFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49631"
FT                   /db_xref="GOA:E1QT39"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR010189"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT39"
FT                   /protein_id="ADN49631.1"
FT                   /translation="MGFTGMEYITYGGISIINAIPAWLGGAAAIDLKVRVRVREGYCGV
FT                   GDFVGFIINYLRSKLGLGYDVCVEVDSEVPPGSGLKSNSAVAVGVIYAVLNSFRGSVDP
FT                   VEVARLAAEVTRAHGSSITGAFDDASAALLGGVVLTDNKSLRVIRQLNPDPLTVVITGY
FT                   RVGKNLQGIDRLRALSGLYQALFNIALNGDLWRAATINGILVAESLGYHNALETIGIAL
FT                   RLGAVSSGVSGNGPAVYAVFKPGEEGPFIDYIRNTWGYYIVTRLVETRYLVS"
FT   gene            220329..222071
FT                   /locus_tag="Vdis_0220"
FT   CDS_pept        220329..222071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0220"
FT                   /product="Transketolase central region"
FT                   /note="COGs: COG3958 Transketolase C-terminal subunit;
FT                   InterProIPR009014:IPR015941:IPR005474:IPR005475:IPR 005476;
FT                   KEGG: cma:Cmaq_0809 transketolase central region; PFAM:
FT                   Transketolase central region; Transketolase domain protein;
FT                   SPTR: A8MCY8 Transketolase central region; PFAM:
FT                   Transketolase, thiamine diphosphate binding domain;
FT                   Transketolase, C-terminal domain; Transketolase, pyrimidine
FT                   binding domain; TIGRFAM: 1-deoxy-D-xylulose-5-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49632"
FT                   /db_xref="GOA:E1QT40"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT40"
FT                   /protein_id="ADN49632.1"
FT                   /translation="MSRNPYGISGLPMVINGSKTLIDVNRLVEVRDRARDLLIRLDREF
FT                   PYIHLGSSLAALDIINVLIRIMRRDGDCRDWFILSIGHVAPALYAILTVEGLIPAERLM
FT                   EINQLSSSISTHADNMDLPYIDATTGSLGQGLSMGVGLALANRVKGCNDGIVYVLMGDG
FT                   ELNEGQPWEAAMTAVKYGLDNLVVIVSLNGYQLDGPVGTIKPINYARVFEAIGWNVLYG
FT                   NGHDYEDIVRLINKAREVRGKPTVVFLSTVRGRGVKNLENTGKQTLNPPPRPQFSMREA
FT                   LGTALARLGEDNDKLVVVTADVGESTRARYFGERFPDRYFNVGISEQDLIGVAVGLALG
FT                   GYVPVAMAYAMFMMRGWEQIRNSLGRMNLNVKLIATHAGLSDFADGPSHQALEDVALMR
FT                   TLSNMVVVAPADAWDVERIIPKVIEYKGPVYVRVGRDHSPPITMDMDYEFKIGEVYELI
FT                   DGDDVVVMGYGPPLYNAVRAALELRRMGIRMGVYNVPTIKPINTDAVVRIARRVGNIIV
FT                   VEEHSPRGGLGSAIAELVSGFARVKILGVDGYGHWGRSEEELLRFYGLDEESIMDAALK
FT                   LINS"
FT   gene            222114..223403
FT                   /locus_tag="Vdis_0221"
FT   CDS_pept        222114..223403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0221"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="COGs: COG0128 5-enolpyruvylshikimate-3-phosphate
FT                   synthase; InterPro IPR013792:IPR006264:IPR016228:IPR001986;
FT                   KEGG: mja:MJ0502 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); PRIAM:
FT                   3-phosphoshikimate 1-carboxyvinyltransferase; SPTR: Q57925
FT                   Probable 3-phosphoshikimate 1-carboxyvinyltransferase;
FT                   TIGRFAM: 3-phosphoshikimate 1-carboxyvinyltransferase;
FT                   PFAM: EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase); TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49633"
FT                   /db_xref="GOA:E1QT41"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT41"
FT                   /protein_id="ADN49633.1"
FT                   /translation="MGKLIVNGFKAREGVVEAPPSKALTLRYLLASALSRTWVSLRKLN
FT                   WGDDTWSMIRGVKPISEIEVRDDYVRTRRGMMVERFRVIDVGESGFTLRVLTGVYSGID
FT                   GTTLLIPRGSLIGRPMDELLGALKNLGAKVDRLGSIIRVVGSKLVGGYVMISGSVSSQY
FT                   ISALLYLAPLTEGGIEVSIKPPIKSRPYIDATISVLRDFGINAERSDDTIYVSGSQEFR
FT                   AVNEEFIVPGDYSLAAYYIALSVLTGIDLRIMNLHRDRAIESEYSFIKYAKEIGVEIEE
FT                   YEDSVMVKGSSTKSLRPLNADLSDSPDIVMPLALLLTRVQGRSRILGVSHLVYKESNRL
FT                   RGVAAVLKCLGAGVSVDEANGIIEIEGTHEIKGGCEIDALNDHRIVMMGVIGALSAREP
FT                   VEIINWEGVSKSWPTFIWDLERLGADIKLA"
FT   gene            223516..223959
FT                   /locus_tag="Vdis_0222"
FT   CDS_pept        223516..223959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0222"
FT                   /product="Pyruvate/ketoisovalerate oxidoreductase"
FT                   /note="InterPro IPR002869:IPR019752; KEGG: cma:Cmaq_1863
FT                   pyruvate/ketoisovalerate oxidoreductase, gamma subunit;
FT                   PFAM: Pyruvate/ketoisovalerate oxidoreductase; SPTR: A8MB51
FT                   Pyruvate/ketoisovalerate oxidoreductase, gamma subunit;
FT                   PFAM: Pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49634"
FT                   /db_xref="GOA:E1QT42"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT42"
FT                   /protein_id="ADN49634.1"
FT                   /translation="MSEVREIIFYGKSGDGVHAVADQLVQRLIKQGFYVISYPEYDPER
FT                   RETLAKIHVRVSREPIHVRGPVMNPEIAVFFDVRLLRDNQEALGARKIIVNSPSRELVT
FT                   KYVGNVNGEIISINLNELRRTGADYTTQVVNLIIDTLLNGYTR"
FT   gene            complement(223936..224679)
FT                   /locus_tag="Vdis_0223"
FT   CDS_pept        complement(223936..224679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0223"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="COGs: COG0134 Indole-3-glycerol phosphate synthase;
FT                   InterPro IPR001468:IPR011060:IPR013785:IPR013798; KEGG:
FT                   cma:Cmaq_0131 indole-3-glycerol-phosphate synthase; PFAM:
FT                   Indole-3-glycerol phosphate synthase; PRIAM:
FT                   Indole-3-glycerol-phosphate synthase; SPTR: A8MA49
FT                   Indole-3-glycerol-phosphate synthase; PFAM:
FT                   Indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49635"
FT                   /db_xref="GOA:E1QT43"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT43"
FT                   /protein_id="ADN49635.1"
FT                   /translation="MDFLSAIGELTRRRVEALKAGIRAPSMVRAIEKRNSEGYLALIAE
FT                   YKRASPSGVIRLDLDPWTYFNAVGRYATGFSVLVEPIYFLGSPEFIKIALTYGKPVLYK
FT                   DFVISREQIEEAGRLGVSSVLLIKRLLGDALWDLVDYAINLGLEPLIEVDNEVDALDVV
FT                   SKDPDVMLGINSRDLSDLSVSLDRAVSIIRAVRGKANIIVAESGVKTVNDALRLAREGA
FT                   NAVLVGTALMRSVELARDLSSVAIK"
FT   sig_peptide     complement(224590..224679)
FT                   /locus_tag="Vdis_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            224838..225557
FT                   /locus_tag="Vdis_0224"
FT   CDS_pept        224838..225557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0224"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /note="COGs: COG0159 Tryptophan synthase alpha chain;
FT                   InterPro IPR011060:IPR002028:IPR013785; KEGG: cma:Cmaq_1047
FT                   tryptophan synthase subunit alpha; PFAM: tryptophan
FT                   synthase alpha chain; SPTR: A8MDM0 Tryptophan synthase
FT                   alpha chain; TIGRFAM: tryptophan synthase, alpha subunit;
FT                   PFAM: Tryptophan synthase alpha chain; TIGRFAM: tryptophan
FT                   synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49636"
FT                   /db_xref="GOA:E1QT44"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT44"
FT                   /protein_id="ADN49636.1"
FT                   /translation="MVIRKPGLGAYITATYPSKEAFLNAVKCLSNVSDFLEIGIPTQNP
FT                   KYDGPVIRKTHFASELKGLDAVKVARYGDVPTILMGYIEDYVSNMELVAETANEVGASS
FT                   VLFPDLLFEHIDLLESYLGVMRDYSLRPTFFVSSNTPHRLIASLVKYEPLFIYLGLYAA
FT                   TGIKLPLYIERNVREVRKLVDDVTLIAGFAINTPEMVRLVINAGADAVVVGTALVDKLN
FT                   DQRACTEFMMKLRGGLP"
FT   gene            225554..226795
FT                   /locus_tag="Vdis_0225"
FT   CDS_pept        225554..226795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0225"
FT                   /product="pyridoxal-phosphate dependent TrpB-like enzyme"
FT                   /note="COGs: COG1350 alternative tryptophan synthase
FT                   beta-subunit (paralog of TrpB); InterPro
FT                   IPR006653:IPR001926:IPR006316; KEGG: cma:Cmaq_1046
FT                   tryptophan synthase subunit beta; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   SPTR: A8MDL9 Pyridoxal-phosphate dependent TrpB-like
FT                   enzyme; TIGRFAM: pyridoxal-phosphate dependent TrpB-like
FT                   enzyme; PFAM: Pyridoxal-phosphate dependent enzyme;
FT                   TIGRFAM: pyridoxal-phosphate dependent TrpB-like enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49637"
FT                   /db_xref="GOA:E1QT45"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006316"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT45"
FT                   /protein_id="ADN49637.1"
FT                   /translation="MMIPHYWYNINVDLPKPLPPPIDPYEADSRIALLMRILPSELIDQ
FT                   EFTPLRYVPIPDEVRELYERMGRPTPFRRAYGLERALGNGVRIYYKFEGALPTGSHKLN
FT                   TAIPQVYYALKDGAREVVTETGAGQWGLAVSLAAALLGVKATVFMTRNSYFNKTQRVLF
FT                   MRTYGAEVYPSPSELTKYGREALRVRPDHPGSLGLAITEAIEFTLMGEGRKYIPGSVLG
FT                   FVILHQTVIGQEVLQQMPEEPDLVIGCVGGGSNFSGFSFPMIGAKLRGEGFEKTRFLAV
FT                   ESKAAPKLTSGRYMYDFPDTGGLLPMVKMLTLGHDYVPPPTHAAGLRYHGAAPALSLLV
FT                   REGIVEARAYGQEEVMEAARLFARTEGIIPAPESAHAIRAVIDEAKRMPKGSVIFFNLS
FT                   GHGLLDVDAYSNVR"
FT   gene            226795..227805
FT                   /locus_tag="Vdis_0226"
FT   CDS_pept        226795..227805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0226"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="COGs: COG0547 Anthranilate
FT                   phosphoribosyltransferase; InterPro
FT                   IPR000312:IPR017459:IPR005940; KEGG: cma:Cmaq_1045
FT                   anthranilate phosphoribosyltransferase; PFAM: glycosyl
FT                   transferase family 3; Glycosyl transferase, family 3-like;
FT                   PRIAM: Anthranilate phosphoribosyltransferase; SPTR: A8MDL8
FT                   Anthranilate phosphoribosyltransferase; TIGRFAM:
FT                   anthranilate phosphoribosyltransferase; PFAM: Glycosyl
FT                   transferase family, a/b domain; Glycosyl transferase
FT                   family, helical bundle domain; TIGRFAM: anthranilate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49638"
FT                   /db_xref="GOA:E1QT46"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT46"
FT                   /protein_id="ADN49638.1"
FT                   /translation="MTMKEILEKIARGLALSVDEAYEVAKGMLTSIDEALSAAVLMGLR
FT                   VRGEASSEIAGFAKALRDFCVKIPIDDRGKYVDTAGTGGDGFGTLNVSTAAALVAAYLG
FT                   ARVIKHGNRSVSSTSGSADFLEALGFNINLPPNKAAEMAIKYRFTFAFAPAYHPAMKNV
FT                   MPVRKKLGIRTIFNLIGPLANPALLTRQLIGVADSSLMDRMAEAALMLGYEHAVLVHGE
FT                   PGIDEVSVFGKTMVIEVRGNNVDKYFIEPRDLGLGTHRIDEVRVSSPLSSIEKVKRAIS
FT                   GEDEAARDFIIANAAFTLYVAGMVRDPRDGVEYVRSHLDNGFWDYVNELARVSRS"
FT   gene            227802..228446
FT                   /locus_tag="Vdis_0227"
FT   CDS_pept        227802..228446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0227"
FT                   /product="N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI)"
FT                   /note="COGs: COG0135 Phosphoribosylanthranilate isomerase;
FT                   InterPro IPR011060:IPR013785:IPR001240; KEGG: cma:Cmaq_1044
FT                   N-(5'phosphoribosyl)anthranilate isomerase (PRAI); PFAM:
FT                   N-(5'phosphoribosyl)anthranilate isomerase (PRAI); SPTR:
FT                   A8MDL7 N-(5'-phosphoribosyl)anthranilate isomerase; PFAM:
FT                   N-(5'phosphoribosyl)anthranilate (PRA) isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49639"
FT                   /db_xref="GOA:E1QT47"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT47"
FT                   /protein_id="ADN49639.1"
FT                   /translation="MTLLKICGVTNVRDAVMVSGYADYVGVIVHSRVPTPRLVNGETAR
FT                   EMIRSVRGVRVVGVVEGLELIDAAKLVSDLGFDVLQYHGDFEPSGEVMDLFNDLGIKLA
FT                   PVLTYVGDKSIIDRAAKLSLINYVEYVLIDAPKTNFTKYEHGLKLPLDVIREASAIPRV
FT                   GVAGGINPGNVSLVMRYRPFLIDVSSGVEKSPGIKDEELVRRVAEVVRGVR"
FT   gene            228436..229698
FT                   /locus_tag="Vdis_0228"
FT   CDS_pept        228436..229698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0228"
FT                   /product="Anthranilate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="COGs: COG0147 Anthranilate/para-aminobenzoate
FT                   synthase component I; InterPro
FT                   IPR005801:IPR019999:IPR006805:IPR015890; KEGG:
FT                   cma:Cmaq_1043 anthranilate synthase; PFAM: Chorismate
FT                   binding-like; Anthranilate synthase component I domain
FT                   protein; PRIAM: Anthranilate synthase; SPTR: A8MDL6
FT                   Anthranilate synthase; PFAM: chorismate binding enzyme;
FT                   Anthranilate synthase component I, N terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49640"
FT                   /db_xref="GOA:E1QT48"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT48"
FT                   /protein_id="ADN49640.1"
FT                   /translation="MSVRKIPIQYLPKPRELTNYLLKSGEDFVTLLESGPGFPERSRYT
FT                   IVAWGVTEHLVVDWDGDLYGELKGLVSKLGRFESGDIALGYLSYEAVAYMEPYLRSYLR
FT                   KPQWPVAEFVIPSNVVIYDNLLGRGYVKGELPSNASVDLDDFEVVSKVGGTRKEDFIRW
FT                   VESSLEDIRNGEIFQIVLSRYEDYSVRGDVMNLYMRLADLNPSPYMYITKFGDKYIVGT
FT                   SPELLVKVDGDRVETHPIAGTRPRGKDPIDDLRLEEELINSIKDKAEHVMLVDLARNDI
FT                   GRVCRFGTVRVKELYAIEKYQSVQHLVSRVEGVLERGNDIVDALFATFPAGTVSGAPKP
FT                   RAMELIAKYEGTARGPYAGAIGLMHGSGGEFAIIIRTLFLMGGVARIQAGAGIVYDSVP
FT                   ELEFQETEHKLGSLKTAMGVV"
FT   gene            229695..230279
FT                   /locus_tag="Vdis_0229"
FT   CDS_pept        229695..230279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0229"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="COGs: COG0512 Anthranilate/para-aminobenzoate
FT                   synthase component II;
FT                   InterProIPR017926:IPR006221:IPR006220:IPR011702:IPR
FT                   001317:IPR000991; KEGG: cma:Cmaq_1042 anthranilate synthase
FT                   component II; PFAM: glutamine amidotransferase class-I;
FT                   SPTR: A8MDL5 Glutamine amidotransferase of anthranilate
FT                   synthase; TIGRFAM: glutamine amidotransferase of
FT                   anthranilate synthase; PFAM: Glutamine amidotransferase
FT                   class-I; TIGRFAM: glutamine amidotransferase of
FT                   anthranilate synthase or aminodeoxychorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49641"
FT                   /db_xref="GOA:E1QT49"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT49"
FT                   /protein_id="ADN49641.1"
FT                   /translation="MMELVVIIDNYDSFTYNIAQYVGELGAKPLVFRNDEVTVKVIERL
FT                   RPNGIIISPGPGSPLNPRDIGISRDVIQRFKGRVPILGICLGHQVIGVTFGARIRRART
FT                   IKHGKTSMIRLMRPSPIFQGLPDRIEGMRYHSLVIDDIPSELIVTAISEDDNEVMAVQH
FT                   RDYPIFGVQFHPESVGTPMGKEILKNFLSLG"
FT   gene            230389..232824
FT                   /locus_tag="Vdis_0230"
FT   CDS_pept        230389..232824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0230"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="COGs: COG0574 Phosphoenolpyruvate synthase/pyruvate
FT                   phosphate dikinase;
FT                   InterProIPR018274:IPR000121:IPR015813:IPR008279:IPR
FT                   006319:IPR013815:IPR002192; KEGG: pis:Pisl_1888
FT                   phosphoenolpyruvate synthase; PFAM: pyruvate phosphate
FT                   dikinase PEP/pyruvate-binding; PEP-utilising protein mobile
FT                   region; PEP-utilizing protein; SPTR: A1RVQ3
FT                   Phosphoenolpyruvate synthase; TIGRFAM: phosphoenolpyruvate
FT                   synthase; PFAM: PEP-utilising enzyme, mobile domain;
FT                   PEP-utilising enzyme, TIM barrel domain; Pyruvate phosphate
FT                   dikinase, PEP/pyruvate binding domain; TIGRFAM:
FT                   phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49642"
FT                   /db_xref="GOA:E1QT50"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT50"
FT                   /protein_id="ADN49642.1"
FT                   /translation="MADYKFIVWLNEEVKDPSILGGKGANLNKLMLMGVPVPPGFVITT
FT                   EAFNYFMSVNGLRDRVLNIINEVVKEGRPEEYEEAERRIKGLILNTEIPRDLHEEITRA
FT                   YMELSKSFNTDALAVAVRSSASAEDLRTSSFAGQQDTYLNVRGVEDLIKYVKYVWASTY
FT                   NARALAYRDERDIPHDVAYMAVIVQKLVNSKAAGVLFTINPVTGDSNEVVIESSWGLGE
FT                   AVVGGMVTPDRWVVDKSRLVIKDRVVARKSVMMTRSESGLTKVVEVPSDLAEKPSLSDA
FT                   EVIALAKLGIELENRVGYPLDIEWVIDSDSGNIYVVQMRPETVYSSGKAKAINEGRATT
FT                   GKAVIKGIAASPGIAVGRVRICLTPEEARAKMGKGDILVTKMTNPDWVPYMKMASAIIT
FT                   DEGGMTSHAAIVSRELGIPAIVGTGNATSVLKDGEVYTVDAVHGVIYEGKVEELVSKAK
FT                   ATREVQVTTAPSTNEIILHIYRSIRTATGVYMNLGVPEKIDEYKDLPFDGIGLMRIEFV
FT                   LSSYIGDHPLYLISIGNEEKFINRLAEGVAYVAKAIYPRPVIVRFSDFKSNEYRQLTGG
FT                   EKFEPEERNPMLGWRGVSRYISKDYEKAFRLEVRAIKRVREEMNLNNVHVMVPFVRAPW
FT                   ELERFMQILNEEGLERDRDFKVYAMAEIPSIALLVEDFAKYVDGFSIGSNDLTQLIMGV
FT                   DRDNDILVRQNPRYFDEREPAVLRAMYEIIRRAHAMNKSVGICGQAPSVYPEITEFLVR
FT                   AGIDYVSVNPDAVITTRLLIDSIERKIILEELRELRRKLMPMEPDGEFHEILNKVFKG"
FT   gene            232880..233500
FT                   /locus_tag="Vdis_0231"
FT   CDS_pept        232880..233500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0231"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="InterPro IPR001123; KEGG: afu:AF1703 hypothetical
FT                   protein; PFAM: Lysine exporter protein (LYSE/YGGA); SPTR:
FT                   O28570 Putative uncharacterized protein; PFAM: LysE type
FT                   translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49643"
FT                   /db_xref="GOA:E1QT51"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT51"
FT                   /protein_id="ADN49643.1"
FT                   /translation="MLGPDFIIKVIVISASGALAPGPLTASAASLGARMGWRAGINEAI
FT                   GHMTVELPLVLAIAYGLHYIFQIPIISTAFGIVGGAFLLFFAYLTLRDALRGSFNVSDA
FT                   PRYSSAVVTGAALSLFNPYFIAWWIGVGTPLIMEAFQSMYLIGIGILYVSHVWLDYAWL
FT                   TLIASLGSVSRLKISAYRVLLMALAIAIAYFGISMIISMVKSL"
FT   sig_peptide     232880..232963
FT                   /locus_tag="Vdis_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            233539..234603
FT                   /locus_tag="Vdis_0232"
FT   CDS_pept        233539..234603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0232"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="COGs: COG2030 Acyl dehydratase; InterPro IPR002539;
FT                   KEGG: mse:Msed_1216 dehydratase; PFAM: MaoC domain protein
FT                   dehydratase; SPTR: A4YG25 MaoC domain protein dehydratase;
FT                   PFAM: MaoC like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49644"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT52"
FT                   /protein_id="ADN49644.1"
FT                   /translation="MIPMISAGYFGLFFEDFVVGSVVRHRPCRSVDFYDNVLWSSLTLD
FT                   YTPLYLDREYASHTDFGGIIINPRFLHSLVIGIATRDTSINTMAFLGIDYERLVRPVYP
FT                   GDTICVESEVVNKRESRSRPGMGIVTWVHRAYNQRGELVYEVRRSNLIYKRGESPWVKF
FT                   LRGEPVGRVEARPTAASRPIDYSSIQFTQLSHEPWLGRFLEDFRPGEVIVHRLGRTVYE
FT                   FDNVLSTVLSMNTATLHFDEEYMAYHDYGRPVVQGPFIVGLACGLSSMDLTMNIAADLG
FT                   ITELRLKSPVFHGDTLHAVSEVLSVEGSSDPRFGVITVRTRLYKDLMRVEVAEITRKIT
FT                   IYKKEHTPWRFIRR"
FT   gene            234724..235053
FT                   /locus_tag="Vdis_0233"
FT   CDS_pept        234724..235053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1899 hypothetical protein; SPTR:
FT                   A8MBI3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49645"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT53"
FT                   /protein_id="ADN49645.1"
FT                   /translation="MPSSKPVNGLPHKTKIYINNQVLLPAKLIKMLGIEWARYADITIK
FT                   HNDRIITLRRVALLRTRHTASRQFTIPKEIREKYGIMPLDDVEIISIRPIRIKEVDARQ
FT                   LILDE"
FT   gene            complement(235075..236391)
FT                   /locus_tag="Vdis_0234"
FT   CDS_pept        complement(235075..236391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0234"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /note="COGs: COG0044 Dihydroorotase and related cyclic
FT                   amidohydrolase; InterPro
FT                   IPR002195:IPR011059:IPR004722:IPR006680; KEGG:
FT                   cma:Cmaq_0784 amidohydrolase; PFAM: amidohydrolase; SPTR:
FT                   A8MCW3 Amidohydrolase; TIGRFAM: dihydroorotase,
FT                   multifunctional complex type; PFAM: Amidohydrolase family;
FT                   TIGRFAM: dihydroorotase, multifunctional complex type"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49646"
FT                   /db_xref="GOA:E1QT54"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT54"
FT                   /protein_id="ADN49646.1"
FT                   /translation="MGVSKVDVLIKARAYVRGGVREVYIGITGSEIAYIGNEPIEAGNK
FT                   LELPNQYLVLPGLVDVHVHFRDFDLSYKEDAISGTQAALAGGYTAVGEMPNTRPPIKTV
FT                   ELLRRKIEEFGKKTNLHIRHYFGAPQDPSLLKDALNNGAYAVGEVFPEEVLEYGGDQYL
FT                   ESLFREAARVGIPVIMHCEDPIIINQYSGPRGFEYHNAIRGPRAELACVHNVIRLVYRY
FT                   GTKVHITHITLPQSISMIRLSGLDITFDVTPHHMLLSQEECLARAEKPAYCKVNPPLRD
FT                   ETTRRELLAMFVRGEVPIVASDHAPHADWEKDKPYDEAPPGIVGLETTAPLLLTLWRRG
FT                   FVDLGTVMRAIQERPAKFLGLNVGIKQGSCADLTIINTKARHRIEPEKFRSKAKYSPFK
FT                   GFEVDVAVVATILHGKLAYISEGHIDDATRKLLESSLPH"
FT   gene            complement(236435..237199)
FT                   /locus_tag="Vdis_0235"
FT   CDS_pept        complement(236435..237199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0235"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="COGs: COG0396 ABC-type transport system involved in
FT                   Fe-S cluster assembly ATPase component; InterPro
FT                   IPR017871:IPR003439:IPR010230:IPR003593; KEGG:
FT                   cma:Cmaq_1841 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: A8MB29 ABC
FT                   transporter related; TIGRFAM: FeS assembly ATPase SufC;
FT                   PFAM: ABC transporter; TIGRFAM: FeS assembly ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49647"
FT                   /db_xref="GOA:E1QT55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT55"
FT                   /protein_id="ADN49647.1"
FT                   /translation="MTRLEVINLSVEVDGKRILNNVNLTVESGEVVAIMGPNGSGKTTL
FT                   FLTIAGHPRYNVVNGDIKLDGESILKLYPEERVQRGILLALQNPTPVPEVRLSTLITAM
FT                   LNKKAGKRITDPPPPQVVAEMTKLTTELGLKPEHLSRGVHAGFSGGESKRAEMLQLLMY
FT                   KPKVAMLDEPDSGLDVDGIAIIGRSIAKLAQEGTAILVTTHHAEILHYVKPTRVIVMAK
FT                   GSVIHVGGEEVVKMIESMGYERFFKEVVKLNV"
FT   gene            237321..238742
FT                   /locus_tag="Vdis_0236"
FT   CDS_pept        237321..238742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0236"
FT                   /product="FeS assembly protein SufB"
FT                   /note="COGs: COG0719 ABC-type transport system involved in
FT                   Fe-S cluster assembly permease component; InterPro
FT                   IPR010231:IPR000825; KEGG: cma:Cmaq_1078 FeS assembly
FT                   protein SufB; PFAM: SufBD protein; SPTR: A8MDQ1 FeS
FT                   assembly protein SufB; TIGRFAM: FeS assembly protein SufB;
FT                   PFAM: Uncharacterized protein family (UPF0051); TIGRFAM:
FT                   FeS assembly protein SufB"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49648"
FT                   /db_xref="GOA:E1QT56"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT56"
FT                   /protein_id="ADN49648.1"
FT                   /translation="MSRDGVKLEIVKTEEYSSLLGRARPIKWEVEIRGRITRDVIEEIS
FT                   RVRGEPDWMRRLRLRALEMFERQPWPNWLPLEGNVDLESLVLYAKPSVERARSWDELPR
FT                   ELREYYEALRIPELEARVLSGVIGQVDGGIVYESVKKDLEKAGVIAMSMDEAVKRYPDL
FT                   VKQYFARVFPPEYKFASLNIALWGGGVFVYVPPGVHVKMPIELVILISSAGVGQFEHSL
FT                   IIVGENANAEFIVACAAPVFTGLSLHDGMTEAYIHRGARVKLVDLKNWSKDVIYFGNNR
FT                   AILEENVSVDWLSGSLGGKVTIVYPMSVLKGVNSRTTVTSVALANGPTWKEEGAKVFHS
FT                   APHTYSKVVSKGVSLNGGTSVYRGLVYVREGAKYARSSVNCESLILDDKSKAYTIPHEQ
FT                   VFEETAIVTHEAYTGRIGEDKLFYLRSRGLSEEEARSLVVLGYFHDIMVNLPVEYVSIF
FT                   NKAIELELSRMGGVG"
FT   gene            238809..240242
FT                   /locus_tag="Vdis_0237"
FT   CDS_pept        238809..240242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0237"
FT                   /product="FeS assembly protein SufB"
FT                   /note="COGs: COG0719 ABC-type transport system involved in
FT                   Fe-S cluster assembly permease component; InterPro
FT                   IPR010231:IPR000825; KEGG: pcl:Pcal_0613 FeS assembly
FT                   protein SufB; PFAM: SufBD protein; SPTR: A3MTS3 FeS
FT                   assembly protein SufB; TIGRFAM: FeS assembly protein SufB;
FT                   PFAM: Uncharacterized protein family (UPF0051); TIGRFAM:
FT                   FeS assembly protein SufB"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49649"
FT                   /db_xref="GOA:E1QT57"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT57"
FT                   /protein_id="ADN49649.1"
FT                   /translation="MSNNSAESLKTVIERSSVEELLGPEMEFVPWEAVIKGRITKDMIE
FT                   EISRIKGEPDWMRRLRLRALEMFEKLPEPKWLPIKEEIDLESLVLYAKPSVERARSWDD
FT                   VPKEIRKYYEALGMPELEAKVLAGLLGQFDSEVVYLHVKKYLEEKGAVVTTMDEAVKKY
FT                   PDIVKQYFAKIFPPGEHKFAALHVALWSGGTFVYVPPGVKLDMPIESFFLIGSSGEGQF
FT                   EHSLIIADEGASVEWLEGCAAPVYRGFSFHDGMVEGYAARNAHLRINTIQNWSRNIINF
FT                   NNKRAVAMENSTVEWVEGSLGSKVSYTYPSTVLKGEGAKTSIIGVTIANGPFWKENGAK
FT                   AYHDAPRTSSKIVNKSVSINGGTVVYRGLVYVREGAKYAKSSVSCDSLILDDRSRAYTI
FT                   PHDQVFEETATVTHEAYTGRISEDKLFYLRSRGFDEGTARSLVVLGFIQDITVRLPTEY
FT                   AMTLNRVIELEFSKLSKVG"
FT   gene            240274..241476
FT                   /locus_tag="Vdis_0238"
FT   CDS_pept        240274..241476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0238"
FT                   /product="SufBD protein"
FT                   /note="COGs: COG0719 ABC-type transport system involved in
FT                   Fe-S cluster assembly permease component; InterPro
FT                   IPR000825; KEGG: cma:Cmaq_1839 SufBD protein; PFAM: SufBD
FT                   protein; SPTR: A8MB27 SufBD protein; PFAM: Uncharacterized
FT                   protein family (UPF0051)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49650"
FT                   /db_xref="GOA:E1QT58"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT58"
FT                   /protein_id="ADN49650.1"
FT                   /translation="MGKWLNELKLRARELAQKIPYQQIRDSPSVKYYTDWNAFERCADP
FT                   SPEDLSKYSAINIPYELNIASINGNVNITKVPSGITAISINDLGEELGKLLFKSIDISE
FT                   SKALARHVANLVNGVYIEVNEDLREPLRIGVVTSLLKQALLPMHYTILIGDGVNASLSL
FT                   FMLGLGGCPSTTVEIYLGRNSKLNVLFTSTHEQLPTYSLIKVVAGDESSITARTLIMGG
FT                   SMNHHREDYLLQGRRSSLNHLGLEVGYGVSRIDYQVNAMHTGEYGTSYSKVLGIARDKS
FT                   FIIHRALGRVTESAKWSDTNVEGKVFVMNEGAYAASVPIIMVDTGDVSGARHSAADASP
FT                   DEDQVNYLRLRGISRDEVTDLIIHEVTSQFIDSLPSEFSYDAEVIRSLVMGKLMIRQGT
FT                   T"
FT   gene            complement(241469..242116)
FT                   /locus_tag="Vdis_0239"
FT   CDS_pept        complement(241469..242116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0239"
FT                   /product="Methyltransferase type 11"
FT                   /note="InterPro IPR013216; KEGG: cma:Cmaq_0409
FT                   methyltransferase type 11; PFAM: Methyltransferase type 11;
FT                   SPTR: A8MBR1 Methyltransferase type 11; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49651"
FT                   /db_xref="GOA:E1QT59"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT59"
FT                   /protein_id="ADN49651.1"
FT                   /translation="MITTSSIPIFNRYARDYDNWYVKHVDTAESEVKAVSMLIPRGLGI
FT                   EVGVGSGFFAGRVGIPIGLEPAMAMAELARGRGVDVVVGVGESMPLRVSSFDYAVIIVT
FT                   ICFLDDPRKTLTEVHRILKPGGKLITCIVPRNSEHGKYYMELGRRGHRFYSVAHFYTVG
FT                   EVKEVLESLGFTVSDKAVAVLSRGVGDYHEEPQVVDLSKAEGFGFACIEAVK"
FT   gene            complement(242113..243126)
FT                   /locus_tag="Vdis_0240"
FT   CDS_pept        complement(242113..243126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0240"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="COGs: COG0704 Phosphate uptake regulator; InterPro
FT                   IPR007159:IPR008170; KEGG: cma:Cmaq_0595 phosphate uptake
FT                   regulator, PhoU; PFAM: PhoU family protein; SpoVT/AbrB
FT                   domain protein; SPTR: A8MCD0 Phosphate uptake regulator,
FT                   PhoU; PFAM: PhoU domain; SpoVT / AbrB like domain; TIGRFAM:
FT                   looped-hinge helix DNA binding domain, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49652"
FT                   /db_xref="GOA:E1QT60"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT60"
FT                   /protein_id="ADN49652.1"
FT                   /translation="MVEEEVRKVVASGRSSIAITIPKKWVSALGIEAGSYVLLRFMGDH
FT                   VAIIPLSRSVRGSSVSNVIEVDRDSSDYVLRRLITQYLRGVDEIKVKFDGFTGIKDEVK
FT                   ELVRERISGAEVIEEGNDYIVFRFVTPIPEVPIKRLLNRMALTVLGMLKDSLDMLRGSA
FT                   IEPSDIIDRDNEVDRLYLLIERLVMMGITDQSVLSKLEAGSSKELVNSLMVSKSIERAG
FT                   DHAWRIAQIIGEASHMCCKLSELLIVDNIIDLGLNSADILREAAMAFINGDVNDAMEVL
FT                   DRRVVMRSKSLEVIKSIYGSSLHVDVGGRLMMIVESIRRISEYSYDIAEITLDTYG"
FT   gene            243177..243719
FT                   /locus_tag="Vdis_0241"
FT   CDS_pept        243177..243719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0241"
FT                   /product="protein of unknown function DUF265"
FT                   /note="COGs: COG1618 nucleotide kinase; InterPro IPR004948;
FT                   KEGG: cma:Cmaq_0312 hypothetical protein; PFAM: protein of
FT                   unknown function DUF265; SPTR: A8MB70
FT                   Nucleoside-triphosphatase THEP1; PFAM: Protein of unknown
FT                   function, DUF265"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49653"
FT                   /db_xref="GOA:E1QT61"
FT                   /db_xref="InterPro:IPR004948"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT61"
FT                   /protein_id="ADN49653.1"
FT                   /translation="MLRVLITGPPGVGKTTLIKRLVDHARSMGVEVFGFITTEVREGGS
FT                   RVGFRIVDINNGREAWLAHVSLFTGGPTVGKYNVNLRAMEEVGIPAIRAAKPGSLLVID
FT                   EIGKMELMHRDFLRALEEVINGVHFLGTIYMAYRTNRPVASFVSKYGFKIVELTRTNRD
FT                   QIFNELVKELNKEVKPI"
FT   gene            complement(243996..245116)
FT                   /pseudo
FT                   /locus_tag="Vdis_0242"
FT   gene            245455..246453
FT                   /locus_tag="Vdis_0243"
FT   CDS_pept        245455..246453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0243"
FT                   /product="metallophosphoesterase"
FT                   /note="COGs: COG2129 phosphoesterase related to the Icc
FT                   protein; InterPro IPR002052:IPR004843; KEGG: cma:Cmaq_0835
FT                   metallophosphoesterase; PFAM: metallophosphoesterase; SPTR:
FT                   A8MD14 Metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49654"
FT                   /db_xref="GOA:E1QT62"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT62"
FT                   /protein_id="ADN49654.1"
FT                   /translation="MGRLRILLVSDLHGSSVAYGKLSNAIKFYKADIVVFAGDLTGKAL
FT                   VPIIRDDGSFSLGSGVSKYVVNVFGDVKAVDGKDLDKVIRELRGRGYYPFVTDKAGYEE
FT                   LASNRDRVRETFVKLMINALEEDLSKVVARYREAGVKLLIMPGNDDYPEIADYVKKQAS
FT                   DVLIPIDEDVVEINGYYFLGFGYSTPTPWNTPREVSEEELRARVERLIRGIDQSRLTKL
FT                   IMVIHDPPYNTLIDQAYQLSKDFKPVIRGGEVLRTHVGSKSVRALIEEYSPLMGMHGHI
FT                   HEAPGIDYVKSNAGAKVPVINAGSEYSEGVLRMAYLIVEDNKLKNYFLLKG"
FT   gene            246492..247319
FT                   /locus_tag="Vdis_0244"
FT   CDS_pept        246492..247319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0244"
FT                   /product="inositol monophosphatase"
FT                   /note="COGs: COG0483 fructose-1 6-bisphosphatase of
FT                   inositol monophosphatase family; InterPro IPR000760; KEGG:
FT                   cma:Cmaq_0397 inositol monophosphatase; PFAM: inositol
FT                   monophosphatase; SPTR: A8MBQ0 Inositol monophosphatase;
FT                   PFAM: Inositol monophosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49655"
FT                   /db_xref="GOA:E1QT63"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT63"
FT                   /protein_id="ADN49655.1"
FT                   /translation="MEVNLESLIKDLAIRAGSFVRSKANDMSYRQIMRRGLTDVSRRID
FT                   LEVEDIIIKGIEEEGLRAVINTEERGVVRVGDGEPEYVFIIDPLDGSLNFVLDIPFYSI
FT                   SIAVGKYGNSLRFSDLTDGVVYYVTKDVLYYGGPRGVEFRGDDLGDLSEDIDRPVISLY
FT                   LEPDADERLLRGLRAIYDRFGRFKIRSLGAASLEMVMASIGRFLAFMDLRNRLRIFDVA
FT                   GAYVISRAMKVDVYTLNGGKLGNELVSSDRRFSLVVSRNGDFIRSFLDLLRVK"
FT   gene            247389..247613
FT                   /locus_tag="Vdis_0245"
FT   CDS_pept        247389..247613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1013 hypothetical protein; SPTR:
FT                   A8MDI8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49656"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT64"
FT                   /protein_id="ADN49656.1"
FT                   /translation="MRIRLNLECPRCGGALFMEEDDKNVSVYCIRCGLRVSWKLRDAAR
FT                   RAVKNIDGSLIFDWSSVIDELYLELTINH"
FT   gene            247695..248087
FT                   /locus_tag="Vdis_0246"
FT   CDS_pept        247695..248087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0246"
FT                   /product="zinc finger SWIM domain protein"
FT                   /note="InterPro IPR007527; KEGG: pai:PAE3053 hypothetical
FT                   protein; PFAM: zinc finger SWIM domain protein; SPTR:
FT                   Q8ZTX0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49657"
FT                   /db_xref="GOA:E1QT65"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT65"
FT                   /protein_id="ADN49657.1"
FT                   /translation="MAEELTPQLSKRLKEWLLELAGKLNWRVDRVLDSYRLAQRSEIID
FT                   VRDDGESISGIRLKVPSETRDNTYYYVSVGPYGAKCTCEASVIRGEVCKHIVAGLVMWN
FT                   MLSVIKYGRWLDLNELEWLRQTQDNK"
FT   gene            248248..248457
FT                   /locus_tag="Vdis_0247"
FT   CDS_pept        248248..248457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49658"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT66"
FT                   /protein_id="ADN49658.1"
FT                   /translation="MAWKKYLSLAIILSITILITHYALSESIYATTSSATSPPSSYLFI
FT                   NITAPNYATWTIYANASNGWYAYY"
FT   sig_peptide     248248..248322
FT                   /locus_tag="Vdis_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            248761..248943
FT                   /locus_tag="Vdis_0248"
FT   CDS_pept        248761..248943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0248"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: D0CM32 Poly(Beta-D-mannuronate) C5 epimerase
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49659"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT67"
FT                   /protein_id="ADN49659.1"
FT                   /translation="MDTTLFIVAWPFYGYTLEGIYVNGTAINYTETPYGSFHAEVLISS
FT                   NLTITVEFTSTTSNS"
FT   gene            complement(248971..249456)
FT                   /pseudo
FT                   /locus_tag="Vdis_0249"
FT   gene            complement(249535..249957)
FT                   /locus_tag="Vdis_0250"
FT   CDS_pept        complement(249535..249957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0250"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btk:BT9727_4231 oligopeptide ABC transporter,
FT                   oligopeptide-binding protein; SPTR: Q8V4S3 B5R"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49660"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT68"
FT                   /protein_id="ADN49660.1"
FT                   /translation="MIVTKGGMSVITLMNELKRLVNESSVESIPVDFVRKTPGFIHILS
FT                   LGGNVKRVYTDNTKIYLIFTDGRLVNGGSDAYGIYHNIEGATWLITGAIFPPHGNESNG
FT                   SMNLTIHSKSGKVRNMLVMAIHEAIKGIDATVNVAY"
FT   gene            250015..250665
FT                   /locus_tag="Vdis_0251"
FT   CDS_pept        250015..250665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0251"
FT                   /product="Methyltransferase type 11"
FT                   /note="InterPro IPR013216; KEGG: cma:Cmaq_0994
FT                   methyltransferase type 11; PFAM: Methyltransferase type 11;
FT                   SPTR: A8MDG9 Methyltransferase type 11; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49661"
FT                   /db_xref="GOA:E1QT69"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032873"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT69"
FT                   /protein_id="ADN49661.1"
FT                   /translation="MERLRDVMEAYEAISRAYPETREGGALARALLNEVGDVIRHLTPR
FT                   LVLDIGPGAGDNLRILRAFLSNSFYIGCELSMGMIRVSKESIEWINCSGTHIPIKLGSA
FT                   DLIISIAALHHVPRSLMGYVLREAHEVLRPGGLFIATVWGCNEATLRRLRRIDGCEGYI
FT                   TWSYGVNKSIARYYRLYREGELEGEVSSAGFTIIRSGIIRLGSFVNYYIVSHK"
FT   gene            250732..252393
FT                   /locus_tag="Vdis_0252"
FT   CDS_pept        250732..252393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0252"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0318 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; InterPro
FT                   IPR020845:IPR000873; KEGG: sid:M164_0843 AMP-dependent
FT                   synthetase and ligase; PFAM: AMP-dependent synthetase and
FT                   ligase; SPTR: C4KFU2 AMP-dependent synthetase and ligase;
FT                   PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49662"
FT                   /db_xref="GOA:E1QT70"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT70"
FT                   /protein_id="ADN49662.1"
FT                   /translation="MSNQYYDYQLTLDKLIRKAALIYPDVEVVHAPPGGPIIRSNYAKE
FT                   WDRIQRLGSALEELGVSPGEPGKFGSRIAVLDWNTIRHFELYYGVPMYGAVLHTVNVLL
FT                   APEDIIYTLLQAQDEVLFINEDFISLARIVTSLVKSIKKVVIMSDELEHEEVSFDGVKV
FT                   YWYEDLIRDARPYNFPELSENTVATMMFTSGTTGRPKGTYFTHRQLVLHAMSVALSLSA
FT                   PPINANIYDVAMPLVPMFHVHAWGLPYIATLVGIKQVYPGRFDWGWVLKLIKDEGVTIT
FT                   NGVPTILFNLLYHPDSPKYDLRGLKFIVGGSALPRGLLEEASRRGIHVVQGFGLTETAP
FT                   VILLTMEKANMRNWPEDRKRELVLSAGLPIPLVDIRVVDGQGRDVPRDGKTMGELVVRA
FT                   PWITREYLNDPEKTRNAWRDGWFHTDDIAVWDSEGYVWIMDRAKDVIKSGGEWISSTRL
FT                   EDLISTHPAVYEVAVIGVPHPKWGERPVAIVVPKPGQKVTEEEIRNYLMGLVNEGKMPK
FT                   WWIPDKVVIVESELPKTSTGKVDKKVLRERFQITLE"
FT   gene            252443..252977
FT                   /pseudo
FT                   /locus_tag="Vdis_0253"
FT   gene            complement(252966..253898)
FT                   /locus_tag="Vdis_0254"
FT   CDS_pept        complement(252966..253898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0254"
FT                   /product="amidohydrolase 2"
FT                   /note="COGs: COG2159 metal-dependent hydrolase of the
FT                   TIM-barrel fold; InterPro IPR006992; KEGG: drm:Dred_2759
FT                   amidohydrolase 2; PFAM: amidohydrolase 2; SPTR: B5JCZ6
FT                   Amidohydrolase family; PFAM: Amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49663"
FT                   /db_xref="GOA:E1QT71"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT71"
FT                   /protein_id="ADN49663.1"
FT                   /translation="MLGDYFIDFHVHPGAELWVLRDRLHRAGAIASTLYPIDVDPTLSL
FT                   TLSGLYRLARDLGMYVDVKSVIREVYDLISKWPEYMIDNMKLWYEVFKEGVSDFFIPFS
FT                   SINPSFGGKYVRQKIKEMEHLGLRGVFVSPALQFFNPATSPAFKQLMEYAEKNNVLIVM
FT                   HLGMPKDVDERIITHVMPKNLAEVLNEYRPYMVINGLGTPPERFGLWVREVLRVMRRYD
FT                   NTYLSTSGINCYLFNDESAKPILNTLGPERILFGSGYPYRRFRDLVGDVKCVKGSDGVG
FT                   NIDKEMIMMNNAIELFKYHGFRINENLSA"
FT   gene            complement(253999..254769)
FT                   /locus_tag="Vdis_0255"
FT   CDS_pept        complement(253999..254769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0255"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="COGs: COG1024 Enoyl-CoA hydratase/carnithine
FT                   racemase; InterPro IPR018376:IPR001753; KEGG: mse:Msed_0385
FT                   enoyl-CoA hydratase; PFAM: Enoyl-CoA hydratase/isomerase;
FT                   SPTR: A4YDR0 Enoyl-CoA hydratase; PFAM: Enoyl-CoA
FT                   hydratase/isomerase family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49664"
FT                   /db_xref="GOA:E1QT72"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT72"
FT                   /protein_id="ADN49664.1"
FT                   /translation="MYRYVIVDDRGPITVFTLNRPDKLNALGPELRAELLDALRKFNSD
FT                   PNKRVGVLTGAGRAFSSGAEISVKPSGPGAVDLEGELRNSFHLILREIRFSDKLFIAAV
FT                   NGVAAGAGISLAVACDFAFASRNARFVLAFQNLGIVPDTGLTLMMARLVGARALRYLLI
FT                   GGEFTAEEAEAMGLVKVVDDPLGEALKFANEIVQGPFRAYSYGKRLINEALFKDLDQFL
FT                   AVEARLQGELGNTHDFVEGVSAFLEKRRPRFTGS"
FT   gene            complement(254779..255324)
FT                   /locus_tag="Vdis_0256"
FT   CDS_pept        complement(254779..255324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0256"
FT                   /product="protein of unknown function DUF35"
FT                   /note="COGs: COG1545 nucleic-acid-binding protein
FT                   containing a Zn-ribbon; InterPro IPR002878; KEGG:
FT                   ape:APE_0930.1 hypothetical protein; PFAM: protein of
FT                   unknown function DUF35; SPTR: Q9YDI3 Putative
FT                   uncharacterized protein; PFAM: Rubredoxin-like zinc ribbon
FT                   domain (DUF35_N); DUF35 OB-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49665"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT73"
FT                   /protein_id="ADN49665.1"
FT                   /translation="MVMSLEARYEEFWRQSIKQLNDVVKATGLPIAPDEKGQYNLWYDV
FT                   REMRLRFSISVERIKKFFEGLREGKVYTTRCRRCGRYYFPPQADCPYCKASDMDWVEVS
FT                   GEGELLTYTVINTKPLTYSHYPDYIVAIARMREGFNVLAWLRADDPRKVRVGMKVKLQV
FT                   VKREPEGYLTYEFVPAEQ"
FT   gene            complement(255324..256538)
FT                   /locus_tag="Vdis_0257"
FT   CDS_pept        complement(255324..256538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0257"
FT                   /product="Propanoyl-CoA C-acyltransferase"
FT                   /EC_number="2.3.1.176"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase; InterPro
FT                   IPR016039:IPR002155:IPR016038; KEGG: pcl:Pcal_0837
FT                   acetyl-CoA acetyltransferase; PRIAM: Propanoyl-CoA
FT                   C-acyltransferase; SPTR: A3MUE6 Thiolase; manually curated;
FT                   PFAM: Thiolase, C-terminal domain; Thiolase, N-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49666"
FT                   /db_xref="GOA:E1QT74"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT74"
FT                   /protein_id="ADN49666.1"
FT                   /translation="MRGVAIVGVGHAKFGRRTDTTLGELAWEAVKEALEDARLDQKDIQ
FT                   YFVVGNAGGWSAESLPAVVVGEYCGLNPRGAMRVEAACASGSAALYNAYLAVASGMADV
FT                   AMAIGVEKMYESPTPTVVEFIGRAGNYFWEFENFGLTFPGYYALYMTAYMNRFGATEED
FT                   FCKVAVKNHYYGSMNPKAQFYGLRITVDQCLKSRYVAWPIKLYDSSPITDGAAAVILAS
FT                   EELARKITDTPVWIRSVGVATGTANLSKRPDFIGLDAAYQAAEQAFRRVGVEHRDTWKY
FT                   FDVADVHDCFTIAEVMAYEDLGFVERGMGIQLVRSEQTYKGGLIPVNLDGGLKAKGHPI
FT                   GATGVSMAVEMTKQLRQSVEPRDRQADIYVGWALSHNVGGTGHYAYITIYSLDKDGPPR
FT                   VKPRR"
FT   gene            256694..258688
FT                   /locus_tag="Vdis_0258"
FT   CDS_pept        256694..258688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0258"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="COGs: COG1250 3-hydroxyacyl-CoA dehydrogenase;
FT                   InterProIPR018376:IPR016040:IPR008927:IPR006168:IPR
FT                   013328:IPR006176:IPR006108:IPR001753; KEGG: pcl:Pcal_0841
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding; PFAM:
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein; Enoyl-CoA
FT                   hydratase/isomerase; SPTR: A3MUF0 3-hydroxyacyl-CoA
FT                   dehydrogenase, NAD-binding; PFAM: Enoyl-CoA
FT                   hydratase/isomerase family; 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain; 3-hydroxyacyl-CoA
FT                   dehydrogenase, NAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49667"
FT                   /db_xref="GOA:E1QT75"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT75"
FT                   /protein_id="ADN49667.1"
FT                   /translation="MSTQIRRVAVIGAGTMGHGIAEVSALAGYEIVMVDVSQDLLNKAL
FT                   ERIKWSLDKLAERGTISKEKVGEVMGRIKTSLSIAEAVKNADIMIEAVPENIDLKKQVF
FT                   AEADANAPPHAILATNTSSLPITEIASATKRPERVVGIHFFNPPVLMPLVEVIKGAQTS
FT                   DEVARRAYDFVKSLGKEPIMVNKDVPGFVVNRILVALNSVACLLVANNVYSIVEVDSAV
FT                   KYRAGLPMGIFELQDFTGIDVGYLVGFAVAVRDPMLRVPCPLIEELYKKGWLGQKSGRG
FT                   FYEYKGGPYERANIPREAGEKVDLVQIFAPAINMAAWLLRQGIASRDDIDKGVKLGLGW
FT                   PKGVFEYADEFGIDKVVEALNQLYSKYGYELFKPDPLLTQMVQEGKLGQKSGRGFYEYG
FT                   AVGVTEFKEIILRKEPPLAWIILNRPQRLNALTLTMLEEISRALDMLWDDKEVRVVIIR
FT                   GAGDRAFSAGADVTSFQGPLHTYYFFIYNRKFQEAVNKIERFPKPVIAAIDGYALGGGL
FT                   EIAMACDFRIATDRSELGQPEINLGIIPGAGGTQRLIRYVGLGRAKELIMFGDRIKADE
FT                   AYRIGLVNRVVPREKFEDEVRSFAMRLAQGPPIALTYAKYAVNFGTQVPVDIGMLLEAA
FT                   LFSMAVNTKDAQEGVMAFAMRRRPEFKGE"
FT   gene            258747..259088
FT                   /locus_tag="Vdis_0259"
FT   CDS_pept        258747..259088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0259"
FT                   /product="Sterol-binding domain protein"
FT                   /note="InterPro IPR016083:IPR003033; KEGG: cma:Cmaq_1772
FT                   sterol-binding domain-containing protein; PFAM:
FT                   Sterol-binding domain protein; SPTR: A8MAW6 Sterol-binding
FT                   domain protein; PFAM: SCP-2 sterol transfer family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49668"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT76"
FT                   /protein_id="ADN49668.1"
FT                   /translation="MSEDPFELLNSMTQQALPKIASKVTGPVKVFQFTGEGYEPFYVEI
FT                   GGGTVKLTKGTHRSPTATIQVNKDNLLKMIKGQLDAMQAYFSGAIKVMGNIMDAASLID
FT                   IINTARSSR"
FT   gene            259200..260156
FT                   /locus_tag="Vdis_0260"
FT   CDS_pept        259200..260156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0260"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="COGs: COG0111 Phosphoglycerate dehydrogenase and
FT                   related dehydrogenase; InterPro
FT                   IPR006140:IPR020392:IPR016040:IPR006139; KEGG: mka:MK0297
FT                   D-3-phosphoglycerate dehydrogenase; PFAM: D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding; D-isomer specific
FT                   2-hydroxyacid dehydrogenase catalytic region; SPTR: Q8TYK0
FT                   Predicted dehydrogenase related to phosphoglycerate
FT                   dehydrogenase; PFAM: D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD binding domain; D-isomer specific
FT                   2-hydroxyacid dehydrogenase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49669"
FT                   /db_xref="GOA:E1QT77"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT77"
FT                   /protein_id="ADN49669.1"
FT                   /translation="MRILVTIPLTDPDVGPQAMKMLSEVGEVDIKPMTTEQLKDAIRDY
FT                   DAVIVSVWHRVTKDVIDAGRNLKVIGTASVGTDHIDVEYAEGRGIKVVSAAGASTYSVA
FT                   EFTFGLLLMMVKRIPENMGRVRNGEWSSLLTPGIELFGKTLGIIGFGRIGSYVASIANA
FT                   FRMRVLAYDPFVDRERFIEVNAIRVDNLDDLLKQSDFITIHTSLTRESRGLIGRREVGL
FT                   MKDGVYIINTARGEVVDENAILEGLKSGKIAGYAADVLTGEPPTEDTSPLLRAFRRGEV
FT                   SNLFITSHIAGVTRESVKRYTLYVAKGVRDALIAFKR"
FT   gene            260167..261864
FT                   /locus_tag="Vdis_0261"
FT   CDS_pept        260167..261864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0261"
FT                   /product="thiamine pyrophosphate protein central region"
FT                   /note="COGs: COG0028 Thiamine pyrophosphate-requiring
FT                   protein; InterPro IPR012001:IPR012000:IPR011766; KEGG:
FT                   mth:MTH1444 acetolactate synthase catalytic subunit; PFAM:
FT                   thiamine pyrophosphate protein central region; thiamine
FT                   pyrophosphate protein TPP binding domain protein; thiamine
FT                   pyrophosphate protein domain protein TPP-binding; SPTR:
FT                   O27493 Acetolactate synthase; PFAM: Thiamine pyrophosphate
FT                   enzyme, central domain; Thiamine pyrophosphate enzyme,
FT                   N-terminal TPP binding domain; Thiamine pyrophosphate
FT                   enzyme, C-terminal TPP binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49670"
FT                   /db_xref="GOA:E1QT78"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT78"
FT                   /protein_id="ADN49670.1"
FT                   /translation="MVTGGEAITRSLIEEGVDTVFGLPGTHVLGLYAALHDYRDRIKHV
FT                   LGRFEPSMGFMADGYARASGKVGVVIATAGPGATGLVTPLAQASVEGVPIVALVGLTPI
FT                   RTAGRGYYHEFRDVNAQLSIFKPFTKLAVRVEDPREIPRVMAKAFRTAKEGRPGPVYVE
FT                   LPRDVIESETEWMGYTKEEPIRTKPDPSLVELAAKELLNAERPIIYVGGGVIAANASDA
FT                   LIKVAEELGAPVVTSIMGKGAIPFDHPLHGGLAAGYFGDTVAVKLVEKADVVLAIGTRF
FT                   SELGTGMWSLPIRGRLIHVNIDPNDIGRNYKTDLSIVSDALEFLNALYDKVRSKGPGRD
FT                   RGIKLINEVKASVGNQQLRELGYDESRINPSDLVRALAHVLDNDMREGKAIVTCDAGGN
FT                   QVAMFELPVYKPRTYFNPAGFTSLGFAIPAAIGAKIARPEATVVATTGDAAFFMTGMEI
FT                   ATAAELNLKVAFVIFNDRAQGVLKLQQRFLYGGKVYASHTYPMDFCKFAESLNVGCVRI
FT                   SDRRELEPGLERCIYKSGGPCIADVLVNPDAVPIPITRQLMAIFGRRR"
FT   gene            complement(261907..262953)
FT                   /locus_tag="Vdis_0262"
FT   CDS_pept        complement(261907..262953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0262"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="COGs: COG1064 Zn-dependent alcohol dehydrogenase;
FT                   InterProIPR002328:IPR011032:IPR016040:IPR013154:IPR 013149;
FT                   KEGG: pai:PAE2931 alcohol dehydrogenase (zinc); PFAM:
FT                   Alcohol dehydrogenase GroES domain protein; Alcohol
FT                   dehydrogenase zinc-binding domain protein; SPTR: Q8ZU64
FT                   Alcohol dehydrogenase (Zinc); PFAM: Alcohol dehydrogenase
FT                   GroES-like domain; Zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49671"
FT                   /db_xref="GOA:E1QT79"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT79"
FT                   /protein_id="ADN49671.1"
FT                   /translation="MKAATIKGPNKPYLEIKEVPTPKPGPGEILVRVAATGICHSDLHL
FT                   FKGDFGPVRQGFIPGHEISGWVEDFGPDVKNPWGLKKGDPVIISWIVPDGICKYCASGK
FT                   ENYCPAAAGRMPGLVGLNGGHAEYITVPEIAVIPLEKGVDVYYAAPIACAYGTAYHALR
FT                   EAGVGPGTSLVVIGVGGVGLSAVQLASAMGAYPIIAVDVRDYALDKARELGATHVINSS
FT                   KEDPISRIRDILPDGADVVHEARPEPDLKLSMEVVARAGTIVVTGLGGPKSYFSVNILP
FT                   FVVNGIRIIGSLGYRPRLDLPEIIKLVASGKVDIRKLVSHVYAPEQINEAYENLEKGLH
FT                   ARAIVKWD"
FT   gene            complement(263107..263652)
FT                   /locus_tag="Vdis_0263"
FT   CDS_pept        complement(263107..263652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3255 Putative sterol carrier protein;
FT                   InterPro IPR016083; KEGG: sis:LS215_0326 hypothetical
FT                   protein; SPTR: C3MKV3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49672"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT80"
FT                   /protein_id="ADN49672.1"
FT                   /translation="MYLICMSSEGFIYPSPQWAEAFCKAINENQEYREAAKDWRWDVAF
FT                   VATNIPENVVDRLSEILGLPKPKDLGVKVDSGAIKLVLRNGTCQGSEFYIDLPVNLPTE
FT                   IKLPGNIKIGKVDADFVLEATYSLWKDLILGKADPVSSLLSRKIKVKKGSFLTLMQYSS
FT                   AAVKLANTTRNVPTKFID"
FT   gene            263763..265016
FT                   /locus_tag="Vdis_0264"
FT   CDS_pept        263763..265016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0264"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="COGs: COG1960 Acyl-CoA dehydrogenase;
FT                   InterProIPR009100:IPR009075:IPR013786:IPR006091:IPR
FT                   013764:IPR006092:IPR006090; KEGG: afu:AF1175 acyl-CoA
FT                   dehydrogenase, short chain-specific (AcdS); PFAM: acyl-CoA
FT                   dehydrogenase domain protein; SPTR: O29092 Acyl-CoA
FT                   dehydrogenase, short chain-specific (AcdS); PFAM: Acyl-CoA
FT                   dehydrogenase, C-terminal domain; Acyl-CoA dehydrogenase,
FT                   middle domain; Acyl-CoA dehydrogenase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49673"
FT                   /db_xref="GOA:E1QT81"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT81"
FT                   /protein_id="ADN49673.1"
FT                   /translation="MSYLDLDRLTEEDDLIRRNVHKLAEEVLRPLSIKVDRMDPRDRVA
FT                   PGSPLYDAIREMKRMGLHRIHLPKDRGGLGLTNLQRYIIDEELGWASLGFATLIGVDAI
FT                   PFTIAALFGSERVKEELVKPWLEDTEGRYIGCWGVTEPEHGSDYILAFRDREVESFGKG
FT                   NVVIERDGDEWVINGQKSAWVSAAPVCTHMGLHAQLRDGRSLRDGAFVIVPLNLRGVRK
FT                   GEPVDMLGNRDCPQGPVFFDNVRVPDDYVIAQPPFYELFSDQLLNLTSVNMGAFSVGLA
FT                   RAAFEEALKYARSRIQGGKPLIEHKNIKLKIYEMFERVETARYYVRKAMDFVYTKFFVE
FT                   QSFTTPPRYARAAQVYAKKIAFEVAHDALQIFGAYGLSREFIIEKLFRDARALLIEDGT
FT                   VEALSLDAADDIILNYNL"
FT   gene            265077..265871
FT                   /locus_tag="Vdis_0265"
FT   CDS_pept        265077..265871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0265"
FT                   /product="Acetoacetate decarboxylase"
FT                   /note="COGs: COG4689 Acetoacetate decarboxylase; InterPro
FT                   IPR010451; KEGG: afu:AF1176 hypothetical protein; PFAM:
FT                   Acetoacetate decarboxylase; SPTR: O29091 Putative
FT                   uncharacterized protein; PFAM: Acetoacetate decarboxylase
FT                   (ADC)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49674"
FT                   /db_xref="GOA:E1QT82"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT82"
FT                   /protein_id="ADN49674.1"
FT                   /translation="MVLKGGEKGFGTPLNAPLYPSSTAVTKISYSKVRVVLVLANVDPK
FT                   SVDPLLPEGVDLALEMAAFWVGDYGISTVGVYREALIALPVRTEGVELAYYIPYIYVTN
FT                   DAAMAAGRELAGAPKKLGDIRLTINDYGLVIGTLDRGGELMRVEVAISGRLGLEQLDAF
FT                   RALMPRTDNTVTLPLLSVRTLPPLPDGTPGIAQLIQWYARFTFTPRESPQIWSGEARVK
FT                   LGGTPFDPLDDIKVTGVVAGFYIEGDMELGITRKVKEWKLTW"
FT   gene            265966..266496
FT                   /locus_tag="Vdis_0266"
FT   CDS_pept        265966..266496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppu:PP_4464 LysR family transcriptional
FT                   regulator; SPTR: D0PPP9 Cytochrome c oxidase (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49675"
FT                   /db_xref="GOA:E1QT83"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT83"
FT                   /protein_id="ADN49675.1"
FT                   /translation="MQIKSILTFILGIMLMALLIYATLSAHLGNAHRTTQKDSALKGDP
FT                   IIYIYSPVVKASGFISFTAGNYDGIPVVVYKAGSLYMPSGQVMIGISPSYNITLTMSSA
FT                   EISDVTIYAANITATAYVIIPITITITPQNVYLLSILSTIASELLPLYNVKIYAYYINS
FT                   TSISYSSIKVYTG"
FT   sig_peptide     265966..266043
FT                   /locus_tag="Vdis_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            266624..267229
FT                   /locus_tag="Vdis_0267"
FT   CDS_pept        266624..267229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: B7DUJ6 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49676"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT84"
FT                   /protein_id="ADN49676.1"
FT                   /translation="MNWKLTVIGLGFVIALLVAASVFGISTDASIPGPIKIYYPTASLS
FT                   GILMYGWVYSTSTAPYQYAPVIAQSINSISAPQGQTISKSVIVSLPNPLMPNCPTSTVN
FT                   ITASLTMNSASLSNIFLYAVNITTTSGSLNNVVLVSSGLPYVVNQTISSATMNGLTVYA
FT                   YYVSVGSLSYSGLSVTVTPALITCSSSGVTTSNVVSGS"
FT   sig_peptide     266624..266695
FT                   /locus_tag="Vdis_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            267346..268116
FT                   /locus_tag="Vdis_0268"
FT   CDS_pept        267346..268116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3120 hypothetical protein; SPTR:
FT                   C9RV48 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49677"
FT                   /db_xref="GOA:E1QT85"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT85"
FT                   /protein_id="ADN49677.1"
FT                   /translation="MDFFTKFGYILVNMWRHKALILPILLVLNVLSWIYFWVKPSLLGF
FT                   SMIILALALLLTVVFIGVIPVAIIEENNYRIDVVRRMGLDSFVSLVVVYALFIYVSLIL
FT                   LAVIKPPPLLIVMMVLLFALPLTPFVVIAVLVPPLVGYFMRQRWRSLRGRIPFWGIYLG
FT                   LLSALILLLLPIMYFRVLFVSASLVNSFILGGVVTILSLIPLFYPKPMVCRVLGLAMIF
FT                   LGILMWLIVAGGLTWGSVLSIISGGYLYDWKPQD"
FT   gene            268175..270284
FT                   /pseudo
FT                   /locus_tag="Vdis_0269"
FT   gene            270274..271665
FT                   /locus_tag="Vdis_0270"
FT   CDS_pept        270274..271665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0270"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG0579 dehydrogenase; InterPro
FT                   IPR006076:IPR007419; KEGG: tpe:Tpen_1375 FAD dependent
FT                   oxidoreductase; PFAM: FAD dependent oxidoreductase; BFD
FT                   domain protein [2Fe-2S]-binding domain protein; SPTR:
FT                   A1RZZ2 FAD dependent oxidoreductase; PFAM: BFD-like
FT                   [2Fe-2S] binding domain; FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49678"
FT                   /db_xref="GOA:E1QT86"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT86"
FT                   /protein_id="ADN49678.1"
FT                   /translation="MSYDVAIIGSGVVGLFIAYELAHYRVRVLVIDKEVEPGFGVSKGH
FT                   AGVIHVVQPPFNSLRSKLAVEGNRLYDGIARRLHVKVRRLSALLVAKNPGQLIALPAVW
FT                   LILNHVYGKQGFRVRVLGPRGLRRVEPNVSGLGAVEVDGYGVINSFELISQLYNFCRLN
FT                   GIDFALSTEVRDAKVLGDEVVLVTSRGEYRAKYVVNSAGLYSTDIARLFGDEYRLEFGK
FT                   GAMLVFWGEQVRNIVAPLQLIPNPKTKGGAIIPTVFGTTIWGPSLSMGDRGDRSVNEDD
FT                   VNVLREKFGRLLRNKDFTPIKAYAGVRPIPEGDDFIITYSGSSRHVIHLIGIESPGLTS
FT                   APAIARRVVEMLREAGAMLTPKDGVKEVDPMVMTRDIIKDGGLISGDQGEVVCPCMGVT
FT                   RADIREAIRRGARTLDGVIFRTGLGMGICQGMCLGRAIKVISEELGVDPRELTKSGGGS
FT                   WLVTQ"
FT   gene            271647..272585
FT                   /locus_tag="Vdis_0271"
FT   CDS_pept        271647..272585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0271"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="InterPro IPR013027:IPR016040:IPR002938; KEGG:
FT                   tpe:Tpen_1374 hypothetical protein; PFAM: monooxygenase
FT                   FAD-binding; SPTR: A1RZZ1 Putative uncharacterized protein;
FT                   PFAM: Pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49679"
FT                   /db_xref="GOA:E1QT87"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT87"
FT                   /protein_id="ADN49679.1"
FT                   /translation="MAGYTIVGAGLAGLSLALELRRLGVEAEIIEYRDYIGGIHSIMPE
FT                   TKGFINDALKNVSARLNTTAVRVGDATYIIWRGGYRKLAGNVVVATGFRVMTLPELGIY
FT                   GERPAGIYPHHAVLDMLHYELLPGKNVIVYGDNQYALSLAGELTKRGATVHVVSPTKLD
FT                   TGAVGEDVDIIIGRVRYVKGMGRVERVLVNNEWVTADTLVISMFRPFNPFPEFRAVGQA
FT                   VIETYDPSIVIESGRIMAGELVNRSGEFIIIDSDLPIYPGNRVSRDVRRVIIPCRGCRV
FT                   MVNDREYVINNDAAIIELPDVDKVIIRRVVS"
FT   gene            272582..273988
FT                   /locus_tag="Vdis_0272"
FT   CDS_pept        272582..273988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0272"
FT                   /product="Carbohydrate kinase, FGGY"
FT                   /note="COGs: COG0554 Glycerol kinase; InterPro
FT                   IPR018484:IPR018485; KEGG: tpe:Tpen_1373 carbohydrate
FT                   kinase, FGGY; PFAM: Carbohydrate kinase, FGGY-like; SPTR:
FT                   A1RZZ0 Carbohydrate kinase, FGGY; PFAM: FGGY family of
FT                   carbohydrate kinases, N-terminal domain; FGGY family of
FT                   carbohydrate kinases, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49680"
FT                   /db_xref="GOA:E1QT88"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT88"
FT                   /protein_id="ADN49680.1"
FT                   /translation="MSLGVIDVGTTNIKLIIYDEELNQRYSETVNVPMAFPGNYRVEQD
FT                   ANALRSAFNHLVSTARDRGVKYLGISTYRASVLAWDRSGNPLINIITWLDRRGLEIVNK
FT                   FPYSIMRHLPLLSSILIPTSPVVQILWLLRNRRGLIERVRRGEVFIGTLSSYLAYIIGN
FT                   RYVNDASNEALTGLWHPGNFRRIDAVYELLGIPREVGPDVVDNIHEFGEVNGMRVGVLI
FT                   ADQQAAMVGEGCLSIGCGKVTNGTGSFVDAVTDKFRLAGGGLLPLLILKYGNTVYYGIE
FT                   GFLPATGSVIDWLIKLGLLSSPQELDGLVNVDTQGIVVVPALAGVNVPPRPCARGLIDG
FT                   LTLNTTRESFVRAVIEGIVQLIGLIFDKIRNYSRVNVVRVDGGLSRSVLFLKLLATALD
FT                   TAVERQRDVEATARGVAALLKVFRGDWSLNDIIKGAHVNVELRIKPGEEKLSLSRDVVR
FT                   RIVEGMRCRM"
FT   gene            273976..275376
FT                   /locus_tag="Vdis_0273"
FT   CDS_pept        273976..275376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0273"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="COGs: COG0277 FAD/FMN-containing dehydrogenase;
FT                   InterProIPR016166:IPR016164:IPR016167:IPR016168:IPR
FT                   006094:IPR004113; KEGG: tpe:Tpen_1372
FT                   alkylglycerone-phosphate synthase; PFAM: FAD linked oxidase
FT                   domain protein; SPTR: A1RZY9 Alkylglycerone-phosphate
FT                   synthase; PFAM: FAD binding domain; FAD linked oxidases,
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49681"
FT                   /db_xref="GOA:E1QT89"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT89"
FT                   /protein_id="ADN49681.1"
FT                   /translation="MQNVIERLINALGRDRVITSNDVLRKYSRDFWPLLMMREQVFNEE
FT                   LPMPLAVVVPESVNDVSLALRIINEGNDVVPVVVYGGGSSVTGASYGAGSIIIDMSKLN
FT                   RVIDINTYDSLVTVEAGARLRDVETRLNEVGYSLRHIPQSFNYATIGGLIATMSSGQYS
FT                   TLYGNIEDMVINLEVVLPNGEITWLRSNNVPRASTGPSLKYLFIGSEGMLGVITKAVLR
FT                   IVPLPTSTIYGAYSFKTLEQGVEALRELMIKRVIPAIARLYDDNEAALRFSINEPLLII
FT                   SFEGYYDDIVQALWRRADEIIKSHGGEYVGSKYFEDWLRTRFNVEEEIEMIKMYGLWFD
FT                   TIEVSTIWSRVNQLYRDFRESLLRVNGVVGVMAHISHLYINGACIYFTVLFKPNVNTYW
FT                   ELWSRAMEVTLRNGGSISHHHGIGIVRSRWLGRELGNALNILRTIKTALDNKGVLNTKS
FT                   NMFFTTER"
FT   gene            275459..275690
FT                   /pseudo
FT                   /locus_tag="Vdis_0274"
FT   gene            complement(275811..276152)
FT                   /locus_tag="Vdis_0275"
FT   CDS_pept        complement(275811..276152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0275"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain protein"
FT                   /note="COGs: COG2146 Ferredoxin subunits of nitrite
FT                   reductase and ring-hydroxylating dioxygenase; InterPro
FT                   IPR017941; KEGG: cma:Cmaq_0813 Rieske (2Fe-2S)
FT                   domain-containing protein; PFAM: Rieske [2Fe-2S]
FT                   iron-sulphur domain; SPTR: A8MCZ2 Rieske (2Fe-2S) domain
FT                   protein; PFAM: Rieske [2Fe-2S] domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49682"
FT                   /db_xref="GOA:E1QT90"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT90"
FT                   /protein_id="ADN49682.1"
FT                   /translation="MWRRVSILVKVFERRNSVITWVDNKPILVVKYGDNYYGMLAICAH
FT                   MGCALLTDVNGYVATCPAHLAKYDVRTGEMIEKPQVRPDVKCEYADVKAPLPTYKVRVT
FT                   QDGFLEIDV"
FT   gene            complement(276384..276737)
FT                   /locus_tag="Vdis_0276"
FT   CDS_pept        complement(276384..276737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR001995:IPR009007; KEGG: sin:YN1551_2275
FT                   hypothetical protein; SPTR: C3NK16 Putative uncharacterized
FT                   protein; PFAM: Retroviral aspartyl protease"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49683"
FT                   /db_xref="GOA:E1QT91"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT91"
FT                   /protein_id="ADN49683.1"
FT                   /translation="MGLVYVDAVVKHGDKSVPVKLLVDSGAVYTVLRRDVWEYLGLKPM
FT                   QEMEFVLADGTVIRRWVSEAVIELRGYGERHTPVVLGETEDENLLGTVTLEIFGLVLDP
FT                   FRRELRPARMLMK"
FT   gene            complement(276764..277864)
FT                   /locus_tag="Vdis_0277"
FT   CDS_pept        complement(276764..277864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0277"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1060 Thiamine biosynthesis protein ThiH;
FT                   InterPro IPR020050:IPR005244:IPR013785:IPR007197; KEGG:
FT                   cma:Cmaq_1416 radical SAM domain-containing protein; PFAM:
FT                   Radical SAM domain protein; SPTR: A8M922 Radical SAM domain
FT                   protein; PFAM: Radical SAM superfamily; TIGRFAM: radical
FT                   SAM domain protein, CofH subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49684"
FT                   /db_xref="GOA:E1QT92"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT92"
FT                   /protein_id="ADN49684.1"
FT                   /translation="MRNDVANNWSPVVEKAVYEERLDPHDIEELFRADLWELGSAAEYL
FT                   TRKYFGNVVTFIPNMILNYTNVCVIACRFCAFYRLPGHPEAYTLSVEEAVRRVAAIDRE
FT                   FGIRQVLVQGGINPELDIEYYEGLFKALKAKLPHVAIHGLSPIEVDYLARKHRMSYAEV
FT                   LDRLRGAGMDTLAGGGGEILVDRVRRAIAPHKIDADTWLNIMETAHRMGIMSNATMMYG
FT                   HVETMSDWAEHLYRIIELQRRTHGFLSFTAWNFEPGNSELTREVPYPLTSATLLRVVAV
FT                   ARLVFKNELPNIQSSWLTNGLEVAQLALKFGANDFGGTLYEERVIPATGLKMPILTRDT
FT                   LINLIKGLGLTPAERDNWYRVIKVYN"
FT   gene            277964..279055
FT                   /locus_tag="Vdis_0278"
FT   CDS_pept        277964..279055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0278"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1060 Thiamine biosynthesis protein ThiH;
FT                   InterProIPR020050:IPR005244:IPR006638:IPR013785:IPR 007197;
FT                   KEGG: cma:Cmaq_1417 radical SAM domain-containing protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; SPTR: A8M923 Radical SAM domain protein; PFAM:
FT                   Radical SAM superfamily; TIGRFAM: radical SAM domain
FT                   protein, CofH subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49685"
FT                   /db_xref="GOA:E1QT93"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT93"
FT                   /protein_id="ADN49685.1"
FT                   /translation="MCTIDDLRNAIINGITKSDAEKFMVECDFKDLARVANELTRKITG
FT                   DTATVVNNVVINYSNICVAQCPICAFYRPRGHPEAYVRTPEEITKGVLEAKARFGVTEL
FT                   HINGGFNPDLGIEYFEEVFRSVKRAAPDVIIKGPTAAEIDFYARVWRMSTREVLERFKA
FT                   AGLDVLSGGGAEILNEEVRRVITPYKFNAETWLRIQEEAHRVGLMSNATMLYGHIEKPN
FT                   HIVEHVFAIKEVQERTHGILLFIPIKFVPWNTKLYRDGLVKGPAPAEYDVKVIAISRLI
FT                   LGDTIRRIGAYWVSTGKRLASTLLMAGANDLVGTMINEQVLRQAGSKESVTLGELAHIA
FT                   REAGLRLFLRDTFHRIITEVGSA"
FT   gene            279058..279801
FT                   /locus_tag="Vdis_0279"
FT   CDS_pept        279058..279801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0279"
FT                   /product="protein of unknown function DUF178"
FT                   /note="COGs: COG1427 periplasmic solute-binding protein;
FT                   InterPro IPR003773; KEGG: cma:Cmaq_1418 hypothetical
FT                   protein; PFAM: protein of unknown function DUF178; SPTR:
FT                   A8M924 Putative uncharacterized protein; PFAM: Putative
FT                   periplasminc binding protein (DUF178)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49686"
FT                   /db_xref="GOA:E1QT94"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030868"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT94"
FT                   /protein_id="ADN49686.1"
FT                   /translation="MTTMSVIRLKYAHSDPLFHYSGLNPIWASNNESIRLILEGKASIG
FT                   FVPLTYAALNCDALYVIPKFAIYSDGPVISARLFKGLGTGYAAVSDTSVNALAVRRLLN
FT                   IEIKVIDDPYTALRNFGAVLVIGDDALKMVDAGYPYIIDVGELWKERVGLPLVYAVMVV
FT                   TRNYNYHELNTVISAIEKSLELFERDPEPVIQYTASRIGVSRELIRQYFGAIRYRVDDR
FT                   VILGINEELRIFGIGNCLRFLGNKA"
FT   gene            279827..280627
FT                   /locus_tag="Vdis_0280"
FT   CDS_pept        279827..280627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0280"
FT                   /product="protein of unknown function DUF191"
FT                   /note="COGs: COG2107 periplasmic solute-binding protein;
FT                   InterPro IPR000209:IPR003794; KEGG: cma:Cmaq_1608
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF191; SPTR: A8M9W0 Putative uncharacterized protein;
FT                   PFAM: Putative periplasminc binding protein (DUF178)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49687"
FT                   /db_xref="GOA:E1QT95"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT95"
FT                   /protein_id="ADN49687.1"
FT                   /translation="MELLIGHSPDPDDAFMFYALKKGLVKAPFTVREFLIDIETLNKLA
FT                   IHGRIDVTAVSTHAMAYIGGKYYILRVGASMGLKYGPVVVGNTAKPELVAVPGTYTTAT
FT                   LLVRLAMPNVKTVEIPFDKIMDAVRAGVVDAGVLIHEGQITYERYGLRKIIDLGEWWYE
FT                   ETKLPTPLGLDVVKASLGIDMAKAVKEALLESIKYAMSHREEALAYAMEFSRGLNMGDT
FT                   DRFVRMYVNDYTMDMGVDGEKSIKVLLEMGHERGLLPEPQLLFI"
FT   gene            complement(280616..281692)
FT                   /locus_tag="Vdis_0281"
FT   CDS_pept        complement(280616..281692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0281"
FT                   /product="Formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="COGs: COG1804 acyl-CoA transferase/carnitine
FT                   dehydratase; InterPro IPR003673; KEGG: sai:Saci_1726
FT                   CoA-transferase family III protein; PFAM: L-carnitine
FT                   dehydratase/bile acid-inducible protein F; PRIAM:
FT                   Formyl-CoA transferase; SPTR: Q4J855 CoA-transferase family
FT                   III; PFAM: CoA-transferase family III"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49688"
FT                   /db_xref="GOA:E1QT96"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT96"
FT                   /protein_id="ADN49688.1"
FT                   /translation="MFRVLDLTRLYPGGVATRILADLGFEVIKVEDTESGDYLREISPT
FT                   LFEWLNAGKRSIAINLKTEEGRDLFYRLVKRSHVVIEGFRPGVTRRLGIDYETLKGVND
FT                   RIVYCSINGYGENGPYSGLPNHDINTVGVAGLLDPDLFSDGMSRPLTVQVADVGSALLC
FT                   VIGVLSLLLRGVGGRVEVSMMESALLFNALNMAMTYEGADPSLTGKYPFYNVYRCRDGY
FT                   ITIGAIETKFWQGLCRALNREDLINRQFDKGAINELSKELSKYTVAEALELLWRHDVPA
FT                   APVNSIRNLGKDPQLIARGFNEKDFLNPLRINDARPKTRGSAPRLGENTVEILTELGLS
FT                   RDEIEGLAKRGVVVRLDK"
FT   gene            complement(281736..282251)
FT                   /locus_tag="Vdis_0282"
FT   CDS_pept        complement(281736..282251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0282"
FT                   /product="thioesterase superfamily protein"
FT                   /note="COGs: COG2050 Uncharacterized protein possibly
FT                   involved in aromatic compounds catabolism; InterPro
FT                   IPR003736:IPR006683; KEGG: sto:ST0061 hypothetical protein;
FT                   PFAM: thioesterase superfamily protein; SPTR: Q976X8
FT                   Putative esterase ST0061; PFAM: Thioesterase superfamily;
FT                   TIGRFAM: uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49689"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E1QT97"
FT                   /protein_id="ADN49689.1"
FT                   /translation="MSAWDELIKGVGSISSIKELFLKARSAGFNVAELMNNYLRSEPLF
FT                   NFIGLEFVEIGDGFVRAVFPYKREILRKGGMVHGGVVMTVIDTVLGTAVMTVNDGVDQY
FT                   TAELKVHFLEPLVNGPFTVEGRVIRAGRHLAVAEAHVYDANKKLCAVGIGTWFMVKNSG
FT                   QRGDNRNS"
FT   gene            complement(282318..283520)
FT                   /locus_tag="Vdis_0283"
FT   CDS_pept        complement(282318..283520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0283"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="COGs: COG0019 Diaminopimelate decarboxylase;
FT                   InterPro IPR000183:IPR009006:IPR002986; KEGG: cma:Cmaq_0523
FT                   diaminopimelate decarboxylase; PFAM: Orn/DAP/Arg
FT                   decarboxylase 2; SPTR: A8MC62 Diaminopimelate
FT                   decarboxylase; TIGRFAM: diaminopimelate decarboxylase;
FT                   PFAM: Pyridoxal-dependent decarboxylase, C-terminal sheet
FT                   domain; Pyridoxal-dependent decarboxylase, pyridoxal
FT                   binding domain; TIGRFAM: diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49690"
FT                   /db_xref="GOA:E1QTH5"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTH5"
FT                   /protein_id="ADN49690.1"
FT                   /translation="MSNCVVGNGISLMELADRFGTPLIVYDLGRVEENYRVIKEATGAR
FT                   VLYSIKANPNLAILTFLRKLGSGADAASPGEIFLALKAGFEPGNILYTGAFRSINDIKY
FT                   GIDAGVIFNFDSRREFERALSLGYKPKTAFFRVDLGYGRGFAPGVVLAGEESKFGMFLD
FT                   DAVEAYRLARDVGVGEFGIHAMMGSNVLDADYFIKIAELLKEYAEAIEDRVGIRIRYFD
FT                   MGGGFGIPYRPDEKPLDLGRLGVLRNFFPGELWVEPGRFIVGNAGYLVTRVTEVKRKGG
FT                   RTFVGVDVGMNVLIRPMLYGAYHHIITCSNNEEREVVDVVGPICENTDKLAIGRELPRV
FT                   REGDLLIILNAGAYVYSMSGNYNGRPRPAEVVVYGNEYGIARFRESLESLVAGQVIPSF
FT                   I"
FT   gene            complement(283557..284150)
FT                   /locus_tag="Vdis_0284"
FT   CDS_pept        complement(283557..284150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0284"
FT                   /product="ribosomal protein L5"
FT                   /note="COGs: COG0094 Ribosomal protein L5; InterPro
FT                   IPR002132; KEGG: cma:Cmaq_1831 50S ribosomal protein L5P;
FT                   PFAM: ribosomal protein L5; SPTR: A8MB19 50S ribosomal
FT                   protein L5P; PFAM: ribosomal L5P family C-terminus;
FT                   Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49691"
FT                   /db_xref="GOA:E1QTH6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR022804"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTH6"
FT                   /protein_id="ADN49691.1"
FT                   /translation="MPAIDLTQIDLKSLTPDQVDWRKFVLPADHPMRVIRIEKVVANIG
FT                   VGQSGERLEKAAKVLEELTMQKPSYRLAKKSIKDWNIRKGEPIGVAVTLRRNKAVWFLL
FT                   RTLAAVDFTLRESSFDDWGNVAFGIREHIMIPGTKYDPAVGVWGLNVATVLARPGLRVM
FT                   YRRRARHDVGREQRVSKAEAMKFFQEVLGVKIIK"
FT   gene            284288..285676
FT                   /locus_tag="Vdis_0285"
FT   CDS_pept        284288..285676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0285"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR005829:IPR016196:IPR011701; KEGG:
FT                   cma:Cmaq_1618 major facilitator transporter; PFAM: major
FT                   facilitator superfamily MFS_1; SPTR: A8M9X0 Major
FT                   facilitator superfamily MFS_1; PFAM: Sugar (and other)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49692"
FT                   /db_xref="GOA:E1QTH7"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTH7"
FT                   /protein_id="ADN49692.1"
FT                   /translation="MSSKTPFEPLDRSKPTPGHLKLLFISGAGFFADAYDLFAISIALV
FT                   FLKQVWSLTTSEISLISSAALFGAVIGPFIFGRIGDIFGRKYIYGVEAALLTAGAIASA
FT                   LSINPTTLWITRFILGLGVGGDYPISATLMSEYAPARSRGLFVAGVFSMQGWGIVTAAL
FT                   LGLGLLNAKVNPDLAWRIILGFGAVMPALVIYFRRRVHETPRFEYFVRGNVEGAKRAIR
FT                   DVLRQDVEINGVRNHDNGFRSNFIRYLPVVLGTAIPWFALDVFFYGVNIFGPFVTSAMG
FT                   LAKSPLAGIYVQLYVVLAFLVPGYYVAALLVDKMGRKAMQIMGFSIVAATYLVAALLLR
FT                   NGIVNPVIILALYGLAQFFTNVGPNVTTFILPTEVFPTRFRTTGHGIAAGSGKLGATIA
FT                   ALLIPLYFPITSSALSTVAKYVVMSNLLLVLVIMAIIGIVFTALFINEPKGKSLELSSG
FT                   ELTT"
FT   gene            285710..286129
FT                   /locus_tag="Vdis_0286"
FT   CDS_pept        285710..286129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0286"
FT                   /product="protein of unknown function DUF86"
FT                   /note="COGs: COG2445 conserved hypothetical protein;
FT                   InterPro IPR008201; KEGG: cma:Cmaq_1437 hypothetical
FT                   protein; PFAM: protein of unknown function DUF86; SPTR:
FT                   A8M943 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49693"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTH8"
FT                   /protein_id="ADN49693.1"
FT                   /translation="MSVSREFVKNLIRDIEYAVREVNRIASKSYDELSDEDKMAIRYEL
FT                   IVIAEALMALVMHIVRRGLNERPKTPINALMMARDRGLLTMNEYEDLTKLVRLRNLLVH
FT                   RYWVIDDYLIYRSIKSDFKSLASFIDRLRSRYGIR"
FT   gene            286116..286517
FT                   /locus_tag="Vdis_0287"
FT   CDS_pept        286116..286517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0287"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="InterPro IPR002934; KEGG: tpe:Tpen_1692 DNA
FT                   polymerase beta subunit; PFAM: DNA polymerase beta domain
FT                   protein region; SPTR: A1S0V7 DNA polymerase, beta domain
FT                   protein region; PFAM: Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49694"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTH9"
FT                   /protein_id="ADN49694.1"
FT                   /translation="MAFDEGYTYHSISREERESLISRIRDVLREYGVSLGIVFGSFVDL
FT                   DEFRDIDIAVYGKDIDLNKVLSLGTRLEEVLGIPVDVVSLMDVDPEFRLSILERGIVIL
FT                   EDVDGLYEALISETLDELYLVRHGEDLVQ"
FT   gene            complement(286506..286853)
FT                   /locus_tag="Vdis_0288"
FT   CDS_pept        complement(286506..286853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR001969:IPR001995:IPR009007; KEGG:
FT                   cma:Cmaq_1783 hypothetical protein; SPTR: A8MAX7 Putative
FT                   uncharacterized protein; PFAM: Retroviral aspartyl
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49695"
FT                   /db_xref="GOA:E1QTI0"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTI0"
FT                   /protein_id="ADN49695.1"
FT                   /translation="MGYVWVDAELISGDREVRVKALVDSGATLTVIPRALAVELGLRVT
FT                   DRGVVMTVGGPVNVEFSEVRVRLMGREATVRVVISDIIDKVLIGITTLEILGLMIDPMT
FT                   GTLKEAPYLLY"
FT   gene            complement(286904..287764)
FT                   /locus_tag="Vdis_0289"
FT   CDS_pept        complement(286904..287764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpe:Tpen_1757 hypothetical protein; SPTR:
FT                   A1S122 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49696"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTI1"
FT                   /protein_id="ADN49696.1"
FT                   /translation="MVSRDEVRKIVLELIRTDEEFRLAIAGALGLDSILNELKALRQDF
FT                   NAMLSRIVSIEEELKRHGEVLQEHARILEEHTRLLQEHSKALEENRRLLEEHGRLLEEH
FT                   GRILNEHTRLLQEHGSKLDEHGKVLQSHSAKLDELTRDVQDIKRTLNQMNRTLQKLTYS
FT                   IEDEALDVVSWRLRERLGINVRLGRLVITEGGREVLELNIYGVIDDLCVVGDSTLDLRV
FT                   GKVGELMGVINELRSRYPQYLRPRVVKVLYCMRYVPEAIEEARKNGIWVLTWREELTPL
FT                   EVSST"
FT   gene            288671..288868
FT                   /locus_tag="Vdis_0290"
FT   CDS_pept        288671..288868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cgt:cgR_2293 hypothetical protein; SPTR:
FT                   A4QGD2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49697"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTI2"
FT                   /protein_id="ADN49697.1"
FT                   /translation="MVIFRKVLIPGFPRLSVDEYFLELIKRRKMGMRKLGYMRKKAVLT
FT                   RLVSVEEYGGEGEGKAEERK"
FT   gene            288828..289115
FT                   /locus_tag="Vdis_0291"
FT   CDS_pept        288828..289115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tne:Tneu_1709 hypothetical protein; SPTR:
FT                   B1YAI0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49698"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTI3"
FT                   /protein_id="ADN49698.1"
FT                   /translation="MAVRVRVRLRSGSRDVVTSAVINTGFETDTPNIAIPTPLARMLGL
FT                   WPLSGGELISLETGGGETEAYLVNNALSLSLELEDRVVGPIMVNAIINPI"
FT   gene            289121..289240
FT                   /locus_tag="Vdis_0292"
FT   CDS_pept        289121..289240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2875 hypothetical protein; SPTR: Q8ZUA5
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49699"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTI4"
FT                   /protein_id="ADN49699.1"
FT                   /translation="MLISDYVTTQLGIVILNAKEGLWRLMDENKVRKSVEPTY"
FT   gene            289461..290078
FT                   /locus_tag="Vdis_0293"
FT   CDS_pept        289461..290078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1923 hypothetical protein; SPTR:
FT                   A8MBK7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49700"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTI5"
FT                   /protein_id="ADN49700.1"
FT                   /translation="MYVVFGVTSGMSSVVFEGRYKGPNDVRDVHVSDVPRINHVLHSFV
FT                   ITNDVNDFVIWTFDIPGYETHIYSMIKERATLLLCPRIDNSTYLLPDASLVNELNSMLY
FT                   KDARSATYFVRPTDRSFVSKVLRDTVSAARALIMEKVSNLLRSRGLATIRLMDELGGIS
FT                   DDMITAAKLWASKGFANEVDGVYSMVDYVRSSLELKRSRSRR"
FT   gene            complement(290096..290818)
FT                   /locus_tag="Vdis_0294"
FT   CDS_pept        complement(290096..290818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0294"
FT                   /product="Threonyl/alanyl tRNA synthetase SAD"
FT                   /note="COGs: COG2872 metal-dependent hydrolase related to
FT                   alanyl-tRNA synthetase HxxxH domain; InterPro
FT                   IPR018165:IPR018163:IPR018164:IPR012947; KEGG:
FT                   cma:Cmaq_1257 threonyl/alanyl tRNA synthetase SAD; PFAM:
FT                   Threonyl/alanyl tRNA synthetase SAD; Alanyl-tRNA
FT                   synthetase, class IIc-like; SPTR: A8ME78 Threonyl/alanyl
FT                   tRNA synthetase SAD; PFAM: Threonyl and Alanyl tRNA
FT                   synthetase second additional domain; tRNA synthetases class
FT                   II (A)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49701"
FT                   /db_xref="GOA:E1QTI6"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTI6"
FT                   /protein_id="ADN49701.1"
FT                   /translation="MPTKFLYWWDSYRREFDATVTRIDGNRVWLDQTLFHPRSGGVAND
FT                   TGRLIWQGEEYVVKEVIKEGEDAVHILDREPRFRVGDTLHGVIDWERRYRLMRLHTATH
FT                   IIAALAYKKYNALVTGGDITPEYARDDYNLTLSGDALRKAFQDLIAEANEIVRRGIPVK
FT                   IYFLRREEAMKIPGVVKLAEREPPPGDEWRIVEIEGIDIQADGGPHVANTREIGEIVFL
FT                   KSESRGKDKKRVYYTVKP"
FT   gene            complement(290856..292100)
FT                   /locus_tag="Vdis_0295"
FT   CDS_pept        complement(290856..292100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0295"
FT                   /product="acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro
FT                   IPR001261:IPR011650:IPR010182:IPR002933; KEGG:
FT                   cma:Cmaq_0553 succinyl-diaminopimelate desuccinylase; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; SPTR:
FT                   A8MC90 Acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase; TIGRFAM:
FT                   acetylornithine deacetylase or succinyl-diaminopimelate
FT                   desuccinylase; PFAM: Peptidase family M20/M25/M40;
FT                   Peptidase dimerisation domain; TIGRFAM: acetylornithine
FT                   deacetylase or succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49702"
FT                   /db_xref="GOA:E1QTI7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTI7"
FT                   /protein_id="ADN49702.1"
FT                   /translation="MSQNLKTGLIELTSHLIQIPSVNPPGYTVNIAGFIRDWLGERGFK
FT                   SEFREYAKDKPNVIARVGRGKPVLILNGHMDVVPPGDDSRWVYPPFSGKIVEGRIYGRG
FT                   ATDMKGGLAVIMMVFTELAPLIERQGSGTLIFSATADEETGGHPGVEALVRDGVLVGDA
FT                   AIVAEPSGSSRYYIGEKGLCQVKLVTRGRPAHGSLPILGENAIMKLAAAIARAEELINE
FT                   FNKGIKLPSELTEAIRNSAEVYLEAARASGLNLTLSDFERVVGTVSFNPGVVRGGSKIN
FT                   MVPDYAELELDMRVPPGVSPSQVINHLRSGLSGIADVEVLDTSEPNYTSPGEVIVRIIH
FT                   EGIERVLGATPRPIIVTGATDGRYLRARGIPTVVYGPGELALAHAYNEYVTVDDLVRTH
FT                   DVMLYAIRRFFGIPA"
FT   gene            292218..292442
FT                   /locus_tag="Vdis_0296"
FT   CDS_pept        292218..292442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_0554 hypothetical protein; SPTR:
FT                   A8MC91 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF3311)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49703"
FT                   /db_xref="GOA:E1QTI8"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTI8"
FT                   /protein_id="ADN49703.1"
FT                   /translation="MYSRPKLSKENLVKIILLIIVPWLFIVFLAPLYNRPYPQIGGWPF
FT                   LWWYLFAWVFIQPIITYIVYRLIDKGGKS"
FT   gene            292439..293905
FT                   /locus_tag="Vdis_0297"
FT   CDS_pept        292439..293905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0297"
FT                   /product="Na+/solute symporter"
FT                   /note="COGs: COG0591 Na+/proline symporter; InterPro
FT                   IPR001734; KEGG: cma:Cmaq_0555 Na+ symporter; PFAM:
FT                   Na+/solute symporter; SPTR: A8MC92 Na+ symporter; PFAM:
FT                   Sodium:solute symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49704"
FT                   /db_xref="GOA:E1QTI9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTI9"
FT                   /protein_id="ADN49704.1"
FT                   /translation="MMFTAIDYTIFFVLVGLTIIAGFLGAKWRAPDFSKISEWSIGGMK
FT                   FGTVIVWFLMGADIYTAYSLVAIPGSAYALGGFILYAVVYGSISYPFLYIVATKFYRIA
FT                   KRRGYITAGDYVRDRFDSRILSLLISLTGIIAMLPYIALQIVGIRYVLDAMGFPVIPSF
FT                   IIAYIIVAAFVAISGLRGPALSSLIKDVLLWAVILTIVIALGIRFTGFGPIFSEIGPSH
FT                   YLIPSKLMLGYITLAFASGISWLLFPNLLVGLLGSKSEEIIRKNSIFLPLYQVWLILLA
FT                   IMGLVALAKNLVPHGISSLAFPSVISAYFPSYFVALAFAGIVIGSMVPAGLQSLGAANL
FT                   IARNIYVDFINKRATEKQQVLWGRVSVFIMIIASLIFAITPAASGLIFYLLTFSYAWLL
FT                   QTLPAIILSMYWYDLDKYSVAAGWAVGTVFVTYGLATVKFSSSLLPWFYNIYVGFLGLV
FT                   LNLVVMLVVYAVVKALKVKTTSKLTPQELM"
FT   gene            complement(293935..294972)
FT                   /locus_tag="Vdis_0298"
FT   CDS_pept        complement(293935..294972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0298"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0079 Histidinol-phosphate/aromatic
FT                   aminotransferase and cobyric acid decarboxylase; InterPro
FT                   IPR004838:IPR015424:IPR015421:IPR004839; KEGG: pai:PAE0377
FT                   CobC aminotransferase, conjectural; PFAM: aminotransferase
FT                   class I and II; SPTR: Q8ZZ90 CobC aminotransferase,
FT                   conjectural; PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49705"
FT                   /db_xref="GOA:E1QTJ0"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTJ0"
FT                   /protein_id="ADN49705.1"
FT                   /translation="MGNIIGGARGHGGYGWRYGLIDMSSNMNPLGTPKELIKLIEEGVV
FT                   NGHYSHYPTELGDELRDSLAGFEGVRPEFTYVFNGATEALQLLLMYLRPHRILIPIPNY
FT                   SDYLRLGRLINADIRLIEYWGYGDLVNSLIDGVVSNTAVILSNPNSPMGYLIKRESLIG
FT                   LAEELYRRGGVLVVDESFMDFVKSNESLIRDSLRYDNVFVVKSYTKFLAIPGLRVGAVY
FT                   TKANIEDLVPTWPVNSIAEYAVSRYMKHARGFRELTIKYVEEERSRVLNSLRSLGISYY
FT                   ESTTHYFVIRHQPWLNEELLKRGFLIRDLSNIPPLTEGYFRVSIKTREVDDSLLNALLE
FT                   IMKIT"
FT   gene            295037..295477
FT                   /locus_tag="Vdis_0299"
FT   CDS_pept        295037..295477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0299"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="COGs: COG1695 transcriptional regulator protein;
FT                   InterPro IPR011991:IPR005149; KEGG: cma:Cmaq_0411 PadR-like
FT                   family transcriptional regulator; PFAM: transcriptional
FT                   regulator PadR family protein; SPTR: A8MBR3 Transcriptional
FT                   regulator, PadR-like family; PFAM: Transcriptional
FT                   regulator PadR-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49706"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTJ1"
FT                   /protein_id="ADN49706.1"
FT                   /translation="MMHGHGHFGPPPQWFIKRRGLKYLILYLLSSRGPMTGAQIIDEIE
FT                   RLSMGFWRPSPGSVYPALEELESDGLIRVARVEGTKKYYEITDSGKAYIGLPSIDKTTA
FT                   AVNDFVSLARYIIDNWDTLSEADRNRVRDVLRDLIKTANIQC"
FT   gene            complement(295474..296508)
FT                   /locus_tag="Vdis_0300"
FT   CDS_pept        complement(295474..296508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_0995 hypothetical protein; SPTR:
FT                   A8MDH0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49707"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTJ2"
FT                   /protein_id="ADN49707.1"
FT                   /translation="MLITRLGIKGFYGINTSIELGPLTVITGSPGSGKSMIIELLWRFF
FT                   RGIRDRLFLEDLPRVGDARIDVTISLDDRVKKRLEEVGYSGDSVTISVGLDDGYVSVVK
FT                   VGEREVMVAEFRSGVSRVKYPLDVDVVDASILLNPDGLAPKEQALQLVGSASEDYETAL
FT                   SVIKAIREYLLSVGIYKIGPYIDFRGRVKNTEISQPDFIGEHGEHIIEILSQLFTDPRR
FT                   DSDVRFLRKVLGELGFRNFRAGWYGGELVLSYVDKRGLVHIGDELPCHIKTILALTTQL
FT                   IVARKPSLILLENADYCLSEGLGNAVTKLLGNYIDSRQLIMEVRNKWFIDELKMPHVVL
FT                   YSMD"
FT   gene            296649..297848
FT                   /locus_tag="Vdis_0301"
FT   CDS_pept        296649..297848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0301"
FT                   /product="aminotransferase class V"
FT                   /note="COGs: COG0075 Serine-pyruvate aminotransferase/
FT                   aspartate aminotransferase; InterPro
FT                   IPR015424:IPR015421:IPR000192; KEGG: mth:MTH1601 aspartate
FT                   aminotransferase; PFAM: aminotransferase class V; SPTR:
FT                   Q59569 Aspartate aminotransferase; PFAM: Aminotransferase
FT                   class-V"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49708"
FT                   /db_xref="GOA:E1QTJ3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTJ3"
FT                   /protein_id="ADN49708.1"
FT                   /translation="MDLDLAPDPLLAIPGPSQIPPRVMKALMRIVDHRSPHFHKLYRDV
FT                   VDGLRYVFRTNGDVYPITASGTGAVETMVLNFVRPKDTVLVPVFGSFSRRLVNHLRRAG
FT                   AEVIEVDYGWNRAPTYDDLRAKVESMGIKQIDVFATVYNDTSPGTVFRDLPKVVRWIKS
FT                   YGALVLVDNVSALGGDYFEVDSWGIDVAVSSSQKCLAAPPVMSFIAVASSEAYRKADSV
FT                   NHPSIYFDIKLMRKFGEKFETPFTPAVNYLFAIREALGIIREVGLENWIRWHIERGRAI
FT                   LNALTKAGLEPFISNDYYRSTTVLSFKYPAGVNPDEFRRTIYRFGVSISDGMDEVKGKA
FT                   FRIGNMGYLTRKDVLTLVSSIIAVSLINGGNNASNDAIKDVFREVLNYWEPEQLSVGEG
FT                   "
FT   gene            complement(297831..298184)
FT                   /locus_tag="Vdis_0302"
FT   CDS_pept        complement(297831..298184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1357 hypothetical protein; SPTR:
FT                   A8M8W4 Putative uncharacterized protein; PFAM: Succinate
FT                   dehydrogenase/Fumarate reductase transmembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49709"
FT                   /db_xref="GOA:E1QTJ4"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTJ4"
FT                   /protein_id="ADN49709.1"
FT                   /translation="MGMVNASTLRRWQYILGIVLIVVLGIHLAFRWPSYEQSISYPVVV
FT                   NQILNYGYIAAIYILLYAALAHGLIGFRTLLLELWHWKYARITVDVVLIIIGVAVAVIG
FT                   TIALTGAILTLAH"
FT   gene            complement(298184..298660)
FT                   /locus_tag="Vdis_0303"
FT   CDS_pept        complement(298184..298660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0303"
FT                   /product="succinate dehydrogenase/fumarate reductase,
FT                   cytochrome b subunit"
FT                   /note="KEGG: cma:Cmaq_1356 succinate dehydrogenase/fumarate
FT                   reductase, cytochrome b subunit; SPTR: A8M8W3 Succinate
FT                   dehydrogenase/fumarate reductase, cytochrome b subunit;
FT                   PFAM: Succinate dehydrogenase/Fumarate reductase
FT                   transmembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49710"
FT                   /db_xref="GOA:E1QTJ5"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTJ5"
FT                   /protein_id="ADN49710.1"
FT                   /translation="MRMAQQKQVKRVPPKWSLWFRGLDEWLLIFQKVSGAILVIYLIAH
FT                   TLVISTALGFGHPSEITWNTVIGFVEGPHVAGPAHVGTIIEYLIALLAAVHGANGFRLI
FT                   LTQYFGVGLPRPERHTFPRAVPSVKKTGQAWLKYIAVIVVVIFLILATLVAFVW"
FT   gene            complement(298660..299472)
FT                   /locus_tag="Vdis_0304"
FT   CDS_pept        complement(298660..299472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0304"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="COGs: COG0479 Succinate dehydrogenase/fumarate
FT                   reductase Fe-S protein subunit;
FT                   InterProIPR006058:IPR017900:IPR001041:IPR017896:IPR
FT                   009051:IPR004489:IPR012675:IPR012285:IPR001450; KEGG:
FT                   cma:Cmaq_1355 succinate dehydrogenase iron-sulfur subunit;
FT                   PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   ferredoxin; PRIAM: Succinate dehydrogenase; SPTR: A8M8W2
FT                   Succinate dehydrogenase and fumarate reductase iron-sulfur
FT                   protein; TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49711"
FT                   /db_xref="GOA:E1QTJ6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTJ6"
FT                   /protein_id="ADN49711.1"
FT                   /translation="MSSQQSGGALQAAVATEKITITKPPLGSPIKRTYTFRVKRYDPER
FT                   GGYYWREYKIELSNHETVLDGLIKIKWYQDATLSFRYSCRMGICGSCGMIINGTPRLAC
FT                   ETKPYDLGTEVITVEPLSNFEPIKDLAADFSEFFRKHRSVRPWLIRKDETEQFEKLESY
FT                   YPQTEEQLSEYLEFAYCIKCGLCYSACPMVFLNRDYLGPQALAQAYRWSADNRDEGAVL
FT                   RLKVVDSENGIWSCHYSGTCSKVCPKDVDPALAINLLKNWLLTGRRRR"
FT   gene            299612..300358
FT                   /locus_tag="Vdis_0305"
FT   CDS_pept        299612..300358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0305"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="COGs: COG1709 transcriptional regulator protein;
FT                   InterPro IPR001387:IPR010982:IPR017271; KEGG: cma:Cmaq_1149
FT                   helix-turn-helix domain-containing protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; SPTR: A8MDX0 Helix-turn-helix domain
FT                   protein; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49712"
FT                   /db_xref="GOA:E1QTJ7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017271"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTJ7"
FT                   /protein_id="ADN49712.1"
FT                   /translation="MVEYEGFITDIMIRIAGDIVLSDNPGKGIRKWREFFEMSQAELAA
FT                   RLGTSPSVISDYESGRRKSPGSQFIKKVVKALVDYELEKGGQKLYILSKQLGGERFWEA
FT                   ILDMRDFDIPVEINDFVKAIGATLAVGPEGYVDIHGYTVVDSLKLVLDVPSSEYLKLYG
FT                   STTQRAAVFTNVRYGRSPLIAIKSMMAFTNLRPAVVVMHGVDKPDYLGLEIARREHIPL
FT                   AIINSSIDELLTALRNLAERQRAITR"
FT   gene            complement(300364..300900)
FT                   /locus_tag="Vdis_0306"
FT   CDS_pept        complement(300364..300900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0306"
FT                   /product="adenylate kinase, conjectural"
FT                   /note="COGs: COG0237 Dephospho-CoA kinase; KEGG:
FT                   pas:Pars_1986 adenylate kinase, conjectural; SPTR: A4WMB6
FT                   Adenylate kinase, conjectural; PFAM: Shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49713"
FT                   /db_xref="GOA:E1QTJ8"
FT                   /db_xref="InterPro:IPR022970"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTJ8"
FT                   /protein_id="ADN49713.1"
FT                   /translation="MLVIVITGLPGSGKTIASDVARELGLPVVTMGDVIRDEAIKSGIS
FT                   SSTASVTLRLRGGTRAIAYKTLEKIPKQSNIVVIDGARSIREIEAIEEALSTRVVLIYV
FT                   VAPWKARFERLLRRGRPDDPRTIEDFLMRDLRELRYGLGDLIARADYIVVNESSIEEFR
FT                   ENVRRILTSLISQAG"
FT   gene            complement(300930..302090)
FT                   /locus_tag="Vdis_0307"
FT   CDS_pept        complement(300930..302090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0307"
FT                   /product="tRNA (guanine-N(2)-)-methyltransferase"
FT                   /note="COGs: COG1867 N2 N2-dimethylguanosine tRNA
FT                   methyltransferase; InterPro IPR002905; KEGG: cma:Cmaq_1309
FT                   N(2),N(2)-dimethylguanosine tRNA methyltransferase; PFAM:
FT                   N2N2-dimethylguanosine tRNA methyltransferase; PRIAM: tRNA
FT                   (guanine-N(2)-)-methyltransferase; SPTR: A8M8R7 tRNA
FT                   (Guanine-N(2)-)-methyltransferase; PFAM:
FT                   N2,N2-dimethylguanosine tRNA methyltransferase; TIGRFAM:
FT                   tRNA(guanine-26,N2-N2) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49714"
FT                   /db_xref="GOA:E1QTJ9"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042296"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTJ9"
FT                   /protein_id="ADN49714.1"
FT                   /translation="MSEYPKVEIREGLVSVIVPDLSKYIVGNRPEPAHAPVFYNPRMEV
FT                   NRSLSTAIINGYIGYMNKAGITICEPLSGTGVRAVRYAREVNGVSRVIANDISERAYEL
FT                   IRLNVDKNGLNDVVSVYRDDANNLLLRLAREGGCDVVDIDPFGSPQPFIENSLRAVRDQ
FT                   GLLCVTATDVGVLSGKYPIKCVRRYGALPQKFPFRFEVGIRILISMIARYALSMDYGIQ
FT                   PLVSFLDGHYYRVCVLILKDRAYALETLRNLGYAYYRLSTLQRGFIPGYPIPTNTRYRL
FT                   AGPLWIGNLWDAEFLMNHFMSNVKDYFSDRAREISKLIVEEALGPNIPYALTTEISRDL
FT                   GRELPINDVIGVIRGLGYQAVRSHFHIKGFRTNADLLRVREVIIGK"
FT   gene            complement(302107..302970)
FT                   /locus_tag="Vdis_0308"
FT   CDS_pept        complement(302107..302970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0308"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="COGs: COG1395 transcriptional regulator protein;
FT                   InterPro IPR001387:IPR010982; KEGG: cma:Cmaq_1687
FT                   helix-turn-helix domain-containing protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; SPTR: A8MAD3 Helix-turn-helix domain
FT                   protein; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49715"
FT                   /db_xref="GOA:E1QTK0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR020886"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTK0"
FT                   /protein_id="ADN49715.1"
FT                   /translation="MILKVMSNELITHVLSLAASRRAKVLLVGDSSLSYDAIIRIPNYR
FT                   GNEEGKFIVKVKEDAERVSKEAIVDLIVLSRVSNSTPIIVGINYGDEEMADGVAYKVHG
FT                   IYAVGIRTFKRILDNEGVKFVKDKGIVRAGVKGQLLRRLREDRGMSLGDLAKILGVTRR
FT                   TVYEYERESMEASERTARILIEIFSKDVLNDVNLRPRDEEVINEVREREDMVDEDIREL
FT                   LPSFRLYSLMKAHTKVAAHSPSESYLVEDKRRVSNEVFSVAKVLGVGLALIESDKRDVE
FT                   FLESRN"
FT   gene            complement(303015..303731)
FT                   /locus_tag="Vdis_0309"
FT   CDS_pept        complement(303015..303731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0309"
FT                   /product="fibrillarin"
FT                   /note="COGs: COG1889 Fibrillarin-like rRNA methylase;
FT                   InterPro IPR020813:IPR000692; KEGG: cma:Cmaq_1310
FT                   fibrillarin; PFAM: fibrillarin; SPTR: A8M8R8 Non-specific
FT                   serine/threonine protein kinase; PFAM: Fibrillarin"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49716"
FT                   /db_xref="GOA:E1QTK1"
FT                   /db_xref="InterPro:IPR000692"
FT                   /db_xref="InterPro:IPR020813"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTK1"
FT                   /protein_id="ADN49716.1"
FT                   /translation="MSSLIQVVGVKEHEKFKGVYWVSFEDGTERLATINLTPGKRVYGE
FT                   QLIQWEGREYRIWNPYRSKLAAAIMNGLKIMPIMEGTRVLYLGAASGTTVSHVSDIVGN
FT                   EGIIYSVEFSPRVFREFMEKLVDQGRKNVIPILADARYPEQYVHIVKSVDVAYIDIAQP
FT                   FQAKILADNADVYVKSHGYVMLVIKAMSIDVTKEPSETFKREIDVLKDRGYEILDMVHL
FT                   EPYDTAHAMVIGRKTS"
FT   gene            complement(303774..305039)
FT                   /locus_tag="Vdis_0310"
FT   CDS_pept        complement(303774..305039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0310"
FT                   /product="Pre-mRNA processing ribonucleoprotein, binding
FT                   domain protein"
FT                   /note="COGs: COG1498 Protein implicated in ribosomal
FT                   biogenesis Nop56p homolog; InterPro IPR012976:IPR002687;
FT                   KEGG: cma:Cmaq_1284 pre-mRNA processing ribonucleoprotein,
FT                   binding region; PFAM: Pre-mRNA processing
FT                   ribonucleoprotein, binding domain protein; NOSIC domain
FT                   protein; SPTR: A8M8P2 Pre-mRNA processing
FT                   ribonucleoprotein, binding region; PFAM: Putative snoRNA
FT                   binding domain; NOSIC (NUC001) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49717"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR036070"
FT                   /db_xref="InterPro:IPR042239"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTK2"
FT                   /protein_id="ADN49717.1"
FT                   /translation="MSVAYLVLDVLGVVALNENGDVIAKVLYEGSTDEIADKMNKLETG
FT                   EPIDEVVKIINELKNRGITKVVVENRELARNLANMVAGVEVRSELPSKAGIMYRNNIGR
FT                   YVKEVFGLTEDEYLARIHEITTVQTRHKLRQVAEKRDLFIAQAISSVDDLDKILNLISS
FT                   RVREWYGLHFPELEDLVKDHKEYMTLVTELGHRSNFTPDNLTKLGLSQDRAKRIAEAAS
FT                   KSVGAEMADWDLEPIRTYARLYIQLSDLRSKLSQYIDEAMVEVAPNIRELVGPLLGARL
FT                   IMLAGGLMRLALLPASTIQVLGAEKALFRALRTGGKPPKHGVIFQFPEIFRAPRWQRGK
FT                   IARALAAKLAIAAKADAFTGNFIAPRLKEDLMKRIQEVKTLYAKPPPRKPEAKAARKAP
FT                   EKKGAEKKAEEKRAREKRGGRR"
FT   gene            complement(305086..305607)
FT                   /locus_tag="Vdis_0311"
FT   CDS_pept        complement(305086..305607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0311"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sto:ST1169 hypothetical protein; SPTR: Q972G4
FT                   Putative uncharacterized protein ST1169"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49718"
FT                   /db_xref="GOA:E1QTK3"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTK3"
FT                   /protein_id="ADN49718.1"
FT                   /translation="MNLVRIGIALMIIGVAILLVTNSFLPRVYNVMTNTLNNVTVSIDV
FT                   YSRYLIPIYINSPAYIVVLLNNSYPLSVYLSDQFGHVLTPSSYKQVRNAYLITFQLPNH
FT                   GNYSLVLFNDNPKPLNVSVLITVISQYVVSNALLVNAVMDLGAVIFIVGALLVLINVLF
FT                   IARYKLLKTR"
FT   gene            complement(305661..305957)
FT                   /locus_tag="Vdis_0312"
FT   CDS_pept        complement(305661..305957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1859 hypothetical protein; SPTR:
FT                   A8MB47 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49719"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTK4"
FT                   /protein_id="ADN49719.1"
FT                   /translation="MRKISYSKLMSFIRGNPLYEVREGPDTVELLFHAPSEEEAAGTEF
FT                   ISSDEPRPVMRIVFARVGDELIPREAWVERGNVIQRMSIDELDTWLEFVDMYS"
FT   gene            complement(306044..306883)
FT                   /locus_tag="Vdis_0313"
FT   CDS_pept        complement(306044..306883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0313"
FT                   /product="protein of unknown function DUF81"
FT                   /note="COGs: COG0730 permease; InterPro IPR002781; KEGG:
FT                   cma:Cmaq_0755 hypothetical protein; PFAM: protein of
FT                   unknown function DUF81; SPTR: A8MCT5 Putative
FT                   uncharacterized protein; PFAM: Sulfite exporter TauE/SafE"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49720"
FT                   /db_xref="GOA:E1QTK5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTK5"
FT                   /protein_id="ADN49720.1"
FT                   /translation="MTIAITPIQYALSIVSGVLVGFSLGLIGGGGSILAVPLFLYFVGL
FT                   DTIPDAAHIAIGTTALAVGLNAYINSYMHLRKKNVAPKVGGIFAGVGLVGSLIGAYLGH
FT                   ITPGTDLLTYFAIAMIVLGVYMAIRRESTQAGTINEVNHVLDAFNKCPRLTISTILKVA
FT                   VFGFIVGLVSGYFGIGGGFLIVPSLMFSAGLCITRAIGTSLISVGTFGVASGAEYWFYG
FT                   DVLILIALLYVAGGIAGGYAGTSIAVKAPKRTLRIAYGIIIVLVGIYMLMRIYHVLP"
FT   gene            complement(307065..309746)
FT                   /pseudo
FT                   /locus_tag="Vdis_0314"
FT   gene            complement(309965..312148)
FT                   /locus_tag="Vdis_0315"
FT   CDS_pept        complement(309965..312148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0315"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="COGs: COG3808 Inorganic pyrophosphatase; InterPro
FT                   IPR004131; KEGG: cma:Cmaq_0196 membrane-bound
FT                   proton-translocating pyrophosphatase; PFAM: Inorganic H
FT                   pyrophosphatase; PRIAM: Inorganic diphosphatase; SPTR:
FT                   A8MAB3 V-type H(+)-translocating pyrophosphatase; TIGRFAM:
FT                   V-type H(+)-translocating pyrophosphatase; PFAM: Inorganic
FT                   H+ pyrophosphatase; TIGRFAM: vacuolar-type
FT                   H(+)-translocating pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49721"
FT                   /db_xref="GOA:E1QTK6"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTK6"
FT                   /protein_id="ADN49721.1"
FT                   /translation="MLSLELLLAIVVPIIGLALAGYNASSVLRIQPGKKELTEINMLIA
FT                   EGGKTFLMREYKTILPTGVVLTILIWAAYYVIFRSGLMAGLAALSFALGAIGSAVAGYL
FT                   GMYVTTRSAAKTAWMGKYGMGPALSTSFKAGTVMGLSLASIALLIVTVLYMAYSSILPT
FT                   PLWAEALAPVAFGASLISLFIRVAGGIYTKAADWGADIVGKVEAGIPEDDPRNPGVIAD
FT                   NVGDNVGDCAGMASDVYESFVVVLAGALLLAAVFRLATNLIVLSIILATLTLIGTLVGV
FT                   QVVRGEVKGKDLAAAAMGKLNLALYTTIIVSAILVAIYSFMTFPLMEATAIFVSDLLGM
FT                   ITAIVVLFATEYFTHYTFPPVRNIARQAVLSASNVIVAGYSYGLLSAIPTIFMVVAALG
FT                   ISYVLGSMFIPPYGVEGGIFGTAVASVGLLSLAGIVISLDSYGPVSDNANGLVEMTGMD
FT                   EVRDVTDPLDAIGNTFKATTKGYAIASAGLAALILFIGFIYEVVERMGIPLVQAFGELM
FT                   VIDPRIIIGALIGVALVYFFSSRTLASVGKAAGELVEEIRRQFRTKRILELWPQEKPDY
FT                   NRAIDIVTRHALKNFLVPGLSAVIVPIVVGLALGWIGLVGTIFGVILAGFPRALLMANA
FT                   GGAWDNAKKYIEIEGIEVNGQKFGKKSEPHKNAVVGDVVGDPFKDTTGPSLNPLIKVVN
FT                   TVSIVFAPVIAMVSLINPAAGPLIMHLISILMA"
FT   sig_peptide     complement(312089..312148)
FT                   /locus_tag="Vdis_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            312307..312975
FT                   /locus_tag="Vdis_0316"
FT   CDS_pept        312307..312975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_0754 hypothetical protein; SPTR:
FT                   A8MCT4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49722"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTK7"
FT                   /protein_id="ADN49722.1"
FT                   /translation="MSRSLSIQQAVRIIVEENPLYVTLLSSGLVNLSALARSIKPLVDS
FT                   MVGKDTKVFTIVKALERISMNYKLVNEYPDIVKALSMAEIITYSGMGEVEIPLTEENME
FT                   KVAKLRDLLSAAKVQFIILNDGSKMHVIAPLMYIAGVCGQAKVEEYGMVRIMFAERAPV
FT                   GIVTFLVQVMKSNQITAKHVLRYDNDIYVVVEREKTPLLLSIIERLRTMSALQLTQQGK
FT                   "
FT   gene            313129..314223
FT                   /locus_tag="Vdis_0317"
FT   CDS_pept        313129..314223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0317"
FT                   /product="peptidase M24"
FT                   /note="COGs: COG0006 Xaa-Pro aminopeptidase; InterPro
FT                   IPR000994:IPR001131:IPR001714:IPR000587; KEGG:
FT                   cma:Cmaq_1605 peptidase M24; PFAM: peptidase M24;
FT                   creatinase; SPTR: A8M9V7 Peptidase M24; PFAM:
FT                   Metallopeptidase family M24; Creatinase/Prolidase
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49723"
FT                   /db_xref="GOA:E1QTK8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTK8"
FT                   /protein_id="ADN49723.1"
FT                   /translation="MLSINRIEKLIDELRRKSIDLVIIVPGPNFRYLVGSYIETFERFG
FT                   ALIICPGNSAYELILPRLDEGRARATGLPYAVYGDEEGPLNVIKAFINGNCGAVRVIGL
FT                   EGRATLNYLWILRKVIGEFNDYSIDDLLISMRISKDEDELRSIERAVRAIEYGIKAVRE
FT                   SIRPGMMEIEVARLISDAISNAGAEPRDILVQSGPNSAIPHWIPSRRRIEVGDVVVIDI
FT                   TATYNDYYGDLTRTLVIGNPPSDFWRIYDLVKRAHDDAIASIREGVTGAYIDSIARKVI
FT                   ADGGYGQYFIHRTGHGIGLEVHEEPFISQSYDKPLPRGSAFTIEPGIYLPGRFGVRLES
FT                   NVVIGLDGKVEVLDKYWPEVIVRV"
FT   gene            314261..314884
FT                   /locus_tag="Vdis_0318"
FT   CDS_pept        314261..314884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0318"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="COGs: COG0406 Fructose-2 6-bisphosphatase; InterPro
FT                   IPR001345:IPR013078; KEGG: cma:Cmaq_0729 phosphoglycerate
FT                   mutase; PFAM: Phosphoglycerate mutase; SPTR: A8MCQ9
FT                   Phosphoglycerate mutase; PFAM: Phosphoglycerate mutase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49724"
FT                   /db_xref="GOA:E1QTK9"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTK9"
FT                   /protein_id="ADN49724.1"
FT                   /translation="MILYLVRHGEAQLNVLGILHSRNYNDNPLTDKGRLEAAAVALLLH
FT                   RMGVHGPVFTSPLLRARQTADCIDRNYKVDERLREIDMGEWELKKISEIPFDNYRKDPV
FT                   RYHPPGGESMESVVNRVMDFLNFVRGINEKSVIAVSHWHPIATVVALVTGLPLSNIYKL
FT                   RISTGSITAIDLDNDDVLFLNLSPLRVLRSLGLSDDGIMKECIR"
FT   gene            314896..315330
FT                   /locus_tag="Vdis_0319"
FT   CDS_pept        314896..315330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1037 hypothetical protein; SPTR:
FT                   A8MDL0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49725"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTL0"
FT                   /protein_id="ADN49725.1"
FT                   /translation="MSTTCNEVHWRLVELNIDHACGLASLLKVIGKRLGVFDVPNIIDV
FT                   MIYGNHEIVKQALGNTVIVERALVPGLLSRAILIGGIPYASIEDLVVSVTVNKDMPWYV
FT                   GIIRELMANPNVKNSLRWEWINEVLNRFGVAELFNKIISQ"
FT   gene            complement(315317..316435)
FT                   /locus_tag="Vdis_0320"
FT   CDS_pept        complement(315317..316435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0320"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG0535 Fe-S oxidoreductase; InterPro
FT                   IPR007197:IPR017200:IPR006638; KEGG: cma:Cmaq_1900 radical
FT                   SAM domain-containing protein; PFAM: Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; SPTR: A8MBI4
FT                   Radical SAM domain protein; PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49726"
FT                   /db_xref="GOA:E1QTL1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR027634"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTL1"
FT                   /protein_id="ADN49726.1"
FT                   /translation="MHRWPLEEKPLLVFYETTKACPLACRHCRANALLKPLPTELSTEE
FT                   AKRFIEDLTGFGRPYPILILTGGDPLTRDDTLELIDHARSFGIPVALSPAVSTKLLNDD
FT                   ILRELKGRVSSISISLDGAKPETHNYIRRTALERIDVFRTTLEVFNKLRSYGIEFQVNT
FT                   AVMRLNVHELPQVFKIVRDSGANAWEVFFLIRVGRGMELEPLDPWETEDVVQFLYEASL
FT                   YGLPIRTVEAPFFRRIIMQRGSGIKYEGGKLYWELTKQLRELMGDPPSNAKPPSFTPTR
FT                   DGYGIIFVASDGSIYPSGFLPLTLGNVRKDNIVKVYREHPILRTIREARFNGKCGTCEF
FT                   RNICGGSRARAYTELGDPLGSDPACIYEPTAK"
FT   gene            316542..317783
FT                   /locus_tag="Vdis_0321"
FT   CDS_pept        316542..317783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0321"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG0535 Fe-S oxidoreductase; InterPro
FT                   IPR007197:IPR017200:IPR006638:IPR013785; KEGG:
FT                   hbu:Hbut_0037 Fe-S oxidoreductase - metallo cofactor
FT                   biosynthesis protein; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB; SPTR: A2BIS4 Fe-S
FT                   oxidoreductase-metallo cofactor biosynthesis protein; PFAM:
FT                   Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49727"
FT                   /db_xref="GOA:E1QTL2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTL2"
FT                   /protein_id="ADN49727.1"
FT                   /translation="MINITNLVVGSGTVSLSIKGHDYVKSDREFTDISRPLIFWNITYR
FT                   CNLKCIHCYINAIQGLSRDELTTEEALRVVDDAHELRTPLLIISGGEPLIREDITEVMR
FT                   RANEYGIKISLSTNGTLITRDWALKLKELNVQYVGISIDSPIPEIHDRIRGITGAWDLA
FT                   IKGIKNVMEVGIPVGIRTTVTKLNIDHAPEVVELAHKLGISRVAFYHLVPSGRGRGIIN
FT                   LLPSPEQLLRFLMRLIDVAKRYPDVEVLTVDNPADGIVASLLASSDEGEFMSKLRLVGR
FT                   MGACSAGRKVVSIYPNGDVYPCQFFNDRPMGNVRKERLTEIWLRPRVNTELVIRLRERN
FT                   YGDSPCMRCPYLRYCGGCRVRAGVLNNDVWSMDPLCTMNSLLRLWRLGEVDLKPWQVRI
FT                   MREFEESMNISLIK"
FT   gene            317848..319149
FT                   /locus_tag="Vdis_0322"
FT   CDS_pept        317848..319149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0322"
FT                   /product="RNA-metabolising metallo-beta-lactamase"
FT                   /note="COGs: COG1236 exonuclease of the beta-lactamase fold
FT                   involved in RNA processing; InterPro IPR011108; KEGG:
FT                   pai:PAE3309 mRNA 3'-end processing factor, conjectural;
FT                   PFAM: RNA-metabolising metallo-beta-lactamase; SPTR: Q8ZTD5
FT                   mRNA 3'-end processing factor, conjectural; PFAM:
FT                   Metallo-beta-lactamase superfamily; RNA-metabolising
FT                   metallo-beta-lactamase; Beta-Casp domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49728"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTL3"
FT                   /protein_id="ADN49728.1"
FT                   /translation="MTDLMIKVLGGGGEVGRMAIFVKEANSERGFLFDYGVNFDENDRP
FT                   VMPGHVRPRDIMAVFLSHAHLDHCGALPSLYVSSPPPVYATPLTLELADIMFKDAIKLS
FT                   GYYLPYEDEEIKAVLDHAIPVTYGEDVDISKDVKATIINAGHVPGSMLTLLEINGARVL
FT                   FTGDFNLSQSNLLRGADINNVPRDVDVVIMEGTYVTNTHPPREEVEREFIRVIKETIEG
FT                   GGSVLIPVLTIGRAQEILITLYKNGIDYPIIIDGLARIANQIVAKYPHYLANPELYLKA
FT                   VENSLEVTTDYQRKSLTKEPVIIVSPAGMLKGGAAVYYLKKLGRDRRNAIILPSYQAPD
FT                   TPGFELLTRGRTFIDKSEVILEAKLYWFDFSSHSGRAELEAFINHFSPDTKVLLVHTEA
FT                   IKALQFLDRLKVKYGIDNVHVPINDETLLIRVNR"
FT   gene            319223..320578
FT                   /locus_tag="Vdis_0323"
FT   CDS_pept        319223..320578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0323"
FT                   /product="TIP49 domain protein"
FT                   /note="COGs: COG1224 DNA helicase TIP49 TBP-interacting
FT                   protein; InterPro IPR003959:IPR010339:IPR003593; KEGG:
FT                   cma:Cmaq_0904 TIP49-like protein; PFAM: TIP49 domain
FT                   protein; AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; SPTR: A8MD82 TIP49-like protein; PFAM: TIP49
FT                   C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49729"
FT                   /db_xref="GOA:E1QTL4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041048"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTL4"
FT                   /protein_id="ADN49729.1"
FT                   /translation="MSQIKIEEVKPTFERVGLHSHIKGLGVRDGKVQFSADGFVGQVEA
FT                   REAAYYVVKMIRAGKFGGKGVLIVGPPGTGKTALAIGIARELGPDTPFVQISAAEVYSM
FT                   EIKKTEFLTRALRSAIGVRIREWRRVYEGVVKSLDIQYGRHPYNPYAQIPRSATITLAT
FT                   KDEEKRLRVPAEIAAQLIELGVEEGDVIWIDEETGRVFVQGKGEGGETYDIYVKKKIEV
FT                   PKGPVYKEKEITRFFTLNDLDIYQARQQGLLSAMIFGFAAEEREIPNDVRKAVDEFVMK
FT                   LISDGKGELVPGVLFIDDVHMLDIETWAYLSRAMESELSPILILATNRGITKIRGTDVE
FT                   SPHGVPLDMLDRLIIIRTKPYTADEVREIIKIRAREEKVSLTNDALEELTKIGTEESLR
FT                   YAIQLLAPAQLRAQEVGHKEIAKEDVEYVKRLFLSVKESVQYVKEYENYFLR"
FT   gene            320648..321097
FT                   /locus_tag="Vdis_0324"
FT   CDS_pept        320648..321097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0324"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GH17186 gene product from transcript
FT                   GH17186-RA; SPTR: B4J1R8 GH17186"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49730"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTL5"
FT                   /protein_id="ADN49730.1"
FT                   /translation="MLSLNDVVQAIYTVTRVVTVPVNIHAIIYLAGRDWAMFERDGPYI
FT                   IYKTTDTQGNPVIIKLRIRETGSSETHYYEVYGMEMQFKYMGNDFLAVYPISGGFSKAK
FT                   VDDKYLLDISTKIGGGEPCIAALRIGQVPAICKQIGKFYLVIARM"
FT   gene            321209..321922
FT                   /locus_tag="Vdis_0325"
FT   CDS_pept        321209..321922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0325"
FT                   /product="Putative phosphate transport regulator"
FT                   /note="COGs: COG1392 Phosphate transport regulator (distant
FT                   homolog of PhoU); InterPro IPR018445; KEGG: cma:Cmaq_1965
FT                   hypothetical protein; PFAM: Putitive phosphate transport
FT                   regulator; SPTR: A8MBZ7 Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function DUF47; TIGRFAM: conserved
FT                   hypothetical protein TIGR00153"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49731"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTL6"
FT                   /protein_id="ADN49731.1"
FT                   /translation="MSRFIKDFWGRILSPLYVGEREFISKLVTHIELSQRALSILEEMV
FT                   LSAVENNSVSKTRVSERMREIAALEREGDEIVRQINDSVLRGAVPITTASIMDTILNKS
FT                   DDILDGIHVLSRELRRTYYLCNTEPVRKFLSEEFLEMLRIGKEALKMLLEIINNLDRKS
FT                   FSDIRVMVMGIQKLEEEVDDIKDSALDKLYSNAKDLTYVEFMSSMSLIFGIDDVLDSIK
FT                   DIAYMLLTLISTYGA"
FT   gene            321912..322649
FT                   /locus_tag="Vdis_0326"
FT   CDS_pept        321912..322649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0326"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="COGs: COG1011 hydrolase (HAD superfamily); InterPro
FT                   IPR005834:IPR006439; KEGG: sso:SSO0726 2-haloalkanoic acid
FT                   dehalogenase, putative; PFAM: Haloacid dehalogenase domain
FT                   protein hydrolase; SPTR: Q9UXB5 2-haloalkanoic acid
FT                   dehalogenase, putative; TIGRFAM: HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1; PFAM: haloacid dehalogenase-like
FT                   hydrolase; TIGRFAM: haloacid dehalogenase superfamily,
FT                   subfamily IA, variant 1 with third motif having Dx(3-4)D or
FT                   Dx(3-4)E"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49732"
FT                   /db_xref="GOA:E1QTL7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTL7"
FT                   /protein_id="ADN49732.1"
FT                   /translation="MVHDKVIDVRAVLFDYDDTLVETRGAMDYARRAVARKISLRTSLD
FT                   EYLVLNVIRDVEVRMESIGQFDRRVWFSEVVKALNIDLSIGDINDLVKTYWDSLRLRSR
FT                   LFPDVIPTLGLLRACGFRIGLVTNTDGEPGLKRDRIRGDGVDGLFDLIIVAGDDTVHTK
FT                   PHPEPFIKALQTLNMRGYEVVYIGDRVDVDVAGAKAVGMHAGLIDRYGTADPRAYGRDG
FT                   ARPDFIIYSLAELPQLLSCVSNA"
FT   gene            complement(322799..323179)
FT                   /locus_tag="Vdis_0327"
FT   CDS_pept        complement(322799..323179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0327"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="COGs: COG2018 Uncharacterized distant relative of
FT                   homeotic protein bithoraxoid; InterPro IPR004942; KEGG:
FT                   tne:Tneu_0108 roadblock/LC7 family protein; PFAM:
FT                   Roadblock/LC7 family protein; SPTR: B1YA92 Roadblock/LC7
FT                   family protein; PFAM: Roadblock/LC7 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49733"
FT                   /db_xref="GOA:E1QTL8"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTL8"
FT                   /protein_id="ADN49733.1"
FT                   /translation="MESSVGKEVVNALEEFMNRVFPDIVGALVVRRDGLPVAFKVSGEF
FT                   NAKVVSAMVAIARSTMDRLGAELGLGESVISVSQYTRNTLLVAPLSKDLILTAIAKPEP
FT                   NLGLILLEIEKLKDKLTKILVE"
FT   gene            323290..325389
FT                   /locus_tag="Vdis_0328"
FT   CDS_pept        323290..325389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0328"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="COGs: COG1529 Aerobic-type carbon monoxide
FT                   dehydrogenase large subunit CoxL/CutL homologs; InterPro
FT                   IPR008274:IPR000674; KEGG: sid:M164_2412 aldehyde oxidase
FT                   and xanthine dehydrogenase molybdopterin binding; PFAM:
FT                   aldehyde oxidase and xanthine dehydrogenase molybdopterin
FT                   binding; aldehyde oxidase and xanthine dehydrogenase a/b
FT                   hammerhead; SPTR: C4KLC8 Aldehyde oxidase and xanthine
FT                   dehydrogenase molybdopterin binding; PFAM:
FT                   Molybdopterin-binding domain of aldehyde dehydrogenase;
FT                   Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49734"
FT                   /db_xref="GOA:E1QTL9"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTL9"
FT                   /protein_id="ADN49734.1"
FT                   /translation="MPLREHLDIVTGNSTYLDDVRFDNMAYLHVIRSPYARARITRIEG
FT                   PGSRALLFLTANDIGDLLMPAVTAPNAKVVRMPVLPRNTVNFVGQPVAAVVTDSRYSLE
FT                   DVADEVSIEYEPLRPVVTIDEALRNEEVIHPEIGTNISLDITLEGGDLNVFKEADVVVE
FT                   REIEQARLVANPMEPKGCVVYYNGDKLLVYASTQSTFRVRSDLAEVLGLPIDKIVAKAP
FT                   KNVGGGFGNKTPAYPEYVLAAIASMKLKRPVKWVETRTEHLNNATQGRGVKSRMKLYAK
FT                   RDGTILGIEGEVIVNLGAYNFTINASSPIFIANLSTGPYRMLAARVRAVGVFTNTPPSG
FT                   PYRGAGRPEAALIHETLIDDLADELGMDPVEVRRKNIIRDGETYKTPLGLVIDPANYQS
FT                   ILEDAARHYYELRSRYPGRGVSIAVFALYVSTFGGEGVRAVIGNGKLRLYIGSRPQGHA
FT                   HVSAFTKYASEVFGVPEELIEVVPGDTETLNYGVGTFGSRSATVVAATITELAERVTSK
FT                   LSSMGLSLIDAIKSRGVVIEEEVDYKPSIAILAPGAHVAVVDFDPETLVANVIDYYAVY
FT                   NVGKPLLEEEVEAQLHGGILQGVAQVLWEGAAYGDDGTPLHSSLADYGLPSPPDVTYKV
FT                   LTRGLNTPSIMPGGLRGIGEAGTVGALASTFLALEKAIRAKMNIRVKLNRMPVTPSYLH
FT                   RLISN"
FT   gene            complement(325420..325974)
FT                   /locus_tag="Vdis_0329"
FT   CDS_pept        complement(325420..325974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0329"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhy:mhp293 hypothetical protein; SPTR: C2Q847
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49735"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTM0"
FT                   /protein_id="ADN49735.1"
FT                   /translation="MIDFFLLLILKYPLSRYMMMSSSSTDVKEEIKKTVQLIITNLNVK
FT                   PSECVLKNYDAITKNAVSILLKIFPELSDDVNALISKFTEIQENIKKLVGTTDIGEYAD
FT                   SILSIFAVYRVNPGIYAAFTALQAAEAMKMCGDADAKFFVARTILAGALPYELYVLLID
FT                   YLGMDRTFPVTLFKALLETTK"
FT   gene            complement(326021..326596)
FT                   /locus_tag="Vdis_0330"
FT   CDS_pept        complement(326021..326596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0330"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsa:LSA0801 pyrimidine-nucleoside
FT                   phosphorylase; SPTR: D1FXE1 Recombination protein
FT                   (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49736"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTM1"
FT                   /protein_id="ADN49736.1"
FT                   /translation="MLIFVQLLINIMSASGPGTIVGIPGSADVKEIVNYIARIITSALE
FT                   VKSSDCLLKNYGTITLNAMNQVLKLFPELSTEFNILASKFKEIQEASRKLVGIKDPAQY
FT                   ADAVLTIFTTYNVDPGLYGVFAALQAMEAAKICGDSDAKFFLVRTLLASSLPNNLYRLL
FT                   LDYLSLDHNFPINLLKALLEKYGKENSG"
FT   gene            complement(326673..327248)
FT                   /locus_tag="Vdis_0331"
FT   CDS_pept        complement(326673..327248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smr:Smar_1530 hypothetical protein; SPTR:
FT                   D0KNG5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49737"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTM2"
FT                   /protein_id="ADN49737.1"
FT                   /translation="MDSTYDVYLPWLVRLEDGTKYRVPLSTIMMGSQKHVFIIKIPPHS
FT                   VHDAALGLMSRGFKPTMLSINRGELYSLAMRVYGPWELHARIFSDGVIEAEAEISRDYL
FT                   QHLVGPRFNVVYEVYDALRHFVTDKRICIKPMGKCISDIIENVKIELRAPRALIPWKPI
FT                   MAAALLTLMPMIDRFSFLHFLHLNTHSN"
FT   gene            complement(327312..330134)
FT                   /locus_tag="Vdis_0332"
FT   CDS_pept        complement(327312..330134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG2409 drug exporter of the RND superfamily;
FT                   InterPro IPR000731; KEGG: cma:Cmaq_0161 hypothetical
FT                   protein; SPTR: A8MA78 Membrane protein, putative; PFAM:
FT                   MMPL family; TIGRFAM: ATP synthase subunit 6
FT                   (eukaryotes),also subunit A (prokaryotes)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49738"
FT                   /db_xref="GOA:E1QTM3"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTM3"
FT                   /protein_id="ADN49738.1"
FT                   /translation="MISRKHVSILIIVAWLITMIYIAHYSFHVFNVLTYDESQLMPNNI
FT                   EPIIVKNLVDKYIGTSNETTLVVVIKLSSNGTTNIEGRLNYVSNVTEMIDSPNITITDL
FT                   LTTYNEIYTIYNETISNVTTKIIDNESSNVWNLYWSLNNECSSIIRLNRKYYSMVYSVA
FT                   DEVSGEFNATVNYAQLLYYEIENYYLRNYPNTSLTTLFELTTKDYELKHGDYDQYINEL
FT                   ANETLTQLVNDIGNNPTPYVLVSKNITGILLTNYGHIIQQEYPGININNITGYVYDLLI
FT                   NDTNDTELRIAVLIGPNVDMNLLRLLVIQEYLNNVSPLLLPYLYQLTCSNNTSVVNSVL
FT                   SEMRTSVINALMQEHPPPSILDLPNNLTQKFLNGTYTVAFITLPSNYEDEVYNLLTRRD
FT                   WVYPVSTDVILYELEKMVSSDVNIIDKTTAALVFVTMIAMLGTLVGPVMSLTVLGLTYL
FT                   ASLGLLYNWAIHFKLYYLTVYMIAPIIFGIGVDYSMLMLSRYLEERIAGHDKDQALKIV
FT                   LSRVRPTILASASVVGLGLGSFAISRYGYIQDIGIGFIIAVSLTVIATAVILPEIMRLL
FT                   GDGVLWPMGLRAKSIELRTAFLSKMAKFAVDRPRLILAVFLAITALALTYLILNIRITT
FT                   DPVQVMPNTPAKVGLSLLINYFRNYDYSTAYLVVYGNESAALALLNAVKGQSYVINAAL
FT                   SYNGSGMYIITATVNQQSLSDKLIPIYLGLREVANEVAREYGVRVLIGGSPADKYYFVL
FT                   GFEREYYGLIIYVMIAVNIVILTIYMRSLMIPLRLVATVLMSITWSLALTIFVFQGLMG
FT                   IQTYWLLPVILISLLLSVGTDYDLFIVSRFREEISNGLSDRDAIVRAVEVTGPVVTGAA
FT                   LVLAMAFASLALSSIYILKQVALAVASSVIIDSFIVRPLLVPAIIVLLGKWNWWPFHGR
FT                   YTGHSVIGND"
FT   gene            330176..331045
FT                   /locus_tag="Vdis_0333"
FT   CDS_pept        330176..331045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0333"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1136 ABC-type antimicrobial peptide
FT                   transport system ATPase component; InterPro
FT                   IPR017871:IPR003439:IPR003593; KEGG: cma:Cmaq_0302 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: A8MB60 ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49739"
FT                   /db_xref="GOA:E1QTM4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTM4"
FT                   /protein_id="ADN49739.1"
FT                   /translation="MRSDEEVIRLVNVSKRYYLSSSVYIDALINVNLTIRMGEIAIVMG
FT                   PSGSGKTTLMNIMGTLDKPTSGRVIIDGVDVTDADEKYLSKFRLERLGFVFQQYNLISQ
FT                   LTALENVMLPMLLTGKYTKDEAREKARLLLDLVGVGEFANNRPSQLSGGQQQRVAIARA
FT                   LANDPSFIIMDEPTGSIDLASSYLILDLVKLLNKAIGVTFVIATHNMEVAAIGSRIIYL
FT                   RGGRIVSESDLARIKEEFSKLRVDQLTVIKSYLRILDLEEKRLRRLGQDLGEIERRRDL
FT                   VNSFIGST"
FT   gene            331085..332860
FT                   /locus_tag="Vdis_0334"
FT   CDS_pept        331085..332860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_0301 hypothetical protein; SPTR:
FT                   A8MB59 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49740"
FT                   /db_xref="GOA:E1QTM5"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTM5"
FT                   /protein_id="ADN49740.1"
FT                   /translation="MSIKYVLLIAAVIMMLFMGITVYAYEPLNAYFTVNYVTYLNPNGQ
FT                   ATDYYIEYSLVLYNNEPYTISLNVTMKVLPYSSILYVSPSTALISGDAVTWVITLQPYS
FT                   QETLNVRFKPVYTLLPIASMNYRILVNESSINSTMVNGGVGTNVNISVNVTNLLPFPIM
FT                   TTLTLTKQSGLFYEYNVTPTLTQNILGYEVDYWIFNTENSSSLSLGMVVENMGPWHSVR
FT                   INPITVQASIDLNGSINSLNEAINSLNNTLNQLRNFSSSLTGVSGTASNYTAQFLQLIS
FT                   LLNETAQVLGASAYIINSTLMVESLLQAQLIELKVALTAGGQILGAEANVISQLRSSLS
FT                   PVVNNEQTYLNSLNTLKQDLLQIESSTSNSTLINEINSAIMMINQIENLLTTLSQVYNS
FT                   LGTIQSELTTTQNQVNQATEGLNYAITAANESELLIISISRSLYVLHNELLNLTNQLLI
FT                   TYINISSYQTRALSYMTQVSGYESEIESTIMSDEVKKAVLTALARQYLTYLSINNTNVK
FT                   IDVTVEETFVINMPSVVNTQYLMQLINETAVQGNESVSPRTVGAVVINYSTYYPLIIGV
FT                   ALSIILVLILVRKLH"
FT   sig_peptide     331085..331156
FT                   /locus_tag="Vdis_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            332885..333529
FT                   /locus_tag="Vdis_0335"
FT   CDS_pept        332885..333529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0335"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="COGs: COG0302 GTP cyclohydrolase I; InterPro
FT                   IPR020602; KEGG: pas:Pars_2122 GTP cyclohydrolase I; PFAM:
FT                   GTP cyclohydrolase I/Nitrile oxidoreductase; PRIAM: GTP
FT                   cyclohydrolase I; SPTR: A4WMQ1 GTP cyclohydrolase; PFAM:
FT                   GTP cyclohydrolase I; TIGRFAM: GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49741"
FT                   /db_xref="GOA:E1QTM6"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTM6"
FT                   /protein_id="ADN49741.1"
FT                   /translation="MLYLNRGINRLDSVHNNRNDEEAEMENYVSRIIEFLGDNPDRPGL
FT                   RETPRRYLNALLELTHGLREPPPKIKFFPMEGNEYVGRISINDIKFVSLCEHHLLPVIG
FT                   TVTVVYEPLNSEVPGLSKVARYVKWLAARPMLQERFTARLANELKEVLHARYVYVKVCA
FT                   LHMCAMIRGVKDEDMYMVTEAWSDGVSDEELKELRNSTRCRVPRIVLTKEY"
FT   gene            333553..333996
FT                   /locus_tag="Vdis_0336"
FT   CDS_pept        333553..333996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0336"
FT                   /product="Protein of unknown function DUF54"
FT                   /note="COGs: COG1325 exosome subunit; InterPro IPR002739;
FT                   KEGG: smr:Smar_0853 hypothetical protein; PFAM: Protein of
FT                   unknown function DUF54; SPTR: A3DMU3 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   DUF54"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49742"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTM7"
FT                   /protein_id="ADN49742.1"
FT                   /translation="MINPIEHVELSTHVHATESELKVVRALLNLLPPQYRDGINIMRSG
FT                   GQGHFGNDIGTIKVQFKGQDALQIAQHILKAVDQLDREIILVTINSRFSDGKLYLRFNK
FT                   QLAYNGVARLDDGDDVIKVIIRFNHWVIKNEGIETIIKQLMRH"
FT   gene            complement(333993..335678)
FT                   /locus_tag="Vdis_0337"
FT   CDS_pept        complement(333993..335678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0337"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="COGs: COG0129 Dihydroxyacid
FT                   dehydratase/phosphogluconate dehydratase; InterPro
FT                   IPR020558:IPR000581:IPR004404; KEGG: cma:Cmaq_1758
FT                   dihydroxy-acid dehydratase; PFAM: dihydroxy-acid and
FT                   6-phosphogluconate dehydratase; PRIAM: Dihydroxy-acid
FT                   dehydratase; SPTR: A8MAK4 Dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: Dehydratase
FT                   family; TIGRFAM: dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49743"
FT                   /db_xref="GOA:E1QTM8"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTM8"
FT                   /protein_id="ADN49743.1"
FT                   /translation="MIKVNLRSQERYGGVLNAPHRAFLRSIGFSDEDIGKPLVAVVAAW
FT                   SEAGPCNIHTLQLAVHVKEGVRRGGGSPLTVPTIVVNDNIGMGTEGMRYSLVSRDVIAD
FT                   TIEAQVNAHAFDGFVGIGGCDKTTPGILMAMARLNIPAVYLYGGTAEPGFYGNLKLTIE
FT                   DVHEAIGAYLAGKITEDELYEIEKRAHPTYGTCAGMFTANTMAAIAEALGMALPGSASP
FT                   PATSARRVMYAVESGVALMNAMELGIKPRDVMTYEAFENAITVLMAMGGSTNAILHLLA
FT                   IAYEAGVKLTLDDFDRISRRTPYIASLRPGGDYVMADLDAVGGVPLVMLKLLKAGLLNG
FT                   KVLTITGKTLEENLRNYKFPNVPHDHIVRDVSNPIKPWGGIRILKGSLAPEGAVIKVAA
FT                   TELMRFEGRARPFNSEEEAFQAIRRGEIKPGDVVVIRYEGPKGGPGMPEMLRVTAAIVG
FT                   AGLGKDVALVTDGRFSGATRGLMVGHVAPEAAVGGPIAVVEDGDRVLIDVENGRLDLLV
FT                   PEEEIKRRLKNWQPPPPRYTRGLLAKYASLVTSASMGAVTLPRL"
FT   gene            335785..336249
FT                   /locus_tag="Vdis_0338"
FT   CDS_pept        335785..336249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0338"
FT                   /product="PEBP family protein"
FT                   /note="COGs: COG1881 Phospholipid-binding protein; InterPro
FT                   IPR008914:IPR005247; KEGG: cma:Cmaq_1927 PEBP family
FT                   protein; PFAM: PEBP family protein; SPTR: A8MBL1 PEBP
FT                   family protein; PFAM: Phosphatidylethanolamine-binding
FT                   protein; TIGRFAM: conserved hypothetical protein TIGR00481"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49744"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTM9"
FT                   /protein_id="ADN49744.1"
FT                   /translation="MSFTLTSPAFKYGERIPRKYTCDDVDISPPLQWSNTPAGTKSLVL
FT                   IMEDPDAPIGVFTHWVLYNIPPDRTELPENVPKTPVVEGIGVQGINDFGRIGYGGPCPP
FT                   RGHKPHRYFFRLYALNTVPNIKQRASKDEVLRIIKNSIIGTTEYMGTYSR"
FT   gene            complement(336275..337138)
FT                   /locus_tag="Vdis_0339"
FT   CDS_pept        complement(336275..337138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0339"
FT                   /product="ABC-2 type transporter"
FT                   /note="InterPro IPR013525:IPR000412; KEGG: cma:Cmaq_0363
FT                   ABC-2 type transporter; PFAM: ABC-2 type transporter; SPTR:
FT                   A8MBB9 ABC-2 type transporter; PFAM: ABC-2 type
FT                   transporter; TIGRFAM: daunorubicin resistance ABC
FT                   transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49745"
FT                   /db_xref="GOA:E1QTN0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTN0"
FT                   /protein_id="ADN49745.1"
FT                   /translation="MATRLHPLHGLWALTNRELAKWYKVPVILIISLIQPVVWLAFFGK
FT                   SMNFAVMFTSGLNIPGLNIPKQVIDEIASEVLKANFGTTDYFSFLAVGMLSFITLFTSL
FT                   QSGMSIVWDRRLGVLSKLLTTPVPRGNIVMAKVLNSMIRSLVQSTIVLIIAILLGMKLN
FT                   PSLNPLDVLGAYAALALMSMGFASLFVTLALRSTSWESQMAIMNLLNMPLMFASNSFYP
FT                   VKSMPWWLKPVALVNPLTYVNDINRQLLLGITGQSLLFDYAYLIGFAVIFSVIGIVLSW
FT                   RYLSEA"
FT   gene            complement(337145..338143)
FT                   /locus_tag="Vdis_0340"
FT   CDS_pept        complement(337145..338143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0340"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro
FT                   IPR017871:IPR003439:IPR005894:IPR003593; KEGG:
FT                   cma:Cmaq_0364 daunorubicin resistance ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: A8MBC0 Daunorubicin resistance ABC
FT                   transporter ATPase subunit; TIGRFAM: daunorubicin
FT                   resistance ABC transporter ATPase subunit; PFAM: ABC
FT                   transporter; TIGRFAM: daunorubicin resistance ABC
FT                   transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49746"
FT                   /db_xref="GOA:E1QTN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTN1"
FT                   /protein_id="ADN49746.1"
FT                   /translation="MEVAIKAINLTKRYGNFTAVDHINFEVYYGEIFGFLGPNGAGKTT
FT                   TIKMLTTVTRPTEGTAVVNGYDVIKQPAKVRESIGVVPQEYTADEDLTGWENLMLVAAL
FT                   YGIPKREAKERAAELLDLVELSYAADRKVETYSGGMRRRLEIAMGLINRPAILFLDEPT
FT                   LGLDAQTRAAIWDYVYRLRKQYGMTIFMTTHYLEEADRYAERIAIIDHGKILAIGTPKE
FT                   LKERVGGDVITIEVNGDVNLARKVIEGIDGVNGVTVNGNTITFKVKSGNTAAPIILEAL
FT                   NKLSIRATSITIKEPTMDEVFLEFTGRRLRDEESSSEEFMRFRRTITRARR"
FT   gene            complement(338210..338899)
FT                   /locus_tag="Vdis_0341"
FT   CDS_pept        complement(338210..338899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0341"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="InterPro IPR005358; KEGG: pis:Pisl_1173 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0153; SPTR:
FT                   A1RTQ9 Putative uncharacterized protein; PFAM:
FT                   Uncharacterised protein family (UPF0153)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49747"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTN2"
FT                   /protein_id="ADN49747.1"
FT                   /translation="MVAPFKCMPNCGYCCTISPVTVFPHEVIILSKLAEELDVNDLAFK
FT                   PGYVVTDIKNGVRVALSYLMQLNSKGICPFLNPEDKTCKVHSLYKPLTCRSFPYLPRVI
FT                   RYVIDPELKLVDFTVEFVVSTLCPVVRNNYTQDDLEAMISNVRIAVKVMPREVAAAEEA
FT                   IRVRKLYADALTALWRAGYVELRGSEGNNTNWPIVNAFEYIRQFIPHITLDKFVPNISQ
FT                   VIRRLDL"
FT   gene            complement(338948..339718)
FT                   /locus_tag="Vdis_0342"
FT   CDS_pept        complement(338948..339718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0342"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="COGs: COG1011 hydrolase (HAD superfamily); InterPro
FT                   IPR005834; KEGG: cma:Cmaq_0159 hydrolase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; SPTR: A8MA76
FT                   Haloacid dehalogenase domain protein hydrolase; PFAM:
FT                   haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49748"
FT                   /db_xref="GOA:E1QTN3"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTN3"
FT                   /protein_id="ADN49748.1"
FT                   /translation="MSLKVITFDVYNTLINYGKELIEEIAMNITKYLKSQDIEVHFDHV
FT                   YEIYMGLDREIRLRRVVEMAYVPPMDNVRTFLERLTRKYGIELNERMVMDVANIIANTL
FT                   LESGNVKPNEDAQYVLMEMKSDGFMIGVVSNVIFWSSAVSRRLLDKFGLSRLIDVQVYA
FT                   DEVGRAKPHPAIFERAYSLLTHGAEPDLAIHVGDGFKEDLLGAMLDDVIGVYIDRIGTL
FT                   ISGGSPAELIRCRAYAVRRLKEVLLVPHLVSGCS"
FT   gene            339814..340521
FT                   /locus_tag="Vdis_0343"
FT   CDS_pept        339814..340521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0343"
FT                   /product="GTP cyclohydrolase IIa"
FT                   /EC_number="3.5.4.29"
FT                   /note="COGs: COG2429 conserved hypothetical protein;
FT                   InterPro IPR007839; KEGG: pai:PAE2984 hypothetical protein;
FT                   PFAM: GTP cyclohydrolase III; PRIAM: GTP cyclohydrolase
FT                   IIa; SPTR: Q8ZU20 GTP cyclohydrolase III; PFAM: GGDN
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49749"
FT                   /db_xref="GOA:E1QTN4"
FT                   /db_xref="InterPro:IPR007839"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTN4"
FT                   /protein_id="ADN49749.1"
FT                   /translation="MVQVTIIRLIGYREWTETLGPDREHVIQQVQAQLHRELVHVFSRL
FT                   NAWAHPLRYDYLLAITNGLSNGELTSIIKELSEYSPVPLSSGTYADVNPRVAEREAFRL
FT                   AMKASPGESLIGGGDDGYVAIAHIDLVDSTTSTEWTSSYQLYEHVWSVVNQVRLYLAPY
FT                   GGITLYLGGDNIVSIVQPAINENDLKPLANLINARIGVGIARSGRVAMKLATEALDSLR
FT                   TRNGYGVMMLRED"
FT   gene            complement(340518..341390)
FT                   /locus_tag="Vdis_0344"
FT   CDS_pept        complement(340518..341390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0344"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="COGs: COG2512 Uncharacterized membrane-associated
FT                   protein/domain; InterPro IPR002831; KEGG: pai:PAE0146
FT                   hypothetical protein; PFAM: transcriptional regulator TrmB;
FT                   SPTR: Q8ZZP6 Conserved protein; PFAM: Sugar-specific
FT                   transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49750"
FT                   /db_xref="GOA:E1QTN5"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTN5"
FT                   /protein_id="ADN49750.1"
FT                   /translation="MILAALITVFVYLLSNGSSVSINVTTVQSTALLNITLPIKPLGPV
FT                   IVQNSSGSTIPAILIGNHLIIPVFGNGSFIIQYAPYIIQSPSGYLIINVSSPYTINLFV
FT                   SNNILLTQLPISLITNFTKVSNGIILQLAPGNYSIGFIPELPTTITNKTTATSTTVSNV
FT                   SAVTTVTNSTPKVTKPSPSLGPMLYYIVIAAVIAVAALFAYLFVIRHRGPEVNLVIVEG
FT                   LNPTDKEVLKALIDMGGEAYQADLQRKLNMPKATLWRAIRRLESSGYVQVIKEGRVNKI
FT                   KLIKRPRLD"
FT   gene            complement(341533..342753)
FT                   /locus_tag="Vdis_0345"
FT   CDS_pept        complement(341533..342753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0345"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_0636 hypothetical protein; SPTR:
FT                   A8MCH0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49751"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTN6"
FT                   /protein_id="ADN49751.1"
FT                   /translation="MSMGNRKIMDIGVVALIMALALTLVLTVVMTASPLLASQSTNATN
FT                   STVSINATSVSNVTTTTVSNVTMTNVTTCPPGLLTAIQANLYIDDMWLMRVGANMSGVN
FT                   ATSLMVVNATGLNETAINGTFTGFNITKFNMTAFNITGFNLTPVTLQNITNYYVSKGEC
FT                   LLALQFLVHLRHYLVHVYVLERHAEIWNRTLTFRLMLLNETLTRLEQQGLLNSTQTSQI
FT                   YSLLSQLKQALISGNYSEAEMLLSGYKSLLSNITSQYYEEQKMGFANRIDHELEHYVMQ
FT                   IIRGSITLNETLTQLATLDHELGMLTNITGLNITSVKELHELFKELKMIYPLIQGNETA
FT                   QAQLLQMLKHGKGFSDWLNTTQQFGQEAKGWQLHGQGHGKGQHGQGGQGGQHGQMGHGK
FT                   GQGKGGG"
FT   sig_peptide     complement(342643..342753)
FT                   /locus_tag="Vdis_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            342874..343551
FT                   /locus_tag="Vdis_0346"
FT   CDS_pept        342874..343551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0346"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="COGs: COG1011 hydrolase (HAD superfamily); InterPro
FT                   IPR005834; KEGG: pcl:Pcal_0554 hydrolase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; SPTR: A3MTL4
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49752"
FT                   /db_xref="GOA:E1QTN7"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTN7"
FT                   /protein_id="ADN49752.1"
FT                   /translation="MLILIDLDGTLLPLEAWDPVFQEISMLIASRANADWRAVYKAAKD
FT                   LNRELLRSFTIKAFDWDYIFTEIAHRFGLPISIDVNDTLMKYVHDFKPFDGALELLRVI
FT                   RDLGHEIIIATNGLYKYQSVVIRELGFSRFVNGIRTPDMVGCPKNCREFFEGAQVMIGD
FT                   NPLFDVYYPARFGLITIFIGDWEKRLSYVLDVWGIDLSSVKPTYSFKSIKDLLMMITSI
FT                   LNQ"
FT   gene            complement(343541..344032)
FT                   /locus_tag="Vdis_0347"
FT   CDS_pept        complement(343541..344032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0347"
FT                   /product="Vitamin K epoxide reductase"
FT                   /note="COGs: COG4243 membrane protein; InterPro IPR012932;
FT                   KEGG: cma:Cmaq_0467 vitamin K epoxide reductase; PFAM:
FT                   Vitamin K epoxide reductase; SMART: Vitamin K epoxide
FT                   reductase; SPTR: A8MBW9 Vitamin K epoxide reductase; PFAM:
FT                   Vitamin K epoxide reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49753"
FT                   /db_xref="GOA:E1QTN8"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTN8"
FT                   /protein_id="ADN49753.1"
FT                   /translation="MRRLTGTWLVLMLIFSAVGLFASSIVIYTYYYLRELPPLCTSFKS
FT                   PFPGITIDCERVLSSKYSDIGGVPLDLLAAIWFIVNIILVLMYDLGPGNLATLAINALF
FT                   YWRFIGIVVVPYLIFVETYLLHALCIYCTVMHIMIIIDFAVITIFFIRVGKSPMRGLTD
FT                   "
FT   sig_peptide     complement(343967..344032)
FT                   /locus_tag="Vdis_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            344152..346137
FT                   /locus_tag="Vdis_0348"
FT   CDS_pept        344152..346137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0348"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="COGs: COG0303 Molybdopterin biosynthesis enzyme;
FT                   InterProIPR005110:IPR001453:IPR005111:IPR008284:IPR 020817;
FT                   KEGG: cma:Cmaq_0083 molybdenum cofactor synthesis
FT                   domain-containing protein; PFAM: MoeA domain protein domain
FT                   I and II; molybdopterin binding domain; MoeA domain protein
FT                   domain IV; SPTR: A8M9Q6 Molybdenum cofactor synthesis
FT                   domain; TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: Probable molybdopterin binding domain; MoeA
FT                   N-terminal region (domain I and II); MoeA C-terminal region
FT                   (domain IV); TIGRFAM: molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49754"
FT                   /db_xref="GOA:E1QTN9"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTN9"
FT                   /protein_id="ADN49754.1"
FT                   /translation="MSEAGKRIIFHELLTPEETLSKVFSTVKVEPLGTEVVRIEESYGR
FT                   VLARDVYSRIDVPPFDRATMDGFAVRAEDTFGADELNPVKLRVIGNIETGAEELPQVNS
FT                   GEAVEIATGAPMPPGANAVVMVEYTKRSGDELVIYRSVTPGENVMSAGSDVMMGELILR
FT                   KCTVIREREVGLLAAVGIDRVEVFRRPRVAIISTGNELVSPGRELGRGKIYDINTYTIA
FT                   HAVRSMGAEPIIMGIVRDDINEMRDAVNKALSIGDLVLLSGGTSAGLADLTYKVLDEIG
FT                   PPGIIIHGLKVKPGKPTVVAVSRDNKLVIGLPGYPSSALMIFNIIVKPILAKMLCTGID
FT                   EIRIKARLAIRADGAKGRRALYPVSLVDTGHGVVAYPLPAESGAISTLAFADGYIAIPE
FT                   TVEYLDSGDEVEVTLFTHQYMPANLYIIGSHDLGLDVLIPMLPGFVRARVINVGSMGGL
FT                   YAVKRGEADVAGLHLVDEETGQYNVPYMVKYNVNNAVLIRGYFREQGLIVPRGNPKNIR
FT                   GIEDLLRGDVRIVNRNKGAGTRFLLDIKLKEIANKMGVKFEELVRRINGYYYEVKTHTA
FT                   VAAAVAQGKADAGVGIRAAAAMYGLDFIPLGWESYDFAIPIDRLEKDSVKAFLNMLRSS
FT                   EFKNALSKLPGYRVPDDIGEVIWKGQ"
FT   gene            complement(346170..347651)
FT                   /locus_tag="Vdis_0349"
FT   CDS_pept        complement(346170..347651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0349"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0318 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; InterPro IPR000873; KEGG:
FT                   sai:Saci_2207 4-coumarate-CoA ligase 1; PFAM: AMP-dependent
FT                   synthetase and ligase; SPTR: Q4J6T8 4-coumarate-CoA ligase
FT                   1; PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49755"
FT                   /db_xref="GOA:E1QTP0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTP0"
FT                   /protein_id="ADN49755.1"
FT                   /translation="MINYQYQNPVEVLLDYSRSRSNDVFLIDESGASLTYGELYSKAAR
FT                   LAGSLSRFDVGHGDRVAIIMSNSMEAVISLFATWILGASAVLIDPLTISEDLDYQLSDS
FT                   APKVVIADRSVIERETAVLSKYRVVGVGVSGQGILSFQELLSSVPSIGRPIEVRSDDVG
FT                   LIYYYAGIAGRTMQVWHTYFSLYSGPYAFGEAIELNPKDSVLVVAQLSHILGLTELMSA
FT                   FVRGAKAVIARHFDAKDTPELIRRYGITVFAGVPLMFDQILNNRDLSPNALSSLRLALS
FT                   AAAPLPPATQLGFYQRFGVPLVQFYGLTEAYVLTVQPVRYKDVTGTVGSAIPGAELKIV
FT                   DPNDPSKELGVGSVGELAAKAPWVMKGYSDPDDTRRAFHNGWLLTGDLMVMDDKGLLYF
FT                   RGVKKRMIKYKGYPIFPRDLEIILMRHPAVKEAYVTGEQAEDPSIGQLPVAYVVLRDEY
FT                   RGKVSDKELIDFVNSRVAFYKKLRKIYFVDKLPIK"
FT   gene            complement(347657..349549)
FT                   /locus_tag="Vdis_0350"
FT   CDS_pept        complement(347657..349549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0350"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0365 Acyl-coenzyme A synthetase/AMP-(fatty)
FT                   acid ligase; InterPro IPR020845:IPR000873; KEGG:
FT                   siy:YG5714_1014 AMP-dependent synthetase and ligase; PFAM:
FT                   AMP-dependent synthetase and ligase; SPTR: C4KFA9
FT                   AMP-dependent synthetase and ligase; PFAM: Domain of
FT                   unknown function (DUF3448); AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49756"
FT                   /db_xref="GOA:E1QTP1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTP1"
FT                   /protein_id="ADN49756.1"
FT                   /translation="MAVNQKFYSLDKIRRMAIEASENPAKFWADKADYLTWFERPKSIF
FT                   EGRAPDVYWFRGGYLNISYNAVDRHIPARANKVAFYYENERGDSRVISYWDLYREVNRA
FT                   AYVLKELGVKKGDTVSMMMPNTPEAVYFGLAVHRLGATLVIHYAGLSEETLAYRLQDCG
FT                   SKVFIVASKGFRAGDEVRMKDLVDRTLEKYQTPVEKVLVVSRGFSDFNVKQGRDLVYED
FT                   IAPKGKVYVEPVPVEANEPATIYYTSGTTGRPKGLWQSNGGYPIGLNWTFRALFNPQDT
FT                   DVWWTISELGWPVWPMANLYTIPVMGLTGLLFEGFVGYKRDLFARIVEKYRVSLIWSST
FT                   TTLYTIRSIGEDALKGDLSSLRIILNTGETLNPGVAEWYIQQLPNTMIADAYWMTEHLI
FT                   PIAATPYGLGEIPFKPGSAGIQFPGSKWLVVDDDGNPLPPGQRGYIVIAIPNPAMAKMW
FT                   NDPNHERLVKTYWSRFPGYFYTGDYGFYDSDGYLYVLGRADDILTIAGERLGTMDIEGI
FT                   LARHKAVAEAAVVGAPAPGGGEKVLAFVVLKSGEAPSEVLINDIKEFARASGTRVDDVI
FT                   IVRRLPKTKSGKIMRRLLRALVKNEPYGDISTLDDVRTLDDIKAALIERGYIKP"
FT   gene            complement(349638..350408)
FT                   /pseudo
FT                   /locus_tag="Vdis_0351"
FT   gene            350648..352030
FT                   /locus_tag="Vdis_0352"
FT   CDS_pept        350648..352030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0352"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="COGs: COG0069 Glutamate synthase domain 2; InterPro
FT                   IPR002932:IPR013785; KEGG: tpe:Tpen_1139
FT                   ferredoxin-dependent glutamate synthase; PFAM:
FT                   ferredoxin-dependent glutamate synthase; SPTR: A1RZA7
FT                   Ferredoxin-dependent glutamate synthase; PFAM: Conserved
FT                   region in glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49757"
FT                   /db_xref="GOA:E1QTP2"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTP2"
FT                   /protein_id="ADN49757.1"
FT                   /translation="MILEIAKLLVRLRAYWASIRGLREFIDDYPFDEIALKALKGRDAV
FT                   YPFGEIATYGSAVLGSGVYDKRGFPRFKTLDNSIILLPPAFTPKRLEKMAELLREPTFM
FT                   DVNLEGSLGGFKVSMPIVVGSMGSTSIASKFSLEIARAAAKAGIVMGIGENVATVRGYS
FT                   RRYTRGHPSFKERLMAYLTNVDKYGGVVIQQNVEDAYDELWNKVYSDKDVEPYIEEGLI
FT                   GFEIKMGQGAKPGLGGVIKIPREEAIRLKAKYHFEIDPEKVKDKFITRYSVPGTYTEDI
FT                   LRGMIRFMKTAYPRARIWIKLGPYRDVDRVISIAHEEGAHAVVIDGKEGGTGMAPSVAM
FT                   KDLGYPTIVALKKIHDARKLGIMDTSLLLAGRLYNGSHVVKAVALGASGAYMARPFLIA
FT                   AMVKGEKGVLNYIEAVKEEMQMLVSALGKYDIREVNTEDVAAIDRGIAEMFGIPYVYSP
FT                   SF"
FT   gene            352071..352946
FT                   /locus_tag="Vdis_0353"
FT   CDS_pept        352071..352946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0353"
FT                   /product="UbiA prenyltransferase"
FT                   /note="COGs: COG0382 4-hydroxybenzoate
FT                   polyprenyltransferase and related prenyltransferase;
FT                   InterPro IPR000537; KEGG: cma:Cmaq_0958 UbiA
FT                   prenyltransferase; PFAM: UbiA prenyltransferase; SPTR:
FT                   A8MDD4 UbiA prenyltransferase; PFAM: UbiA prenyltransferase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49758"
FT                   /db_xref="GOA:E1QTP3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTP3"
FT                   /protein_id="ADN49758.1"
FT                   /translation="MNLRAFVRLSRIEHGILTSLIVIASYVIAGGRSAIAMVLLFLSSL
FT                   LTEIFLFATNDIYNIEEDRINRPDAPLVRGEVSINEAWALSLLSVVIAVSLNVLGIVMG
FT                   YLMIWSIVILIMAIVLGFSYNYRLKRVIIVNNAFVAVTSSLTFLYGLYAVSPTVPTLNL
FT                   PYLLFIVSFLATMGRELVKGAIDVAGDVRAGVKTVANTYGIKIAITLAVIFTLVAVLIS
FT                   PLIIIYALRNPYGLVLSVGVLATDAILMYISIALLRNSNYMGRFRVLSLGAMAITIIAY
FT                   LLFALLVTVH"
FT   sig_peptide     352071..352157
FT                   /locus_tag="Vdis_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(352943..353254)
FT                   /locus_tag="Vdis_0354"
FT   CDS_pept        complement(352943..353254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0354"
FT                   /product="Vacuolar H+transporting two-sector ATPase F
FT                   subunit"
FT                   /note="InterPro IPR008218; KEGG: cma:Cmaq_0219 vacuolar
FT                   H+transporting two-sector ATPase F subunit; PFAM: Vacuolar
FT                   H+transporting two-sector ATPase F subunit; SPTR: A8MAN2
FT                   Vacuolar H+transporting two-sector ATPase F subunit; PFAM:
FT                   ATP synthase (F/14-kDa) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49759"
FT                   /db_xref="GOA:E1QTP4"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTP4"
FT                   /protein_id="ADN49759.1"
FT                   /translation="MSENVRAVVLGDEHTVYTFKLLGFEGRVINENENILAIIKELSVE
FT                   EGVGAILITSNLVDRVREDFDKLRMKMRKPMLIEIPSLREMKFKEVNYLAILRSVLGI"
FT   gene            complement(353285..353824)
FT                   /locus_tag="Vdis_0355"
FT   CDS_pept        complement(353285..353824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0355"
FT                   /product="protein of unknown function DUF46"
FT                   /note="InterPro IPR002726; KEGG: cma:Cmaq_0732 hypothetical
FT                   protein; PFAM: protein of unknown function DUF46; SPTR:
FT                   A8MCR2 Putative uncharacterized protein; PFAM: Putative
FT                   integral membrane protein DUF46"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49760"
FT                   /db_xref="GOA:E1QTP5"
FT                   /db_xref="InterPro:IPR002726"
FT                   /db_xref="InterPro:IPR032690"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTP5"
FT                   /protein_id="ADN49760.1"
FT                   /translation="MSLLWDFIITLLIIWPPYVANATPVIASKVFRRRTPIDLGRNFID
FT                   GKRLFGDGKTYEGFITGLLAGFVIGELTYIVVARAVNIVSELPNPLAVFVMCIAALLGD
FT                   LLGAFIKRRLGLPRGAPAPLLDQLDFLLAALLALWLIQPSVLRIIYVVIAVVITPPIHL
FT                   ATNTIAYLLGLKREPW"
FT   sig_peptide     complement(353759..353824)
FT                   /locus_tag="Vdis_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(353831..354223)
FT                   /locus_tag="Vdis_0356"
FT   CDS_pept        complement(353831..354223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0356"
FT                   /product="zinc finger C2H2-type domain-containing protein"
FT                   /note="InterPro IPR007087:IPR015880; KEGG: cma:Cmaq_0733
FT                   zinc finger C2H2-type domain-containing protein; SPTR:
FT                   A8MCR3 Zinc finger C2H2-type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49761"
FT                   /db_xref="GOA:E1QTP6"
FT                   /db_xref="InterPro:IPR008598"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTP6"
FT                   /protein_id="ADN49761.1"
FT                   /translation="MSTAAKALTKIVVCPLCDYMGEDVNKVVDAITKASPRPKLKCPKC
FT                   GAEVDVNSFVTHMRRHGRVGGKTITCEICNAKLNGEGAFLRHIKEHLIVSVRRNGMDIY
FT                   YCLVCGQEFITKNSAITHLIKRHSLE"
FT   gene            354279..354824
FT                   /locus_tag="Vdis_0357"
FT   CDS_pept        354279..354824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tye:THEYE_A0777 adenylate/guanylate cyclase
FT                   catalytic domain protein; SPTR: B5YK54 Adenylate/guanylate
FT                   cyclase catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49762"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTP7"
FT                   /protein_id="ADN49762.1"
FT                   /translation="MSRVVGLAMPRWDLGTVGYVAGSPGEIDKAYSELFLRCYPTTVDM
FT                   TREMDSKVSCIVNTVRRGLPIGSVVFLLDPYGIANDIGTKYGIRRELILNSVYSWFINY
FT                   LRNNGLITDSDAVELDQELSMLIRSIKARVGGSASMVAGVMATIVMNRRVKVNELPIRI
FT                   MDVRNDVINHVRGMISIH"
FT   gene            354959..355471
FT                   /locus_tag="Vdis_0358"
FT   CDS_pept        354959..355471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0358"
FT                   /product="protein of unknown function DUF35"
FT                   /note="COGs: COG1545 nucleic-acid-binding protein
FT                   containing a Zn-ribbon; InterPro IPR002878; KEGG:
FT                   pai:PAE2489 protein associated with acetyl-CoA
FT                   C-acyltransferase; PFAM: protein of unknown function DUF35;
FT                   SPTR: Q8ZV24 Conserved protein associated with acetyl-CoA
FT                   C-acyltransferase; PFAM: Rubredoxin-like zinc ribbon domain
FT                   (DUF35_N); DUF35 OB-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49763"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTP8"
FT                   /protein_id="ADN49763.1"
FT                   /translation="MVGGTPIREGDIKNYPHEEWTRPFQYSVTAGTAYSKFLDGLKSGK
FT                   IYGTYCSKCGHVFVPPKMYCPYCFKPVDGWVEVKDEGTVITAVVSYISATREPLKEPRV
FT                   VGVIKLDVPGKEFSEHRFPGIMHYLCVDPEDVKSMKVFGMRVKARWKPANQRTGSVLDI
FT                   ECFEPVR"
FT   gene            355477..355944
FT                   /locus_tag="Vdis_0359"
FT   CDS_pept        355477..355944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0359"
FT                   /product="protein of unknown function DUF35"
FT                   /note="COGs: COG1545 nucleic-acid-binding protein
FT                   containing a Zn-ribbon; InterPro IPR002878; KEGG:
FT                   pai:PAE2490 protein associated with acetyl-CoA
FT                   C-acyltransferase; PFAM: protein of unknown function DUF35;
FT                   SPTR: Q8ZV23 Conserved protein associated with acetyl-CoA
FT                   C-acyltransferase; PFAM: DUF35 OB-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49764"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTP9"
FT                   /protein_id="ADN49764.1"
FT                   /translation="MSFEKINVNRDIKHWLHVIEQGYRYTAGPIGTKFLEGIKAGKLLA
FT                   GKCPVCGRLLIPPKAFCQYDFAEIKELVEIAPVGIVRSYTVVYEDSYGNKLPKPVVIGF
FT                   IEFPGVAGGLVHYIVNVEPGNVRVGLKVKPVFKPGNERRGSITDIVGFEPA"
FT   gene            355997..356683
FT                   /locus_tag="Vdis_0360"
FT   CDS_pept        355997..356683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0360"
FT                   /product="ribosomal protein S3"
FT                   /note="COGs: COG0092 Ribosomal protein S3;
FT                   InterProIPR001351:IPR009019:IPR004044:IPR005703:IPR 004087;
FT                   KEGG: pcl:Pcal_0553 30S ribosomal protein S3P; PFAM:
FT                   ribosomal protein S3- domain protein; KH type 2 domain
FT                   protein; SMART: KH domain protein; SPTR: A3MTL3 30S
FT                   ribosomal protein S3P; TIGRFAM: ribosomal protein S3; PFAM:
FT                   KH domain; Ribosomal protein S3, C-terminal domain;
FT                   TIGRFAM: ribosomal protein S3, eukaryotic/archaeal type"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49765"
FT                   /db_xref="GOA:E1QTQ0"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027488"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTQ0"
FT                   /protein_id="ADN49765.1"
FT                   /translation="MSQAQRRIPVYKKILQDKIKEWMIKEFLNYRLAKQGYVDSDVLKT
FT                   PLGTRIIVYAERPNRIIGRKGVIVKELTELLSKKLEVENPIIDVTPIQNPELNPKIIAN
FT                   RIAWAMTKGVKFRRAGMIAIRQIMDGGAKGAEVTISGKLTSERSRFEKYIYGTIYKNGF
FT                   DSRTKVQRFVGQVLLKPGLYGIEVRITPPIRFSDEFQIKPPSREVAAEAQAQQVQGGEG
FT                   GEQAET"
FT   gene            356661..356888
FT                   /locus_tag="Vdis_0361"
FT   CDS_pept        356661..356888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0361"
FT                   /product="ribosomal protein L29"
FT                   /note="InterPro IPR001854:IPR018254; KEGG: pis:Pisl_1728
FT                   ribosomal protein L29; PFAM: ribosomal protein L29; SPTR:
FT                   A1RV97 LSU ribosomal protein L29P; TIGRFAM: ribosomal
FT                   protein L29; manually curated; PFAM: Ribosomal L29 protein;
FT                   TIGRFAM: ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49766"
FT                   /db_xref="GOA:E1QTW9"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTW9"
FT                   /protein_id="ADN49766.1"
FT                   /translation="MASRQRLNARTIRNMKPEDRAKLLNDLRNELLKLQTQRERGTLDN
FT                   PGRVRAIRRAIARVLTIMNEEARKAVKAGE"
FT   gene            356885..357133
FT                   /locus_tag="Vdis_0362"
FT   CDS_pept        356885..357133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0362"
FT                   /product="Ribonuclease P, Rpp29"
FT                   /note="InterPro IPR002730; KEGG: cma:Cmaq_0514 ribonuclease
FT                   P, Rpp29; PFAM: Ribonuclease P, Rpp29; SPTR: A8MC53
FT                   Ribonuclease P, Rpp29; PFAM: Domain of unknown function
FT                   UPF0086"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49767"
FT                   /db_xref="GOA:E1QTX0"
FT                   /db_xref="InterPro:IPR002730"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR036980"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTX0"
FT                   /protein_id="ADN49767.1"
FT                   /translation="MSKPLLFKFIETVNCRNKSLNGVSGIVIDETAKTVKVLTLTGSIK
FT                   VIIKEDCWFYVNINNCTYLVNGRKLILKGGKGKFLNS"
FT   gene            357149..357739
FT                   /locus_tag="Vdis_0363"
FT   CDS_pept        357149..357739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0363"
FT                   /product="H+transporting two-sector ATPase E subunit"
FT                   /note="InterPro IPR002842; KEGG: cma:Cmaq_0218
FT                   H+transporting two-sector ATPase E subunit; PFAM:
FT                   H+transporting two-sector ATPase E subunit; SPTR: A8MAN1
FT                   H+transporting two-sector ATPase E subunit; PFAM: ATP
FT                   synthase (E/31 kDa) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49768"
FT                   /db_xref="GOA:E1QTX1"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTX1"
FT                   /protein_id="ADN49768.1"
FT                   /translation="MSEQELTERLINGIITRLENEINEWSNNVRLRAEAELLDGVKAII
FT                   DKYSGTLENIDKELNMEREYRLYNEMMREKREKLSILEEAYAEVVRRIKERISSMRGTD
FT                   DYKKFLKNSILWAMSIIGSRELTITVSKADKDVAEELVSELGLNSTVNTTEEDLLGAII
FT                   SSADGSIRVDATLDSRLRLMEHQIKTLLAHLAS"
FT   gene            357797..359608
FT                   /locus_tag="Vdis_0364"
FT   CDS_pept        357797..359608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0364"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="COGs: COG1155 H+-ATPase subunit A; InterPro
FT                   IPR000793:IPR018118:IPR004100:IPR000194; KEGG:
FT                   cma:Cmaq_0217 V-type ATP synthase subunit A; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; PRIAM: H(+)-transporting two-sector ATPase;
FT                   SPTR: A8MAN0 H+transporting two-sector ATPase alpha/beta
FT                   subunit central region; PFAM: ATP synthase alpha/beta
FT                   family, beta-barrel domain; ATP synthase alpha/beta chain,
FT                   C terminal domain; ATP synthase alpha/beta family,
FT                   nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49769"
FT                   /db_xref="GOA:E1QTX2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTX2"
FT                   /protein_id="ADN49769.1"
FT                   /translation="MSSDKGRIVYISGPVVKAELPGALLYELVFVGELGLFGEVVRIQG
FT                   DMAFIQVYEETTGLKPGEPVVRTGEPLSAWLGPGILNRVYDGVQRPLPLIFDLTKRPFV
FT                   ARGINYEKAPPLDFKKKWKWIPKVKVGDEVEVGDILGVVPETPLVEHRVLYPPIYRVGG
FT                   VVKYVAPEGEYTIDDVIAEVETKEGTVKVKMWHKWPVRRPRPFKEKLPPIEPLITGIRT
FT                   IDTLFPIAIGGAAAIPGPFGSGKTVTIRTLAMYSEARLVFPVLCGERGNEAADALQGLL
FT                   KLVDPNTGRPLMERTTIIVNTSNMPVAAREASIYMGVTIAEYFRDQGYDAFLMADSTSR
FT                   WAEAMREVALRIGEMPSEEGFPAYLPTRLAEFYERAGRVVTLGKGNRLGSVTIAASVSP
FT                   PGGDFTEPVTSHTLRFIGAFWPLDAKLAYSRHYPAINWLMGFSRYVDTVAEWYQKNVAP
FT                   DWRELRDEAVRILTREAELQEVVRILGTEALSEQEKHLLNAAFLIREGFLKQDAYHPVD
FT                   VKSLPPKQYWLLRLIITFYRKGLEAINRGVPASALRELDVVKRLARLRMEVRNEEYKKL
FT                   VDYEQELISAIENLVKQYETQRVTATA"
FT   gene            complement(359610..360185)
FT                   /locus_tag="Vdis_0365"
FT   CDS_pept        complement(359610..360185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR002114; KEGG: cma:Cmaq_0162 hypothetical
FT                   protein; SPTR: A8MA79 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49770"
FT                   /db_xref="GOA:E1QTX3"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTX3"
FT                   /protein_id="ADN49770.1"
FT                   /translation="MSAEELTVLLMLKRYGRMGRYSLSAVSGMGEGVVRRVLNELRDKG
FT                   AIRVMRGGAELTSKGEELLNDLLRNLGIDEIRDVTKFSQVFRCECRRCYVSVISRSINE
FT                   DSVVRLRDIAIKNGSDAALFLKFVCPQNRFLILKLNNYLDELSQEAAEELSKLDSISCN
FT                   KYTIVLCGSENYQVIRSLISTVMSIQGF"
FT   gene            360295..361770
FT                   /locus_tag="Vdis_0366"
FT   CDS_pept        360295..361770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0366"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="COGs: COG0215 Cysteinyl-tRNA synthetase;
FT                   InterProIPR009080:IPR015803:IPR015273:IPR002308:IPR 014729;
FT                   KEGG: cma:Cmaq_0825 cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase class Ia ; Cysteinyl-tRNA
FT                   synthetase class Ia DALR; SPTR: A8MD04 Cysteinyl-tRNA
FT                   synthetase; TIGRFAM: cysteinyl-tRNA synthetase; PFAM: tRNA
FT                   synthetases class I (C) catalytic domain; DALR domain;
FT                   TIGRFAM: cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49771"
FT                   /db_xref="GOA:E1QTX4"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTX4"
FT                   /protein_id="ADN49771.1"
FT                   /translation="MYANSKELPIIVYNTASKNLEKITLLRPGLARIYVCGLTPYDSMH
FT                   VGHARTFVFYDIFRRYLEYLGVEVRFVTNFTDIDDKIINRARQEFGGELINRWYEVPSR
FT                   YIKEFFDAMDRLYVKRAYAYPKVTENINDMLKWIQELVSKNLAYVSPDGSVYFDITKVP
FT                   RYGEFSGQKIEDLIAGARVEPEPGKRNPLDFALWKSWSEGEPWWNSPWSPGRPGWHLEC
FT                   VVMSSKYLGVPFDIHGGGQDLIFPHHENEIAIARVYFGIDYFARYWIHVGLVTIRGQKM
FT                   SKSLGNIIPIMEVLRKYDGEVLRLYYAMTQYRKPMDFDPDALDQVRNSLMSVYAAYDML
FT                   TEAINEAPDTGDRDNELLSKVNEFVNSFEESLNNDINTSGAVAALMDFARYIASTVIYN
FT                   TQHYSRNALTNALTAFSDLANILGILNRTRLPPSLVSLIDTLIRIRAQLRARKMFDVAD
FT                   EIRNELSKLGVVVSDVGNKTYWYIDRDKITQWH"
FT   gene            361939..363783
FT                   /locus_tag="Vdis_0367"
FT   CDS_pept        361939..363783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0367"
FT                   /product="glycoside hydrolase 15-related protein"
FT                   /note="COGs: COG3387 Glucoamylase and related glycosyl
FT                   hydrolase; InterPro IPR008928:IPR011613:IPR012341; KEGG:
FT                   sul:SYO3AOP1_0709 glycoside hydrolase 15-related; PFAM:
FT                   glycoside hydrolase 15-related; SPTR: Q704C9 Glucan 1,4
FT                   alpha-glucosidase (Glucoamylase) and related glycosyl
FT                   hydrolases; PFAM: Glycosyl hydrolases family 15"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49772"
FT                   /db_xref="GOA:E1QTX5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTX5"
FT                   /protein_id="ADN49772.1"
FT                   /translation="MRTVFLSNGSLAVLYDENYYIRDIYYPLLGQHHHHSFGGRFKIGI
FT                   WHDGRFTWLEGIGNKGIRLSGSKAELHAQWDGLDIHMEDTVLIPQPVLVRHVSIRGPGF
FT                   VRVIFYHDFKLNDYEAGDTAFYDPSLDAVFHYKGTTWFGIASTNPIYEYTTGRRDLNVV
FT                   LPDCEDGILSKNPIAQGSVASAISIASPEFYYFIVAGDNYERVMRLIIELRDRRNVETY
FT                   FRRSVNYWSNVAAEYSDDELASQSIVVLLGHVGVNGSIPASLDTSIIKFNLDTYGYLWP
FT                   RDAAFAAMALDMAGYYTFTKRFYSLVFRLFGGEGFLFQKYNPSGTWGSTWHPWTVRSRR
FT                   SLNIQEDETATVIYAFWHYFQRTRDYDLLREVYDVIARAANFMVNFRDEKLKLPLESYD
FT                   LWEERLGVHTYTAASVYAGLLAASNLAKMLGEYESASKWEEAAMEIREAIRNYLFDRER
FT                   GVFYRFVRIDDGKITEVDRTVDASIMGVYIFNVFDVYEPMLESSVKVIMDRLWVKPVGG
FT                   VARYEGDYYQRVPGDYSGIPGNPWIITTLWVAQYYMAKGDCYRAKELMSWVNRVKTPTN
FT                   LLPEQVDPFKGLPVSVTPLVWSHAEYLRAYIMRRKHCA"
FT   gene            complement(363780..364784)
FT                   /locus_tag="Vdis_0368"
FT   CDS_pept        complement(363780..364784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0368"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="COGs: COG0205 6-phosphofructokinase; InterPro
FT                   IPR000023:IPR012003; KEGG: cma:Cmaq_1260
FT                   6-phosphofructokinase; PFAM: phosphofructokinase; PRIAM:
FT                   6-phosphofructokinase; SPTR: O57694
FT                   Pyrophosphate--fructose-6-phosphate 1-phosphotransferase
FT                   (Alternative product name: pyrophosphate-dependent
FT                   phosphofructokinase); PFAM: Phosphofructokinase; TIGRFAM:
FT                   phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49773"
FT                   /db_xref="GOA:E1QTX6"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTX6"
FT                   /protein_id="ADN49773.1"
FT                   /translation="MKVGILTGGGDAPGLNIAVYTLTKLLEGKHEVYAIFHGWRGILDK
FT                   EVRRVTSRDLIDFAFEGGTFIRTSRTNPFKDETRAEVFARNLRELGLDVIVAIGGDDTL
FT                   SAAAQTQARGLANVVGIPKTIDNDVYGTDYTIGFDTAVNEAIKVTESFKTTLISHERVG
FT                   VVEVMGREAGWIALFTGLATMADFVLIPEKPVNWDIVANRVKEVYKDRRWALVVVSEGI
FT                   KEYGGPKDEFGHSRLGGVGNELAQYIEKVTGLETRAVIPGHIIRGAPPTAFDRVLAVRF
FT                   ATEAFNAIEDDDFGKMVAYRGGDIVRVPITEVLGKNRLVSGYWIKLYETYWGP"
FT   gene            complement(364781..365578)
FT                   /locus_tag="Vdis_0369"
FT   CDS_pept        complement(364781..365578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0369"
FT                   /product="Fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="COGs: COG1830 DhnA-type fructose-1 6-bisphosphate
FT                   aldolase; InterPro IPR002915:IPR013785; KEGG: cma:Cmaq_1259
FT                   fructose-bisphosphate aldolase; PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase;
FT                   PRIAM: Fructose-bisphosphate aldolase; SPTR: P58315
FT                   Fructose-bisphosphate aldolase class 1; PFAM: DeoC/LacD
FT                   family aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49774"
FT                   /db_xref="GOA:E1QTX7"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTX7"
FT                   /protein_id="ADN49774.1"
FT                   /translation="MAGLIEKFLKVFARRGRSIILAYDHGIEHGPTDFLDNPDSADPEY
FT                   ILKLAREAGFDGVVFQRGIAEKYYDGSVPLIVKLNGKTSLYNGEPISVANCTVEEAVSL
FT                   GASAVGYTIYPGSGYEWKMFEELAKIKREAIKFDIPLIVWSYPRGGKVTNETAPEIVAY
FT                   AARVALELGADAMKIKYTGDPKTFAWAVKVAGKVPVLMSGGPKTKTEEEFLRQVEGVLE
FT                   AGAVGIAVGRNVWQRKDALKFARVLSEIVYGGKKVAEVLGEVG"
FT   gene            complement(365659..366387)
FT                   /locus_tag="Vdis_0370"
FT   CDS_pept        complement(365659..366387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0370"
FT                   /product="Creatininase"
FT                   /note="COGs: COG1402 Uncharacterized protein putative
FT                   amidase; InterPro IPR003785; KEGG: siy:YG5714_2616
FT                   creatininase; PFAM: Creatininase; SPTR: C3NB30
FT                   Creatininase; PFAM: Creatinine amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49775"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTX8"
FT                   /protein_id="ADN49775.1"
FT                   /translation="MRILEITRDEVPKDPLIIVPVGSIEQHGPHLPLGTDSIIANYIAA
FT                   EVERKMQNKALLYPLIAVGSSMEHAGFVGTTWVRFESLIHYLLDFIESVSAWSPVGIVF
FT                   VNGHGGNVDALTIVVKEWNYSRVRPRAYHYYIYNKRVVDYITRYFPSFGHADAVETSLI
FT                   AAISKDLVRWDRVTDIEVSGNINIFRTIDVSETGVIGSLRRDLVRPEVGSEILRFIVND
FT                   LLEQIQVIYGITIGNEGNNA"
FT   gene            complement(366504..366655)
FT                   /pseudo
FT                   /locus_tag="Vdis_0371"
FT   gene            complement(366652..366843)
FT                   /locus_tag="Vdis_0372"
FT   CDS_pept        complement(366652..366843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0372"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hbu:Hbut_0094 ATPase; SPTR: A2BJ08 Predicted
FT                   ATPase of the PP-loop superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49776"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTX9"
FT                   /protein_id="ADN49776.1"
FT                   /translation="MIFRRSIRAGDVVRVVRESILDRCSVYDRRAFVRIPYARLTLCKE
FT                   HFIEFVRRRIVRLLISIN"
FT   gene            366915..366993
FT                   /locus_tag="Vdis_R0006"
FT   tRNA            366915..366993
FT                   /locus_tag="Vdis_R0006"
FT                   /product="tRNA-Gly"
FT   gene            complement(367019..367582)
FT                   /locus_tag="Vdis_0373"
FT   CDS_pept        complement(367019..367582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0373"
FT                   /product="protein of unknown function DUF309"
FT                   /note="InterPro IPR005500; KEGG: pis:Pisl_0363 hypothetical
FT                   protein; PFAM: protein of unknown function DUF309; SPTR:
FT                   A1RRF9 Putative uncharacterized protein; manually curated;
FT                   PFAM: Domain of unknown function (DUF309)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49777"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTY0"
FT                   /protein_id="ADN49777.1"
FT                   /translation="MRVLLITKNPGFKPEDREALFMNLRKATKLKIINIRIASSHIEID
FT                   LNVDNNDYVYIIENLGFKVMDTVKIDLEEDEKYNEEYAIKRYIELFNEERFWEAHEVLE
FT                   RVWRKNRDEGIQGLIILAAAFVKIQENNPEAFKRLIIRARELIMKNQIPYINKEKLLRK
FT                   MDNALLLTKPFKIEREDLGSIQKA"
FT   gene            complement(367631..367796)
FT                   /pseudo
FT                   /locus_tag="Vdis_0374"
FT   gene            367756..367995
FT                   /locus_tag="Vdis_0375"
FT   CDS_pept        367756..367995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0375"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpr:CPR_0546 ISCpe2, transposase orfA; SPTR:
FT                   C5JVK6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49778"
FT                   /db_xref="GOA:E1QTY1"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTY1"
FT                   /protein_id="ADN49778.1"
FT                   /translation="MLKPIKPKTASALRNANITTTDKTTTYIDVIQKLHKRNSIYFSYE
FT                   IYTYLLGHNTILMSVLVLSLHTSTIRQNWLILAS"
FT   gene            368037..368360
FT                   /locus_tag="Vdis_0376"
FT   CDS_pept        368037..368360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0376"
FT                   /product="SAF domain protein"
FT                   /note="InterPro IPR013974; KEGG: cma:Cmaq_0208 SAF
FT                   domain-containing protein; PFAM: SAF domain protein; SPTR:
FT                   A8MAM1 SAF domain protein; PFAM: SAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49779"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTY2"
FT                   /protein_id="ADN49779.1"
FT                   /translation="MESVVVRSAPAVVLNPGDNVAVALRDLRAGEDVELIIGGSRVRVR
FT                   LLNDIPFGHKFAIRDIRMCDYVIKYGHVIGRAKRDIKVGEHVHVHNVESLTAVHSVCRG
FT                   GNP"
FT   gene            368357..369526
FT                   /locus_tag="Vdis_0377"
FT   CDS_pept        368357..369526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0377"
FT                   /product="Altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /note="COGs: COG2721 Altronate dehydratase; InterPro
FT                   IPR007392; KEGG: cma:Cmaq_0207 altronate dehydratase; PFAM:
FT                   D-galactarate dehydratase/Altronate hydrolase domain
FT                   protein; PRIAM: Altronate dehydratase; SPTR: A8MAM0
FT                   Altronate dehydratase; PFAM: D-galactarate dehydratase /
FT                   Altronate hydrolase, C terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49780"
FT                   /db_xref="GOA:E1QTY3"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTY3"
FT                   /protein_id="ADN49780.1"
FT                   /translation="MSRPTILGYVRPDGKVGIRNYLLVMSTVVCSSFVTRRIADQVQGA
FT                   VAIENPFGCGQLEPDLEITKRTLIGMAKNPNVGGVLVVGLGCEQIQADDLVKEIEKTGK
FT                   PVEKVVIQEVDGGTPAAIERGVTLLRKMAEEVLSQRPEEVDVSNLVMGVECGGSDATSG
FT                   LAANPVVGYASDKLVDLGGTVILSETPEMIGAEDILAKRAVSKEVGDKIVRVVKRWVDL
FT                   AASYGVDLVGTQPSPGNIAGGLSTIEEKSLGAIIKGGSRPIQGVVDYAEEVRDKGLWIM
FT                   DTPGYDIMSVVGMVAGGATLVVFTTGRGTPTGNPIAPVIKVTANPYTAKKMHENIDFDA
FT                   STVTLGQETIEQAGERLFKLIIDVARGKPTRAELLGFREFVIHKIIPSF"
FT   gene            complement(369528..369884)
FT                   /locus_tag="Vdis_0378"
FT   CDS_pept        complement(369528..369884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pas:Pars_1172 hypothetical protein; SPTR:
FT                   A4WK26 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49781"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTY4"
FT                   /protein_id="ADN49781.1"
FT                   /translation="MGIVRVKFRVYNPADMSRYVDVDGIVDTGAVYSVIASSFLNSIGI
FT                   KPLEKRRFLAFGGYVERNVGGAIIEVMGRRGAVTVIFGEEGDINVLGVTALEALGLEVD
FT                   IVRGTLKETEQLLL"
FT   gene            complement(369916..370806)
FT                   /locus_tag="Vdis_0379"
FT   CDS_pept        complement(369916..370806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0379"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding
FT                   protein"
FT                   /note="COGs: COG2084 3-hydroxyisobutyrate dehydrogenase and
FT                   related beta-hydroxyacid dehydrogenase;
FT                   InterProIPR016040:IPR008927:IPR002204:IPR006183:IPR
FT                   006115:IPR013328; KEGG: sid:M164_0486 6-phosphogluconate
FT                   dehydrogenase NAD-binding; PFAM: 6-phosphogluconate
FT                   dehydrogenase NAD-binding; SPTR: C4KDZ3 6-phosphogluconate
FT                   dehydrogenase NAD-binding; PFAM: NAD binding domain of
FT                   6-phosphogluconate dehydrogenase; TIGRFAM: UbiD family
FT                   decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49782"
FT                   /db_xref="GOA:E1QTY5"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTY5"
FT                   /protein_id="ADN49782.1"
FT                   /translation="MERLRVGFIGLGIMGSAMAMNIHKAGFPLIVYNRTKSKTEPFAKL
FT                   GIPVAESPREVAEKSDVVIDMVTDAPDVEEVLLGPNGVVHGAHPGLIVIDMSTNSPDHA
FT                   RYFARELGKYGIEFLDAPVTGGDIGARQGTLTIMVGGKYEVFEKVKPILQAMGKTIIYA
FT                   GDVGNGQMLKLLNQIVVGIDMLAVAEAMALARKAGIDMEKLFTVLSTGAANSFTVQYYM
FT                   PKMMKGDFEPGFRAAHLKKDLRYALETANRLNVPLPGTALTLQLYNALVAKGLGEKGTQ
FT                   ALLKLYYEMAGISDG"
FT   sig_peptide     complement(370750..370806)
FT                   /locus_tag="Vdis_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            370900..371889
FT                   /locus_tag="Vdis_0380"
FT   CDS_pept        370900..371889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0380"
FT                   /product="molybdopterin binding domain protein"
FT                   /note="COGs: COG0303 Molybdopterin biosynthesis enzyme;
FT                   InterPro IPR001453; KEGG: dka:DKAM_0218 molybdopterin
FT                   binding domain protein; PFAM: molybdopterin binding domain;
FT                   SPTR: B8D2Z7 Molybdopterin binding domain protein; PFAM:
FT                   Probable molybdopterin binding domain; TIGRFAM: molybdenum
FT                   cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49783"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTY6"
FT                   /protein_id="ADN49783.1"
FT                   /translation="MRLVRVEDAIGQVLGYDTTYVGRDGATVLLPRGHVITRDDVEKLK
FT                   DSGVYFVWVEGNEESSDLMYEWEIAETVARAVAGENTYIKPARQGSAWIMSSVNGVLKV
FT                   DIHGLTELNLGGNVLLITRQGMSGVVKDELVGIIDVIPLSMRRSEVEELLRYRNLISVV
FT                   PFRRRKIGIVITGTEIYQGRKRDLYYPVIKARADKYGWEVTFNTVVPDDEDKIMNAVKE
FT                   AISNGVEAIVITGGMSVDPTDKTPNAIRRLGARVIAYGVPIKPTTMTMIAMLDNTPILA
FT                   ISAGGIYYSDYNAIDIFLPRLMADLIPSREEIAAMGHGGILPNYRPHH"
FT   gene            complement(371886..372317)
FT                   /locus_tag="Vdis_0381"
FT   CDS_pept        complement(371886..372317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0381"
FT                   /product="HEPN domain protein"
FT                   /note="InterPro IPR007842; KEGG: tpe:Tpen_0999 hypothetical
FT                   protein; PFAM: HEPN domain protein; SPTR: A1RYW9 Putative
FT                   uncharacterized protein; PFAM: HEPN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49784"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTY7"
FT                   /protein_id="ADN49784.1"
FT                   /translation="MIDPMNEVKYRYELANEHLSRAERYYELDDWAGCVHSSQLAVENF
FT                   AKAIIAIYQVPTWSHDPLNQLMSIISQVPGSVKELIIELARMSHELAAEHARSTYGEPT
FT                   AGLTPGMIYNREIAARALSMAHRARDIVTSVFNALGITV"
FT   gene            complement(372314..372775)
FT                   /locus_tag="Vdis_0382"
FT   CDS_pept        complement(372314..372775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0382"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="InterPro IPR002934; KEGG: tpe:Tpen_0998 DNA
FT                   polymerase beta subunit; PFAM: DNA polymerase beta domain
FT                   protein region; SPTR: A1RYW8 DNA polymerase, beta domain
FT                   protein region; PFAM: Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49785"
FT                   /db_xref="GOA:E1QTY8"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTY8"
FT                   /protein_id="ADN49785.1"
FT                   /translation="MINCQAVINDVRAKLSRLVGGSFMAVLLFGSLARCEADEYSDVDL
FT                   LVLHSGLGRIDRVKRRRAVYLAISALLRDYPLTVIDMDINEFLNPGIITPLLLNIYWDA
FT                   MVLLDRTGKLNEFLEQVRRRIVESGLRRIRDGKAYYWVLPKPLERVRII"
FT   gene            372896..373372
FT                   /locus_tag="Vdis_0383"
FT   CDS_pept        372896..373372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0383"
FT                   /product="PaREP1 family protein"
FT                   /note="InterPro IPR010268; KEGG: sis:LS215_0596 PaREP1
FT                   family protein; PFAM: PaREP1 family protein; SPTR: C3MM66
FT                   PaREP1 family protein; manually curated; PFAM: Archaeal
FT                   PaREP1/PaREP8 family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49786"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTY9"
FT                   /protein_id="ADN49786.1"
FT                   /translation="MEELIRMAEERGIDVEDLIINAIRSRSKDPLESIRLRIELARKFI
FT                   TEARERLNTGDSIQASEKAYKAAEEVVKALAEKFNIPEYQQAIKEGRWYTHQLSSAASK
FT                   LSRTLGNWVLNGWSSAYLLHVWGFHEAKLSADDIVGYVNEVERMVKEAEKLLTH"
FT   gene            373433..374113
FT                   /locus_tag="Vdis_0384"
FT   CDS_pept        373433..374113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0384"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="COGs: COG2414 Aldehyde:ferredoxin oxidoreductase;
FT                   InterPro IPR013983; KEGG: cma:Cmaq_1809 aldehyde ferredoxin
FT                   oxidoreductase; PFAM: Aldehyde ferredoxin oxidoreductase;
FT                   PRIAM: Aldehyde ferredoxin oxidoreductase; SMART: Aldehyde
FT                   ferredoxin oxidoreductase; SPTR: A8MAZ8 Aldehyde ferredoxin
FT                   oxidoreductase; PFAM: Aldehyde ferredoxin oxidoreductase,
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49787"
FT                   /db_xref="GOA:E1QTZ0"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTZ0"
FT                   /protein_id="ADN49787.1"
FT                   /translation="MALFGWVGKVLYVNLSNGKIWVETVGEDVYDKVLGGEGLAAYIIY
FT                   KRFREIKGPLDPSNILVFASGPLTSDIIPQSGRVSIGFISPLTGIWGSTHVGTRFAYEL
FT                   KRAGLDAVVVMDRAEKPVYIYIEEGQADIRDAGKYWGLDIIETVNALRRDLNDQSIKAL
FT                   AIGPAGEHLVEFSTIANEEGIGGRAGGGAVMGSKNLKAIVVKGTRPIEYAYSEELRRYV
FT                   HWWL"
FT   gene            374163..374704
FT                   /pseudo
FT                   /locus_tag="Vdis_0385"
FT   gene            complement(374730..375206)
FT                   /locus_tag="Vdis_0386"
FT   CDS_pept        complement(374730..375206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0386"
FT                   /product="PaREP1 family protein"
FT                   /note="InterPro IPR010268; KEGG: sto:ST0717 hypothetical
FT                   protein; PFAM: PaREP1 family protein; SPTR: Q974D4 Putative
FT                   uncharacterized protein ST0717; PFAM: Archaeal
FT                   PaREP1/PaREP8 family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49788"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTZ1"
FT                   /protein_id="ADN49788.1"
FT                   /translation="MEVTKPWIDARRYQEDRFREAFYEAELAERFLQNGLLRNAAGKAF
FT                   QAIKAYVAGLAVDYREELTKHYPGVRRLGPNKVVDRVDWLIAVMPSSRLREVASIIGDK
FT                   ELRLYVEIALNLHEFQYNGLDRDSEVSRYSSEELVRKDVVEVINFIRDRLKNRI"
FT   gene            complement(375248..375727)
FT                   /locus_tag="Vdis_0387"
FT   CDS_pept        complement(375248..375727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0387"
FT                   /product="PaREP1 family protein"
FT                   /note="InterPro IPR010268; KEGG: sim:M1627_0994 PaREP1
FT                   family protein; PFAM: PaREP1 family protein; SPTR: C3N4J2
FT                   PaREP1 family protein; PFAM: Archaeal PaREP1/PaREP8 family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49789"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTZ2"
FT                   /protein_id="ADN49789.1"
FT                   /translation="MEIPEELIKAAEEKGIDIIDLLISAIGRSDPSTAIRIRLELAEKY
FT                   LNEAKEYVRKGDAVQASEKAYKAAEECIKALAERYNIPEHQQAIKEGRWYTYLLGMASN
FT                   TLASILGDWVATGWAAGYVLHVWGFHEAKFSVGDLSNYLRLVENLVTNTKKALGT"
FT   gene            complement(375752..376628)
FT                   /pseudo
FT                   /locus_tag="Vdis_0388"
FT   gene            376729..377199
FT                   /locus_tag="Vdis_0389"
FT   CDS_pept        376729..377199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0389"
FT                   /product="PaREP1 family protein"
FT                   /note="InterPro IPR010268; KEGG: tne:Tneu_1916 PaREP1
FT                   family protein; PFAM: PaREP1 family protein; SPTR: B1YBM9
FT                   PaREP1 family protein; PFAM: Archaeal PaREP1/PaREP8 family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49790"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTZ3"
FT                   /protein_id="ADN49790.1"
FT                   /translation="MQSLLELLSEIAKKRDLSPELYLAELISRDLDPKDRVSIYLKIHS
FT                   ELLNEAEKEYADNDLVQAGEKYWGAVVALLNAIAELKGWEHFSHRDYAIIIERLADEFN
FT                   DDELRTLFDSVEKLHANFYHNFLDRSGFNLRRDRALALIKRLSEYMARLKGD"
FT   gene            complement(377206..378354)
FT                   /locus_tag="Vdis_0390"
FT   CDS_pept        complement(377206..378354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0390"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="COGs: COG4948 L-alanine-DL-glutamate epimerase;
FT                   InterProIPR018087:IPR018110:IPR012619:IPR013341:IPR 013342;
FT                   KEGG: csa:Csal_2476 mandelate racemase/muconate lactonizing
FT                   enzyme; PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; myoactive tetradecapeptide family protein; SPTR:
FT                   C8Q2N5 Mandelate racemase/muconate lactonizing protein;
FT                   PFAM: Mandelate racemase / muconate lactonizing enzyme,
FT                   C-terminal domain; Mandelate racemase / muconate
FT                   lactonizing enzyme, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49791"
FT                   /db_xref="GOA:E1QTZ4"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTZ4"
FT                   /protein_id="ADN49791.1"
FT                   /translation="MRITDVTAYVAKAYVGKPVTGFRGFYEDVASRISHGFTAVYVKVV
FT                   TDEGLVGWGEAIAREAPEAAASVINSLFKPMLIGKDPLDSEVLWEQLFSAMRIRGHYAG
FT                   YYVEALSGVDLALWDIKGKYLGKPVYKLIGGAFRDRVKAYASSVLFMSPEDTVKEVERL
FT                   VQEGFRYVKVKIGRGYDMDKAVIKAIRDSLGSEVEIMVDANTAYNVSTAIKVGRMLEKY
FT                   DVLWFEEPVPPDNIEAYSRVAKALDIPIAAAETLFTKYQWLEFMIKEAVDIAMPDIARI
FT                   GGITEAMRIAALADAFGIPMTFHVGLSRAMCRAATLQFIASLPSHITFTPTYEYYYVER
FT                   NPLAYDTTNEPVEVFKGDDVEIPNRPGLGIEINEEKLRRYIT"
FT   gene            complement(378520..379566)
FT                   /locus_tag="Vdis_0391"
FT   CDS_pept        complement(378520..379566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0391"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="COGs: COG1063 Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenase; InterPro
FT                   IPR011032:IPR016040:IPR013154:IPR013149; KEGG:
FT                   cma:Cmaq_1304 alcohol dehydrogenase; PFAM: Alcohol
FT                   dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; SPTR: A8M8R2 Alcohol
FT                   dehydrogenase GroES domain protein; PFAM: Alcohol
FT                   dehydrogenase GroES-like domain; Zinc-binding
FT                   dehydrogenase; TIGRFAM: 2-desacetyl-2-hydroxyethyl
FT                   bacteriochlorophyllide A dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49792"
FT                   /db_xref="GOA:E1QTZ5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR026583"
FT                   /db_xref="InterPro:IPR031640"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTZ5"
FT                   /protein_id="ADN49792.1"
FT                   /translation="MKAVTVIPGVPESLRLMEVPKPSPSKGQVLLKPIRVGVCGTDKEI
FT                   IEGRYGKAPEGSQYLILGHEAVAEVVELGDGVDNVGVGDIVVPTVRRPLNCDLPVDFCP
FT                   VGHYLEHGIWGLHGHAAEYSVTDAKYLVKVPKEVIDIAVLTEPLSVVEKGIDMAMRLGQ
FT                   SRFDWKPKTALILGAGPVGLLATMVLRLMGLSTVTTATRPPDSLKAKLVKELGGVYVDS
FT                   AIEQISGEFDIVIEATGAPQVVNEGFRHVAPNGVYVLLGVYPSGGSLNNLGELMTNVVL
FT                   NNKVIVGSVNAGIKHFEMALEHLRRAKEEFSNWPAKLITKRASLSNYQEAYTWTHDDIK
FT                   TVLEIIPS"
FT   gene            complement(379645..381576)
FT                   /locus_tag="Vdis_0392"
FT   CDS_pept        complement(379645..381576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0392"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="COGs: COG0674 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase alpha subunit;
FT                   InterProIPR009014:IPR002869:IPR019752:IPR002880:IPR 015941;
FT                   KEGG: pto:PTO1000 2-oxoglutarate synthase, alpha chain;
FT                   PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; Pyruvate/ketoisovalerate oxidoreductase; SPTR:
FT                   Q6L0B7 2-oxoglutarate synthase, alpha chain; PFAM: domain;
FT                   Transketolase, C-terminal domain; Pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49793"
FT                   /db_xref="GOA:E1QTZ6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTZ6"
FT                   /protein_id="ADN49793.1"
FT                   /translation="MPTDIMWVIGGPQGGGIDTGANVFMRAMARAGYYVIGDREYFSNI
FT                   KGRHSYFMVRVSDEPRGGLLSSIDMLVALDAESVFTHFQDVKRGGYVIVDTSTFNTRLD
FT                   QLQYMEDELKDRLREFFSKAGIEPTVKGVIDYLRGNGVNVLTIHYADLLQDVKKRLHDI
FT                   DLPSLIGRYSNVVMTAYSTAIMGLPIDYVFKGLEDVFTGRRGKLLEYNKAIVEVVYDYA
FT                   KPIKTGISLPPIKRDVKAIIVNGNEAVAIGKILGGLRFQTYYPITPAADESFFIEAHNI
FT                   VSLDPVTEEAKALERAGIVVVQTEDEISAINMAIGAGIAGARAATATSGPGLSLMVEGT
FT                   GFAGMNEVPVVITHYQRAGPSTGMATRNSQSDLRFVMHMGHGEFPRIVISSGDHREAIE
FT                   DAFKALNWAERYQMPVIHLVDKTLANSYSTVIWDIDKRTLKIDRGLIVTKDENDYRRFR
FT                   ITKDGVSPRSIPGLGPIFWLTGDEHDEFGHITEDPVTRTEMYEKRMGKLELADREIPIT
FT                   DKVRLYGPESADITLVGWGSTKGVLLDVMNMLSREGYRVNFLQLKMFIPFPSEFVRNVL
FT                   SKGQLIIDVESNYEAQAAGVIREKTGIEIKHRVVKVTGRPIFVDEVYDAVKKILKDKDE
FT                   KIILMKGP"
FT   gene            complement(381713..382714)
FT                   /locus_tag="Vdis_0393"
FT   CDS_pept        complement(381713..382714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0393"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="COGs: COG1064 Zn-dependent alcohol dehydrogenase;
FT                   InterPro IPR011032:IPR016040:IPR013154:IPR013149; KEGG:
FT                   cma:Cmaq_1615 putative alcohol dehydrogenase; PFAM: Alcohol
FT                   dehydrogenase GroES domain protein; Alcohol dehydrogenase
FT                   zinc-binding domain protein; SPTR: A8M9W7 Alcohol
FT                   dehydrogenase GroES domain protein; PFAM: Alcohol
FT                   dehydrogenase GroES-like domain; Zinc-binding
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49794"
FT                   /db_xref="GOA:E1QTZ7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTZ7"
FT                   /protein_id="ADN49794.1"
FT                   /translation="MRAVVVYERGKYEVRDVPMPRLNDGDVLIKISYAALCYRDLLQLA
FT                   GYYPRMKYPVILGHEAVGVVVESKDPRFKPGDRVVPLLHEPDGTCEFCMRGLDSYCINA
FT                   LSYGENVNGFFAEYARVSGNALVKVPNGVPDELAAFTPCVIAMVYKGLKRAGLTYGETV
FT                   VVTGASGGVGIHAVQLAKALGARVIAVTRSPDKARFIRQFADDVVTEQRFSKVVKDLTN
FT                   GLGADMVIEAVGTPTIEESLRSLRSGGRVIIIGNVNPDETYQLRLGYLIMKDVVMIGNV
FT                   RSNRSDVAETLKILSKGLVKPVIAATYPLERFGDALEFMRNNSRIGKILIKP"
FT   gene            complement(382768..383556)
FT                   /locus_tag="Vdis_0394"
FT   CDS_pept        complement(382768..383556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0394"
FT                   /product="Hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="COGs: COG2145 Hydroxyethylthiazole kinase sugar
FT                   kinase family; InterPro IPR000417:IPR011144; KEGG:
FT                   cma:Cmaq_0062 hydroxyethylthiazole kinase; PFAM:
FT                   hydroxyethylthiazole kinase; PRIAM: Hydroxyethylthiazole
FT                   kinase; SPTR: A8M9N5 Hydroxyethylthiazole kinase; PFAM:
FT                   Hydroxyethylthiazole kinase family; TIGRFAM:
FT                   hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49795"
FT                   /db_xref="GOA:E1QTZ8"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTZ8"
FT                   /protein_id="ADN49795.1"
FT                   /translation="MINYWDDLQAIRRKRPLVHHLMNYVVMNDAANVTLAVGASPIMAH
FT                   AREEVEELAAKADVLYINIGTLDDRWVESFILAGKAASRNNVPVLLDPVGAGATRFRTE
FT                   TVLRILDEVEVGVLKGNGGEMMALAGVAGMIKGVDSLGEASPEIAERLAREYGVTAVIT
FT                   GPRDYVSDGKRVAIVSNGTPMLQYITGSGCMVGSVIASFMAVNRDFLIASVEGLVTFEI
FT                   AAEKAERKSSGPASLKVNLIDELYNMKPSDYEMARVELRG"
FT   gene            383723..384625
FT                   /locus_tag="Vdis_0395"
FT   CDS_pept        383723..384625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0395"
FT                   /product="Protein of unknown function DUF1626"
FT                   /note="COGs: COG5493 conserved hypothetical protein
FT                   containing a coiled-coil domain; InterPro IPR012431; KEGG:
FT                   tpe:Tpen_1359 hypothetical protein; PFAM: Protein of
FT                   unknown function DUF1626; SPTR: A1RZX6 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1626)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49796"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR012431"
FT                   /db_xref="InterPro:IPR024271"
FT                   /db_xref="UniProtKB/TrEMBL:E1QTZ9"
FT                   /protein_id="ADN49796.1"
FT                   /translation="MSRNLKDEFLRLLREDEVFRLAVIGFLGISDVQSSLRQLVSVVSD
FT                   LTRTVQRLVEGQERLWEENNKLWQEVRRLAEGQEALRTDVSKLWEENNKIWQEIKALRE
FT                   NQEKLWENQNKLWQEVKALREEQERRWQENERRWEENNRRWEEAYKRFEVIETELRNLR
FT                   EDFNKSMAAINRRLDALGARWGVISEEAFREGMKGVIERILGTAKVEKWTYNDTNGEVY
FT                   GHPAIVDVDLVIRDNVHVLVEVKSSISRGDVAEFWRVGRLYERVNGVKPRLVMISPYVD
FT                   DKAMELARELGIEVYTNVT"
FT   gene            384822..385112
FT                   /locus_tag="Vdis_0396"
FT   CDS_pept        384822..385112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0396"
FT                   /product="HTH DNA binding domain-containing protein"
FT                   /note="COGs: COG5625 transcription regulator containing HTH
FT                   domain; KEGG: smr:Smar_1446 HTH DNA binding
FT                   domain-containing protein; SPTR: A3DPH6 HTH DNA binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49797"
FT                   /db_xref="GOA:E1QU00"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU00"
FT                   /protein_id="ADN49797.1"
FT                   /translation="MNRDKAIGIGLLVISVVIILAYIYLTFFTPYTTLVLQITDTLIII
FT                   VVFGILAWVGYALATTPPPKPIEEIEKEIEAELKKLEEETKQEQQKAQQQQ"
FT   gene            385482..386099
FT                   /locus_tag="Vdis_0397"
FT   CDS_pept        385482..386099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0397"
FT                   /product="thymidylate kinase-like protein"
FT                   /note="KEGG: cma:Cmaq_1461 thymidylate kinase-like protein;
FT                   SPTR: A8M966 Thymidylate kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49798"
FT                   /db_xref="GOA:E1QU01"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU01"
FT                   /protein_id="ADN49798.1"
FT                   /translation="MVHDRICLFGPDGSGKSTLARLLAQYLARGDYVRISWVRGSHMAA
FT                   SLLARFLALFPSMRGVDNPYYGISIPKNLRPLWWFLEFISVLPNWFFRFIMPSIYETVI
FT                   GERGLLDFLVWVCVTTEPGFLKTLWGRATLALALKHCRNVFIIADLKTLIRRKGREPTA
FT                   RTLPRQWVIYNALAKSLNLISVDTSSDTPIQSLIKLISELGM"
FT   gene            complement(386105..387076)
FT                   /locus_tag="Vdis_0398"
FT   CDS_pept        complement(386105..387076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_0605 hypothetical protein; SPTR:
FT                   A8MCE0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49799"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU02"
FT                   /protein_id="ADN49799.1"
FT                   /translation="MSIKDEFLRLLREDEVFRLAVIGFLGISDVQSSLRQLVSVVSDLT
FT                   RTVQRLVEGQERLWEENNKLWQEVRRLAEGQEALRTDVSKLWEENNKIWQEIKALRENQ
FT                   EKLWENQNKLWQEVKALREGYEALRVDVNKLWEENRRINENIERIWQEIRALHEGQERL
FT                   WQENNRIWQEIRRINENIEKLWQENNKIWRELRGIRRTLEHVTLSIEEEANEVVQYFLR
FT                   QRGVVVETRPTHLNARFEFDVYGTDGRLTIVGEAKTRASPNTVRRVAEKIDEAIRAMPD
FT                   KFPGRVIKVIYCLRAMPGAVEEANRLGIWFLESGRERNSPGI"
FT   gene            complement(387536..388123)
FT                   /locus_tag="Vdis_0399"
FT   CDS_pept        complement(387536..388123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0399"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mae:Maeo_0523 hypothetical protein; SPTR:
FT                   B9NUC1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49800"
FT                   /db_xref="GOA:E1QU03"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU03"
FT                   /protein_id="ADN49800.1"
FT                   /translation="MNIKSLLRITGIVGFIIAVIATYLYVTYILIPAITPIFIHQIEAQ
FT                   LSSEGVTISQGDISGFISFIKAIMPITTLVGLVIGWLIEAAVLMALLRAFRINAGFMDT
FT                   WLLSGNYFYVSVVQTAITATTPLLEYSINAVATHHSILSEPMVLTVSLAFVVVGSLLLA
FT                   YIFARVYGTGITKALIPTLIALVIFWAISTVI"
FT   gene            complement(388167..388889)
FT                   /locus_tag="Vdis_0400"
FT   CDS_pept        complement(388167..388889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0400"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1136 ABC-type antimicrobial peptide
FT                   transport system ATPase component; InterPro
FT                   IPR017871:IPR003439:IPR003593; KEGG: cma:Cmaq_0772 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: A8MCV1 ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49801"
FT                   /db_xref="GOA:E1QU04"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU04"
FT                   /protein_id="ADN49801.1"
FT                   /translation="MSFIEARDVWKYYGDYPALRGVNLEINEGEFRCIVGPSGSGKTTL
FT                   LSLIGGLDRVSRGYLRVGPYELHRLGNAELDRYRNEFVGFVFQLYYLIPRMTVLENVEL
FT                   PLIARGVDPSQRRRLALEALEMVGLRDKARRRPNELSGGEQQRVAIARAIVARPRLLLA
FT                   DEPTGNLDSKTAAIIMEIFRKLNRELGMTIVMVTHNLELIGNCHKVSRISDGVITRTYE
FT                   VPQVRESLEQLIRELTAI"
FT   gene            389014..390645
FT                   /locus_tag="Vdis_0401"
FT   CDS_pept        389014..390645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0401"
FT                   /product="conserved repeat domain protein"
FT                   /note="InterPro IPR001434; KEGG: cma:Cmaq_0771 hypothetical
FT                   protein; SPTR: A8MCV0 Conserved repeat domain; TIGRFAM:
FT                   conserved repeat domain protein; TIGRFAM: conserved repeat
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49802"
FT                   /db_xref="GOA:E1QU05"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU05"
FT                   /protein_id="ADN49802.1"
FT                   /translation="MSKMITNRHILVITMAVLALLALIPLAQAQQYSNTAPPFSIVSIS
FT                   STPSPTITGISKVSITLIYTGGYYLYNTEFSLTPCSGAVVSQNPVFIGWLNPGQEVTVT
FT                   YLINSTLPINCQSTLTISWGAEYETSPRAQVTTYIQVAGSGSMNINFPLVVYGSPIITA
FT                   YTKTQYLVSNLVNPVELVISNNGSGPIYDLQANVGIEGATLAAGSNTLIIGTLNPGSNY
FT                   TTTLYVLPTGSGPVTMTIGYSGLDQNGNVVSGSISISMGVTTVSSSQVIVYPVNSSLSI
FT                   GSGRLVIGIRNVNPVTIYNVTLVIASTQGLSLAGSTAYDIAEIPPGSTDYVYVPVAVPI
FT                   TSSSASITYSLTYQYAGGYPGSIQGAMTLSVLNQPSILVTGYQVAPTPLTIGETGSVSL
FT                   NFVNTGPVPAYNLNITAIPGPGIKIISQSSTYMGTLNSQQLSAVAFSFSVTRVMNTTIT
FT                   FQIQYTDQFGQQHVQYYTVPITVVRNATLFIQSSSQVGQQGTVINYYRFHRTNYFTYVI
FT                   IALAVVAVAIIITVVLLLRRRHGGST"
FT   sig_peptide     389014..389100
FT                   /locus_tag="Vdis_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            390642..391886
FT                   /locus_tag="Vdis_0402"
FT   CDS_pept        390642..391886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0402"
FT                   /product="protein of unknown function DUF214"
FT                   /note="COGs: COG4591 ABC-type transport system involved in
FT                   lipoprotein release permease component; InterPro IPR003838;
FT                   KEGG: cma:Cmaq_0770 hypothetical protein; PFAM: protein of
FT                   unknown function DUF214; SPTR: A8MCU9 Putative
FT                   uncharacterized protein; PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49803"
FT                   /db_xref="GOA:E1QU06"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU06"
FT                   /protein_id="ADN49803.1"
FT                   /translation="MRVSDYFKLAWSAAWERRGRTIGAIVGIIIAIVALGLAIGMGQGY
FT                   KVLTTSFFERVFGTNTVFLFPGQNSQLTLTDVYEVMNIPHVTNAIPILSTVARVNINGH
FT                   EVTATIIGATEQEIMQLYGVTSLSNAILAGAPVLSPGLALVGYNIAFTSTGQQIAYPGQ
FT                   VMVITTPGGSEITYTVGAIMQQSGIGVIGLNPNNAIFIDENTFLSQFDPSGTVDGIIVY
FT                   VDSPNNINYVTDELKAMFPMDQVLNLSTLLSSINQFFTVLELFLAFIAGISFVIIGIWM
FT                   FDTMMLNVIQRTREFGIMRAVGFSGRSIPLLLIIEAAIIAVIGSVIGTALLMAIVSVFP
FT                   SPSSFMGPAFGGPGRVARGAAAAAASPSIMLPIALTPLDFAAIFILPIVINVIAALVPA
FT                   LRAMRIPPAQTLRYE"
FT   gene            complement(391920..393011)
FT                   /locus_tag="Vdis_0403"
FT   CDS_pept        complement(391920..393011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0403"
FT                   /product="ATPase"
FT                   /note="COGs: COG1672 ATPase (AAA+ superfamily); InterPro
FT                   IPR011579; KEGG: pas:Pars_0503 ATPase; PFAM: ATPase; SPTR:
FT                   A4WI81 ATPase; PFAM: Archaeal ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49804"
FT                   /db_xref="GOA:E1QU07"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU07"
FT                   /protein_id="ADN49804.1"
FT                   /translation="MLFDLEPKSRREDLYDFEAELRNLINGIINDRIIVVRGLRRTGKT
FT                   SLMRVALNEIGYPYIYLDVRFTGRPRQADLIELIRHGLEDFLARNKPIIDRVRDALSRI
FT                   RWVRIGASPIHVEIKLGEFRRLSIGELLNAINDLGTELGNPVIIAIDEAQELSRVTWID
FT                   FNALLAYSYDNLKYVKFLISGSEVGVLDRFLRVNDPEAPLFGRYIHFASTRRLSPDESL
FT                   DFLRRGFEQYGVQVSDELLMRIVNELDGVIGWLTYIGHKYVVEGRQSLDEVLESAMALA
FT                   LNELRNFLTNRSPRYRALLRELFVRRSWRELKAALETAEGRPINDKSLYVLLRELIDHG
FT                   IVEKVDEDYVIADPILRRAVLKL"
FT   gene            complement(393052..393510)
FT                   /locus_tag="Vdis_0404"
FT   CDS_pept        complement(393052..393510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR001412; KEGG: cma:Cmaq_1036 hypothetical
FT                   protein; SPTR: A8MDK9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49805"
FT                   /db_xref="GOA:E1QU08"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU08"
FT                   /protein_id="ADN49805.1"
FT                   /translation="MRRGLLITGAVLIVIAVLVFAIGVYMVLTQAKITVTTATLPPGGN
FT                   ITLGTANPDRILTVSYMDSINKPLEIYVTAPGQWSQKYVNGYYVVAYAVLSGKGNLYLI
FT                   NNYSIPVTVTYYIISGLRTGGAFELMGIVIGIIGVILAILGAVLRPRR"
FT   sig_peptide     complement(393448..393510)
FT                   /locus_tag="Vdis_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(393737..394075)
FT                   /locus_tag="Vdis_0405"
FT   CDS_pept        complement(393737..394075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1899 hypothetical protein; SPTR:
FT                   A8MBI3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49806"
FT                   /db_xref="GOA:E1QU09"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU09"
FT                   /protein_id="ADN49806.1"
FT                   /translation="MTFTEEIKVGRKGLPVNELPYTIKVYINNQVLVPANLVRSLGLDK
FT                   VKYVSVIMEYNGYKIEVDNVKLLRTRHTASRQFTIPKEIREKYGIRPFDNVTIHMIIPR
FT                   QAPPPLKN"
FT   gene            394379..395623
FT                   /locus_tag="Vdis_0406"
FT   CDS_pept        394379..395623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0406"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /note="COGs: COG0452 Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase; InterPro
FT                   IPR003382:IPR007085:IPR005252; KEGG: cma:Cmaq_1701
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein; PRIAM: Phosphopantothenate--cysteine
FT                   ligase; SPTR: A8MAE7 Phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; PFAM:
FT                   DNA / pantothenate metabolism flavoprotein; Flavoprotein;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase,
FT                   prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49807"
FT                   /db_xref="GOA:E1QU10"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU10"
FT                   /protein_id="ADN49807.1"
FT                   /translation="MSFREDIELIKGSRSNLLRGKRVVLALTGGISIYRVPDIARELIR
FT                   HGADVVTFMSKEASRLLGPRVMEWATGNPVYVELSGYAEHVNICTTANAVVIAPATANT
FT                   ISKIANGIGDTSVTLCAMTALGSGVPLLLVPAMNESMWRNPIIRSNIEKLRNLGVHFVE
FT                   PIIEEGKAKLATNQEVVDSVIDLLSPRDMNGLSVLITSGPTHEYIDATKYITTPSSGLT
FT                   GYYFAREAMARGARVTLIEGPVSISDPPGAEVYRVKSVLEMYDTAIKLVSKRHYDLAIL
FT                   TAAPLDFYVKDKVSGKLSSDLDKVVIELIQAPKIARDLKRYSPGTFLIAYKAEVGITEE
FT                   ELIARTLKRASEGDWDLALAHLVGEGKGFGTEKDEVLVLSKNGVIRRIGPLHKRELARE
FT                   VLGLYLSMSRSRVKN"
FT   gene            395691..397019
FT                   /locus_tag="Vdis_0407"
FT   CDS_pept        395691..397019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0407"
FT                   /product="General substrate transporter"
FT                   /note="InterPro IPR016196:IPR005828; KEGG: cma:Cmaq_1414
FT                   major facilitator transporter; PFAM: General substrate
FT                   transporter; SPTR: A8M920 Major facilitator superfamily
FT                   MFS_1; PFAM: Sugar (and other) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49808"
FT                   /db_xref="GOA:E1QU11"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU11"
FT                   /protein_id="ADN49808.1"
FT                   /translation="MSGPTVPEHVRRRGLMLASISTFLAWALEYYDFLIYFSLIPYISE
FT                   LFFPKSNPLAALIYTLLVFAVGYFARPLGAIFFGHIGDKYGRRNALLGDAITMAAATVV
FT                   IALLPTYSQIGIWAPTLLTIFRFVQGFGYGGEAGGGVVWALEFASPKWRGLVNGVLNSS
FT                   MSVASLLATGLLLLVSAYYPIGVVGWRILFLSGAVVVIIGLIIRFAAPESILWERKREE
FT                   GRIVKIPLATAIRRYWFSLILVILINLGLTFVFYAGYGFVTTFTKLLSSYMPELQRAFI
FT                   KLTYLPLMLGSIGGIIGNTFGGYLTDLFGRRRMLIIPTAILLITIYPLYLALTTLSIPI
FT                   MALSLALMYFIFTLSATVQTAYFSEIFPTEVRWSGIGFGWNLNAAIGSLAPTFALLLYT
FT                   SLKGGMNPITAAALAPSIVVMIGAAMTIIGASIGPETVRKQLE"
FT   sig_peptide     395691..395771
FT                   /locus_tag="Vdis_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(397071..398129)
FT                   /locus_tag="Vdis_0408"
FT   CDS_pept        complement(397071..398129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0408"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="COGs: COG2025 Electron transfer flavoprotein alpha
FT                   subunit; InterPro IPR014730:IPR014731:IPR001308:IPR014729;
FT                   KEGG: cma:Cmaq_0476 electron transfer flavoprotein alpha
FT                   subunit; PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit ; Electron transfer flavoprotein alpha
FT                   subunit; SPTR: A8MBX8 Electron transfer flavoprotein alpha
FT                   subunit; PFAM: Electron transfer flavoprotein domain;
FT                   Electron transfer flavoprotein FAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49809"
FT                   /db_xref="GOA:E1QU12"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU12"
FT                   /protein_id="ADN49809.1"
FT                   /translation="MSAAQAQQKICSEWNPVNKNEYRGIWVYVEYVNGVIKDGSLQLIG
FT                   KARELAGKISTDVTAVVLGYNLGDAVKEPIYYGADKVIYVDHPALAKYVPHIYANVIVQ
FT                   LANKYKPEIILFAATKRGRELAPYVANSLRTGITADCTELDVDPKTRDLDQVRPTYGGN
FT                   ILAHIRTPTRRPQLASVRPNVFPTPPRDTSRKGEIIEETINSIPSINGQGLIEVKSVVK
FT                   GEELPPVEKADIVVVAGRGVGSADGVKLLTELAKLLGGTIGGTKKVVDAGWLAADRQVG
FT                   QTGKTIRPTLYIGVGVSGAIQHVFGMKESKIIVAINSDPNAPIFQYADYGIVGDYRDVV
FT                   KELIELLKNYKK"
FT   gene            complement(398126..398947)
FT                   /locus_tag="Vdis_0409"
FT   CDS_pept        complement(398126..398947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0409"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="COGs: COG2086 Electron transfer flavoprotein beta
FT                   subunit; InterPro IPR014730:IPR012255:IPR014729; KEGG:
FT                   cma:Cmaq_0477 electron transfer flavoprotein
FT                   alpha/beta-subunit; PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; SPTR: A8MBX9 Electron transfer
FT                   flavoprotein alpha/beta-subunit; PFAM: Electron transfer
FT                   flavoprotein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49810"
FT                   /db_xref="GOA:E1QU13"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU13"
FT                   /protein_id="ADN49810.1"
FT                   /translation="MGGLTIIVPVKAAVPNVTAVRLDPVTHNLVREGVPLMLNPYDRNA
FT                   LEFALRLKDKYGGKVITLSMAPPSGKDFLESTIGMGADEAYLITDRAFAGADTLATSYT
FT                   VARSIQKLFPNFDLIVFGEETTDSTTAHMPAQVASWLNLPYVYYAVDAEVKLEDRLIVV
FT                   TRYLEDEGVYEAYEYKMPIIISVYKNSNPPRDISLARKVEAKLNGLVKIVDNNALKLER
FT                   ECIGLRGSPTIVAKIEDAKPIERKKQVFKGDPREAAKWLLDNLIKEGVIKP"
FT   gene            complement(399026..399319)
FT                   /locus_tag="Vdis_0410"
FT   CDS_pept        complement(399026..399319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0410"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="COGs: COG2440 Ferredoxin-like protein; InterPro
FT                   IPR017900:IPR001450:IPR012206:IPR017896; KEGG:
FT                   cma:Cmaq_0478 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain-containing protein; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: A8MBY0 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49811"
FT                   /db_xref="GOA:E1QU14"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU14"
FT                   /protein_id="ADN49811.1"
FT                   /translation="MSLDRKIPIEERLNSNAWDVDQRPHIRIIDPDQCRKCDKKPCLYL
FT                   CPARCYTPGPDGTVLFSHEGCLECGTCRVVCPENNIEWNYPKSGFGVQYRFG"
FT   gene            complement(399316..400593)
FT                   /locus_tag="Vdis_0411"
FT   CDS_pept        complement(399316..400593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0411"
FT                   /product="Electron-transferring-flavoproteindehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="COGs: COG0644 Dehydrogenase (flavoprotein); InterPro
FT                   IPR003042:IPR002922; KEGG: cma:Cmaq_0479
FT                   electron-transferring-flavoprotein dehydrogenase; PFAM:
FT                   thiamine biosynthesis Thi4 protein; PRIAM:
FT                   Electron-transferring-flavoprotein dehydrogenase; SPTR:
FT                   A8MBY1 Electron-transferring-flavoprotein dehydrogenase;
FT                   PFAM: Pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49812"
FT                   /db_xref="GOA:E1QU15"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU15"
FT                   /protein_id="ADN49812.1"
FT                   /translation="MGTKFDVIVVGAGPAGLTAAQQLASKGFKVLVIERGKKPGSKNVF
FT                   GGRIYAHVLDRLYPEYVKEAPVERWVRRERITMMTEDSWTTVDFETTKVEHKSFTAYLT
FT                   NFVEWLDKKAESAGAVVVSEVPVDSLIIRDGKVVGVRAGNDEVYGDVTIIAEGINRLVL
FT                   ERSGLAPKLSPEIVALGVKEVIKLSREEINERFNLDEDEGLAWVLAGFPTHYLPGGAFI
FT                   YTNKEAITLGIVIYLSYGYQLDVPVHDLIEEFRLHPMVKRLIKGGQLLEYSAHLTPVAG
FT                   INAAPPKLYGNGYLVTGDAAGFLLHLGVIIRGVDFAMESGRLAAEAVTKAHELGKYDDE
FT                   ALSVYGKLLEESFVLRELKTFRNAHKVLIEPRLYSNYVRMINNLLRRYFEVDGTPRKLG
FT                   STLLESKGNLTLIDLARDAIRLVMNL"
FT   gene            400827..402338
FT                   /locus_tag="Vdis_0412"
FT   CDS_pept        400827..402338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0412"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG0535 Fe-S oxidoreductase; InterPro
FT                   IPR007197:IPR006638; KEGG: cma:Cmaq_1099 radical SAM
FT                   domain-containing protein; PFAM: Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; SPTR: A8MDS1
FT                   Radical SAM domain protein; PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49813"
FT                   /db_xref="GOA:E1QU16"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU16"
FT                   /protein_id="ADN49813.1"
FT                   /translation="MSSLGDHIDKLVERKVEDSGSGAGALIAAIRLLNRGVVRWALRVL
FT                   TKEVEFNGERKPLMEWVLAKYVGESQCPTVTHFVAPFFEMGMKLATAWLHADEEPIKQL
FT                   LSDPAIRRGIVTTLRGIALFGVTTPQKLPAPFFIVWNFTNACNLKCMHCYQNAGRPLPN
FT                   ELALEEKLRVVKELDEAGVPAIALSGGEPTVHRDFWPVLAEINRRGFYSAIATNGTTFA
FT                   NIEFAERAKKLGLRYVEISIDAADPNVHDKFRGVPGAWAKAVQGLRNAVRLGFSAALAF
FT                   TVTKYNIHEVDKILDLAQEIGVKRVVFFNFIPVGRGRENLEIDLSPEEREEFLRHIYKE
FT                   MRRRKMEIISTAPQYGRVVNQLSNGEDVSPTHFVVANDPITKELTEFIGGCGAGRVYAA
FT                   IEPEGTVTPCVFLPYPVGNLRTKSFWDIWMDPFMENFRDRDRLEGFCGRCPYKLICGGC
FT                   RARAYNYFGDVLAPDPGCIYNSAEWRKLQEDILRIKVKVSPLVFK"
FT   gene            402343..403761
FT                   /locus_tag="Vdis_0413"
FT   CDS_pept        402343..403761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0413"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1032 Fe-S oxidoreductase; InterPro
FT                   IPR006158:IPR007197:IPR006638:IPR013785; KEGG:
FT                   cma:Cmaq_1100 radical SAM domain-containing protein; PFAM:
FT                   Radical SAM domain protein; cobalamin B12-binding domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; SPTR: A8MDS2
FT                   Radical SAM domain protein; PFAM: Radical SAM superfamily;
FT                   B12 binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49814"
FT                   /db_xref="GOA:E1QU17"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU17"
FT                   /protein_id="ADN49814.1"
FT                   /translation="MNMRVLLAVPPGIDKLELYKVLGLKAPPLGLAWIAAVLERAGHKV
FT                   RIIDSPTEGIDLRTFMGEVKSWQPDVVGITAITPTVYKAYETAKAIKEYDKDLPVIMGG
FT                   PHVTFMYEEALSNNVDVVVRGEGEYTTLELINTMEKYGMDPAHLKSIRGLVFKDGDQVI
FT                   KTPDRPPIKNLDELPPPARHLLPMDKYTLFGKPIRIVHVMASRGCPYGCSFCSTSYFWG
FT                   RIIRYRSAKAVADEIEDTVNTYKTNIIVFTDDEFTLGKRFVYEFLRELEERKLDISFSC
FT                   GSRVDTIDREMMIALKKHGCTALYFGVESGSQDTINRIGKRITLEQAVRVFQWAKEIKI
FT                   DHVGSFVIGFPWESIDDMKNTVKFAMKLNPTYAQFTVATPYPGTPLYYQALSENLIEDW
FT                   NWEHWTTLKAVMRGYKFTKEQAQKMLQWAYVKYYSRLGFLIHELIHGRLGTIISAIRNS
FT                   LVPWFTEKLLRRGE"
FT   gene            complement(403763..404431)
FT                   /locus_tag="Vdis_0414"
FT   CDS_pept        complement(403763..404431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1101 hypothetical protein; SPTR:
FT                   A8MDS3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49815"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU18"
FT                   /protein_id="ADN49815.1"
FT                   /translation="MDFREVPINECPIKYLDTLHLILFILYKRTEFCKNLGLNCMDLPV
FT                   LATSPLVARNCDRNDVHKFFKRMRRIVERIGNEIEIFRFGRLSASLLLEFGTGSIRVHD
FT                   NLIVSDNDCNKVQCVTVNNVTTFYMRLIIRLSDKNLVVLNVPDIIMWLARVYGLDTVYS
FT                   ALNLVHSYVENGSFSDDLDRVLEIISKWGVNLDRDSFINATLPGRRNLLVLREILNNAT
FT                   "
FT   gene            complement(404507..404908)
FT                   /locus_tag="Vdis_0415"
FT   CDS_pept        complement(404507..404908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0415"
FT                   /product="Ribosomal protein S24e"
FT                   /note="COGs: COG2004 Ribosomal protein S24E; InterPro
FT                   IPR018098:IPR001976:IPR012677; KEGG: cma:Cmaq_0004
FT                   ribosomal protein S24E-like protein; PFAM: Ribosomal
FT                   protein S24e; SPTR: A8M9H7 Ribosomal protein S24E-like
FT                   protein; PFAM: Ribosomal protein S24e"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49816"
FT                   /db_xref="GOA:E1QU19"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018098"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU19"
FT                   /protein_id="ADN49816.1"
FT                   /translation="MSIPMPKLPEGIEAGKLVFKLLNIRENKVIGRKEVTAEAWHVGLP
FT                   TPSRVQLREEIAKAMGVDVKQVYVVRVITEYGRHRSVIEAHVYDDPNVGERIEPLYIRL
FT                   RNMPKEEAKKIREEMKKRKTEKKAAAKKQ"
FT   gene            complement(404961..405194)
FT                   /locus_tag="Vdis_0416"
FT   CDS_pept        complement(404961..405194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0416"
FT                   /product="DNA-directed RNA polymerase subunit E, RpoE2"
FT                   /note="COGs: COG2093 DNA-directed RNA polymerase subunit
FT                   E''; InterPro IPR007178; KEGG: cma:Cmaq_0717 DNA-directed
FT                   RNA polymerase subunit E, RpoE2; PFAM: DNA-directed RNA
FT                   polymerase subunit E, RpoE2; SPTR: A8MCP7 DNA-directed RNA
FT                   polymerase subunit E, RpoE2; PFAM: Spt4/RpoE2 zinc finger"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49817"
FT                   /db_xref="GOA:E1QU20"
FT                   /db_xref="InterPro:IPR007178"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="InterPro:IPR038589"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU20"
FT                   /protein_id="ADN49817.1"
FT                   /translation="MSARGRRPVRRSPLPGYKACRNCKAVVPEDVEKCPVCGGTDFTKD
FT                   WMGLIVILKPEESCIAKRLGITKAGMYAIEVL"
FT   gene            405250..405942
FT                   /locus_tag="Vdis_0417"
FT   CDS_pept        405250..405942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0417"
FT                   /product="HhH-GPD family protein"
FT                   /note="COGs: COG2231 Uncharacterized protein related to
FT                   Endonuclease III; InterPro
FT                   IPR011257:IPR004035:IPR003265:IPR003651; KEGG:
FT                   cma:Cmaq_0651 HhH-GPD family protein; PFAM: HhH-GPD family
FT                   protein; iron-sulfur cluster loop; SMART: HhH-GPD family
FT                   protein; iron-sulfur cluster loop; SPTR: A8MCI5 HhH-GPD
FT                   family protein; PFAM: HhH-GPD superfamily base excision DNA
FT                   repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49818"
FT                   /db_xref="GOA:E1QU21"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU21"
FT                   /protein_id="ADN49818.1"
FT                   /translation="MNETVNRLIETFRGIKSELESVGWYPVDAESTRWWGGAETPDEVI
FT                   ITAILVQQTRWDVVHEVLNRLRKLGLNTIESIANADPNYLAEVIKGVNYRFTKAQRLVK
FT                   LARNITVIGGLERLRLKGDVRDFLLNQEGVGRETADSIMLFALNILTLPISQYTKRVFS
FT                   RVLGINPGNDYDSWKRTLEDLIPRDLYTYKLVHASVITIGKKYCLPDNPLCDKCPLRDL
FT                   CLYANGRR"
FT   gene            complement(405946..406503)
FT                   /locus_tag="Vdis_0418"
FT   CDS_pept        complement(405946..406503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0418"
FT                   /product="Protein of unknown function DUF367"
FT                   /note="COGs: COG2042 conserved hypothetical protein;
FT                   InterPro IPR007177; KEGG: hbu:Hbut_0010 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF367; SPTR:
FT                   B5IDT6 Conserved domain protein; PFAM: Domain of unknown
FT                   function (DUF367)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49819"
FT                   /db_xref="GOA:E1QU22"
FT                   /db_xref="InterPro:IPR007177"
FT                   /db_xref="InterPro:IPR022968"
FT                   /db_xref="PDB:5APG"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU22"
FT                   /protein_id="ADN49819.1"
FT                   /translation="MIPRVFIYRLPQDDPRKNTAIKLVRFGFAQLVDSIKALPSGSIIL
FT                   DPTVKTPLTPSDRVIAESRGLSLIDCSWKRAVDVHTKFIRGKFIRRRLPLLIAANPTHY
FT                   GKPYILSTIEAVAAALYIMGFKDEAMEVLRLYKWGPNFIIINQKYLERYAAGDLSPERE
FT                   LLGVDDVDNGLEQLMRVLTNGD"
FT   gene            406564..408915
FT                   /locus_tag="Vdis_0419"
FT   CDS_pept        406564..408915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0419"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="COGs: COG1529 Aerobic-type carbon monoxide
FT                   dehydrogenase large subunit CoxL/CutL homologs; InterPro
FT                   IPR008274:IPR000674; KEGG: pai:PAE2478 molybdopterin
FT                   binding oxidoreductase large subunit; PFAM: aldehyde
FT                   oxidase and xanthine dehydrogenase molybdopterin binding;
FT                   aldehyde oxidase and xanthine dehydrogenase a/b hammerhead;
FT                   SPTR: Q8ZV33 Molybdopterin binding oxidoreductase large
FT                   subunit; PFAM: Molybdopterin-binding domain of aldehyde
FT                   dehydrogenase; Aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49820"
FT                   /db_xref="GOA:E1QU23"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU23"
FT                   /protein_id="ADN49820.1"
FT                   /translation="MSNLPHYREGLRAVTGSGEYIDDIPTPPGTLYMAIYRSPYAHARI
FT                   LKVDLSGVFEHGGIAYGPNDLAKVIPNPFPLAVDAPIKYYPFARDKARFVGEPIAVVLA
FT                   DDPYRAIDLLDYVQVDFEPLKPVLTFDDALRGDVLVHEELKSNVAMHRHMKFGPVDKVF
FT                   SEAPVVIKREFYYQKHNAMPLETYGVLAHYTGGELNVWANAQGPLLITYFVTRALGLPT
FT                   GSLRLFGPRDVGGSFGSKYSLYPYITLAAAASILSGRPVKWVESRTEHLVGSNSGGARK
FT                   GVVEVAATRDGVIQGFRFRFYEDVGAYPRPPDPGVLFRVHGNMNGAYDVRAIEAEDYVV
FT                   VTNKLPTGLNRAYGGPPFYFMLEVAVNELARELGIDPLELRIKNLIRDFPKRIGDEYFY
FT                   ETVTGGLYPRQDYERVVRAIEPEYRRWLEERRKNPNIGVGIAVLVEPAGTNLGYTDLAI
FT                   EPSKRKYPHSGSGSYVTINIDMSGYIRVFVNGTNEGLGHETTLAEVVASELGVDPSMII
FT                   VENRVDTTRTWALSDGSYSSRFAPIVVSAAILAARQLKEKLTRIAMSILGTDKVGYENG
FT                   QFYDINNPSRRVDIRRMASSVNWDPGSLPEGLDASLSVTVFYQPPTVKAAEGDRINSSA
FT                   TYAIQAHLAVIELDPNTYDIRVRKYVIAHDAGRILKREFVDSQLMGGLMHGLALTLYEE
FT                   LMYDDQGNPLTTSLDIYETPTMAEAVGMEVEFIHFETPTKHLVSGAHGVGEGAMMGVPA
FT                   AIVNALASIIGKAITDLPLRPYKIMRAVEG"
FT   gene            408912..410333
FT                   /locus_tag="Vdis_0420"
FT   CDS_pept        408912..410333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0420"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="COGs: COG1319 Aerobic-type carbon monoxide
FT                   dehydrogenase middle subunit CoxM/CutM homologs;
FT                   InterProIPR016166:IPR002888:IPR001041:IPR005107:IPR
FT                   006058:IPR002346:IPR016167:IPR016169:IPR012675; KEGG:
FT                   pai:PAE2477 molybdopterin binding oxidoreductase small and
FT                   medium subunit; PFAM: molybdopterin dehydrogenase
FT                   FAD-binding; ferredoxin; [2Fe-2S]-binding domain protein;
FT                   SPTR: Q8ZV34 Molybdopterin binding oxidoreductase small and
FT                   medium subunit; PFAM: 2Fe-2S iron-sulfur cluster binding
FT                   domain; FAD binding domain in molybdopterin dehydrogenase;
FT                   [2Fe-2S] binding domain; CO dehydrogenase flavoprotein
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49821"
FT                   /db_xref="GOA:E1QU24"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU24"
FT                   /protein_id="ADN49821.1"
FT                   /translation="MMGMAYTLGIPRGFKYVRASTIDEALKLLNEYGGDAKVLAGGMSL
FT                   MPMLKLRMTEVKYLIDILGINDLRYIRVEGNHLRIGALTTHNDIAMNRVVNDNAKILSE
FT                   SAWHIADIQVRNLGTIGGSLAHADPAANYYPALIALDAEVMIKGIGTERVVKVSDLYKG
FT                   PYITDLKPNELITEVRIPLSGLRGVYEIFRRGGASFPSVIIAVAYQEKDGVITDSRISI
FT                   GAVYPEPVLVSGHLNGLGVREVGAKVNDIVNSIFSSIDAKPLEDTHAPGDYKVKVAKNL
FT                   LTKALTEIANGSVQYIKAPIKDELIKWEFRDGVEYVGDLVRVRVNVNGQWIEDLVEPRL
FT                   LLIDFLRRHGFKEVRRGCDEGKCGACTVLVDGRAVKSCMVPVVRVSGHSVTTVRGLSKG
FT                   MELHPIQRAFLEEYAMQCGFCTHGFMMVTHDYLTNIDPTANDDLLKLSIKNICRCTGYI
FT                   NIIKAIKRAAKYLQP"
FT   gene            complement(410456..410965)
FT                   /locus_tag="Vdis_0421"
FT   CDS_pept        complement(410456..410965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0421"
FT                   /product="PaREP1 family protein"
FT                   /note="InterPro IPR010268; KEGG: pas:Pars_1267 PaREP1
FT                   domain-containing protein; PFAM: PaREP1 family protein;
FT                   SPTR: A4WKB4 PaREP1 domain containing protein; PFAM:
FT                   Archaeal PaREP1/PaREP8 family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49822"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU25"
FT                   /protein_id="ADN49822.1"
FT                   /translation="MEARMRRLNTEALAKERLEEAMKELDVAEVFLREGLTSNAAGKAF
FT                   QAWKAFLSYLALKNADQLQEKYRGNKRVGNVTIPFHEWIAAVIPTNRMTELSAEMERIV
FT                   PGVAELTAMALQLHEYQYNGPDPEGIRSKIPNDETAIALIKSFIVKARALMSVLSKGSN
FT                   SIHTSG"
FT   gene            411189..411923
FT                   /locus_tag="Vdis_0422"
FT   CDS_pept        411189..411923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0422"
FT                   /product="Conserved TM helix repeat-containing protein"
FT                   /note="InterPro IPR011014:IPR008910; KEGG: mem:Memar_0455
FT                   TM helix repeat-containing protein; PFAM: Conserved TM
FT                   helix repeat-containing protein; SPTR: A3CSN8 Conserved TM
FT                   helix repeat-containing protein; PFAM: Conserved TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49823"
FT                   /db_xref="GOA:E1QU26"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU26"
FT                   /protein_id="ADN49823.1"
FT                   /translation="MSSTVNSTATQIKVFGFIPQYVFYTVLAAVVIIVVGYVVGRLVEI
FT                   LIKKISYTTGLDAFFRKTSVGRALLRSGYTAGDFLGLFVKWVIYIAAIFYALLELSYAS
FT                   PNLAFLYDTSRSVLTYLPYLVSGVIILIIGLIMVDWISDYFKRSYPANDQYSQTLLNFV
FT                   GDAFRFILYYMVITIALSVMKVNVTILYIFAQGLAWAVAIGLGVAIGLVLAVPLREPLR
FT                   RFLEREWDQSRDGDKRRGDVGG"
FT   gene            411916..413169
FT                   /locus_tag="Vdis_0423"
FT   CDS_pept        411916..413169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0423"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: dka:DKAM_0097 glycosyl transferase,
FT                   conjectural; PFAM: glycosyl transferase group 1; SPTR:
FT                   B8D2Q5 Glycosyl transferase, conjectural; PFAM: Glycosyl
FT                   transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49824"
FT                   /db_xref="GOA:E1QU27"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU27"
FT                   /protein_id="ADN49824.1"
FT                   /translation="MAKPVIGVIMYQTSNSKGQELVAQRMVKWFLRLGYEAYLITSIYH
FT                   DGNEVVRRRAVETSLEGYVFQEKDPAIGLPTIRVDSYVARWPPRRIMFKNFVDVLRRIS
FT                   ENFNVNSLITHSTLWNGPEDTAKYVMWRRMLTTFGLENSNVFFGHMSHYQPPDPTRYDV
FT                   VERTYRLAWNHMAFPEIFKAANLILCVTPLEGEEMIRMGARPEQIYVFPGGIDDDEVAD
FT                   LNAVDSSDFRVKYRIPDDVKIVAYLGTVEERKNPLAVVRVAKMLRHRRDVHFVIAGKPG
FT                   DQWDEVVSEARGLSNVTLTGELSVEDKKKLIKEAYVNIIMSKMEALGLTQLEFMYGGVP
FT                   VITSAVYGQKWVVRNGVDGIHVNGPDDVEGAAKAVERLLDHPEERDRMSRNARERASQL
FT                   LMSKLVKELAVKIEEYLR"
FT   gene            complement(413166..413567)
FT                   /locus_tag="Vdis_0424"
FT   CDS_pept        complement(413166..413567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0424"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bgr:Bgr_00850 iron transport system membrane
FT                   protein YfeD; SPTR: C6ABA4 Iron transport system membrane
FT                   protein YfeD"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49825"
FT                   /db_xref="GOA:E1QU28"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU28"
FT                   /protein_id="ADN49825.1"
FT                   /translation="MRVRDRLISGAVNAATDVLLLILMLILYSLLSSYMAHLPIQFTSI
FT                   ITEYITLIAAFAVLAFLRGLLAGHVLAYPVILGEATLITAIFLSIPGTITAYGVTVNIT
FT                   PLIYFLWSVEMAWVVYSIIDQFNNTLLDP"
FT   gene            complement(413564..413899)
FT                   /locus_tag="Vdis_0425"
FT   CDS_pept        complement(413564..413899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pto:PTO0709 transmembrane
FT                   glutathione-dependent Na/H antiporters; SPTR: Q5K3Q3 Alpha
FT                   glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49826"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU29"
FT                   /protein_id="ADN49826.1"
FT                   /translation="MRVAIALAILSLVITLIVLGISALTMGNLSRYVSANIYQTGTGYY
FT                   LNFTIHNPLPLPLVITITQGGLSRSVYVEPYGFGSIIMPITSLNLPINITVSIPGIANV
FT                   TSTVTPS"
FT   sig_peptide     complement(413795..413899)
FT                   /locus_tag="Vdis_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            414019..414279
FT                   /locus_tag="Vdis_0426"
FT   CDS_pept        414019..414279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0426"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="InterPro IPR010985:IPR002145; KEGG: tsi:TSIB_0588
FT                   hypothetical protein; PFAM: CopG domain protein DNA-binding
FT                   domain protein; SPTR: C6A208 Putative uncharacterized
FT                   protein; PFAM: Ribbon-helix-helix protein, copG family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49827"
FT                   /db_xref="GOA:E1QU30"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU30"
FT                   /protein_id="ADN49827.1"
FT                   /translation="MGKVRISIYIDEELWREFKRYAAERGLNASELLEELIKEELMIEL
FT                   NTLILEETTPELDFEPIKPREPVSGLVREMRDERENSLSGQ"
FT   gene            complement(414456..414698)
FT                   /locus_tag="Vdis_0427"
FT   CDS_pept        complement(414456..414698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_0332 hypothetical protein; SPTR:
FT                   A8MB88 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49828"
FT                   /db_xref="GOA:E1QU31"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU31"
FT                   /protein_id="ADN49828.1"
FT                   /translation="MSSSATKRRIGLVLIGIGIALLLVASVLAYIELLTGISIPQPPSL
FT                   ESVLYVLAVVTYKVAFIAVIAWAGAILITRGLQAL"
FT   sig_peptide     complement(414612..414698)
FT                   /locus_tag="Vdis_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(414735..415181)
FT                   /locus_tag="Vdis_0428"
FT   CDS_pept        complement(414735..415181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0428"
FT                   /product="protein of unknown function DUF101"
FT                   /note="COGs: COG1371 conserved hypothetical protein;
FT                   InterPro IPR002804; KEGG: pai:PAE1678 hypothetical protein;
FT                   PFAM: protein of unknown function DUF101; SPTR: Q8ZWP9
FT                   UPF0211 protein PAE1678; PFAM: Archease protein family
FT                   (DUF101/UPF0211)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49829"
FT                   /db_xref="GOA:E1QU32"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="InterPro:IPR022952"
FT                   /db_xref="InterPro:IPR023572"
FT                   /db_xref="InterPro:IPR036820"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU32"
FT                   /protein_id="ADN49829.1"
FT                   /translation="MQCQLPTRYEYGEHTADIAVIAYGCTLEEAFKNAALGVAGLTYYI
FT                   DRVEPREFVEVNVGGEDLEQLLFNWIDEFIYLFDGRKFAYGDYFREVSIEGNGPYRIRA
FT                   VVGGEHFDINKHGYRGLIVKAMTYNMMEIKRADNYWRLTFVVDI"
FT   gene            complement(415272..416348)
FT                   /locus_tag="Vdis_0429"
FT   CDS_pept        complement(415272..416348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0429"
FT                   /product="ATPase"
FT                   /note="COGs: COG1672 ATPase (AAA+ superfamily); InterPro
FT                   IPR011579; KEGG: sis:LS215_0459 ATPase; PFAM: ATPase; SPTR:
FT                   C3MLI5 ATPase; PFAM: Archaeal ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49830"
FT                   /db_xref="GOA:E1QU33"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU33"
FT                   /protein_id="ADN49830.1"
FT                   /translation="MLFDLHPKESRDELFGRDEEVEYVKRQVRAGNWVVIGGQRGIGKT
FT                   SLMKVVLNELSREGFRAIYINARGVTTLRDLLTILVNEVNRTRLRLRLNVSLNFIVGSA
FT                   GITLSRGSRVFNSLLELLLSIDENTVIGLDEVQELSRVTGQFLRILGNVFMSNPRVSFI
FT                   FTGSYVGLVKTLLKPNPESPLYGRPPVEVKLKPFNDELSREFLKRGFRELGIQFNAFDT
FT                   VIDRLDGVVGWLTLFGNYHGVRGLDVDEALRETINEGVKIMVNEIEHFLEDKANKALYL
FT                   AILSALRVVNRWKDIKFAVTTRLGREFGDRELLNALNALINYNFVVKVREGEYRLADPI
FT                   LREVDYDKLIKRYLRMDY"
FT   gene            416559..417164
FT                   /locus_tag="Vdis_0430"
FT   CDS_pept        416559..417164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smf:Smon_1433 cation diffusion facilitator
FT                   family transporter; SPTR: A5AU28 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49831"
FT                   /db_xref="GOA:E1QU34"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU34"
FT                   /protein_id="ADN49831.1"
FT                   /translation="MHRWVYAIDASIKLFIRDINSFRLLIINAAIPITILTTYELLMNI
FT                   LNTYVDSLTTTVAPYSKSIINNAVYFINSITYLVVAALVIIFFVTSAFMVNGIVRNLRD
FT                   DFRAMISIFRSGVGVIMHIALIMLLISLYSFTLGISISAALVLVLMKILTTLGIIPITN
FT                   YGVDITGVLPVMLPLACVICVTYIIEGIIWVRRYAYLP"
FT   gene            417148..418725
FT                   /locus_tag="Vdis_0431"
FT   CDS_pept        417148..418725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hut:Huta_1094 protein of unknown function
FT                   DUF214; SPTR: Q3SAD8 Putative uncharacterized protein
FT                   (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49832"
FT                   /db_xref="GOA:E1QU35"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU35"
FT                   /protein_id="ADN49832.1"
FT                   /translation="MPIYPRGLAVIALSVYLASIALGLVISTMLAVYYLPQLFLLNIGN
FT                   VTIKKGESMSIFTSWVPINLAYSLRDMGFMAIPEVIMPSVVNRTPVIVRGIVPSYINYY
FT                   GVNATAQELNEGALVGYELARELHVRVGDELVITSFKGITNNLTVAGIIKSIKYPQLNY
FT                   EVVINLTTAQHLDSLPSSVVNVIYVNASYGLISRVNGMYGLRIITHILNGSLAVLNSMN
FT                   HTVFNGPLTNMTLTLPFGVYYVVAYNRSLIIWFSTVILESNKTIELMKMPVPRMVSSYP
FT                   VSPSEWVIVRWPNGSLVSSYYLLIYYMNGSLAYSTVGGGVTPISVPGGMYRIDVVMGNT
FT                   YYSVSEYVVPGSNVTVVLTPYSILVGELMTHAYNYFTSVLPLSSASGPAALISALRVGI
FT                   GTFIGVIMGLLVIVSIGLIGIVNYSVEVNRELIMYLRLNHAGKLSIMLMVDAPLVMMYP
FT                   AFTALGLLTANYLWRPMVGAMGLSLMGQPIYLIVVSNYYPYIAAFIIVSALLIIMHLIT
FT                   RLRVVGVE"
FT   sig_peptide     417148..417216
FT                   /locus_tag="Vdis_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            418718..419377
FT                   /locus_tag="Vdis_0432"
FT   CDS_pept        418718..419377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0432"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR017871:IPR003439:IPR003593;
FT                   KEGG: dba:Dbac_1893 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: C7LXB3 ABC
FT                   transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49833"
FT                   /db_xref="GOA:E1QU36"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU36"
FT                   /protein_id="ADN49833.1"
FT                   /translation="MSDVGINVINVSKSFGNHAVLRNVSIEALPNSITCVAGPSGSGKS
FT                   TLLRIVAGYLRPDSGRVLINGVDLYADSRAREIINMISYVPQDDLLISGLTIRENLRLA
FT                   LRVQGLGNRVIEERIRWVSGLLGIEHILNKRPGQISGGERRRASIAVALARDHEFLIMD
FT                   EPTNSLDRANVDLLMRILREEAGLGRVVLVATHDQYLIRNSDRLYMIRAGELTIEP"
FT   gene            complement(419374..420984)
FT                   /locus_tag="Vdis_0433"
FT   CDS_pept        complement(419374..420984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0392 hypothetical protein; SPTR:
FT                   Q2FQD0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49834"
FT                   /db_xref="GOA:E1QU37"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU37"
FT                   /protein_id="ADN49834.1"
FT                   /translation="MEKDREVIKTASTAAPLVILASLILLNYVINGLPYIPDSWTHIAH
FT                   SETLLRTGYLFGPSPNPSMVSYNYKWPTVNLLLALSQSVLGLGPIQSFYVVNILASLSI
FT                   IPFILLVRRLTGSDMATLITGLLFAVLSVKLLVDSSVMKETAAQYPFYAYMLTTYMALI
FT                   DRKHLRQNLLVMVLTFIAILFAHHFTLLMALAYSFIMTITVLMSNYLSGNNAWHALYVA
FT                   ITVIALGLLTYYWYVDYLRAYTVTTFVTPGLISTPILIAILLIDYVTMRRGSRILIYAT
FT                   LAILALMLISMFSTGKFLPYVLEGFNRAVVLSSTPYVLPILIAVLYLALYGFERPVVAI
FT                   TTVLSLAILLYVLLMGNNPLELLFLSKSLDFVMPFLLIPTALMITSAVRHRLPVKALAY
FT                   VLTAALMISLPIFAVLTLYTYSLPTSSTLTVYRLIDYEEFNAINGLIPRNSTLYSSISY
FT                   ESMIMFMTGINTSDPTTYLIHGEAPQGLLLLTERNLRVGFLYGSGYSMVSIPKHYLLNI
FT                   LMSNDLVYSSRTLWLWETP"
FT   gene            complement(420963..422087)
FT                   /locus_tag="Vdis_0434"
FT   CDS_pept        complement(420963..422087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0434"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; InterPro IPR001173; KEGG:
FT                   pcl:Pcal_0472 glycosyl transferase family protein; PFAM:
FT                   glycosyl transferase family 2; SPTR: A3MTD6 Glycosyl
FT                   transferase, family 2; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49835"
FT                   /db_xref="GOA:E1QU38"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU38"
FT                   /protein_id="ADN49835.1"
FT                   /translation="MVSLLIEELGIALIMMHFITPSIYYVIARSWLRLGNGVGSDNVLD
FT                   ADPPFVSIIIPTYNEAKVITQKLNNIYMQDYPRDRFEVIIVDSGSTDGTIELVREWVKG
FT                   HGDVNVRVIEEGVRRGKMHALNTALRNTKGDIIVVTDADSAWLKDSLRNAIAWLMNKDV
FT                   GAVSCNKIPRTDKGIEAEYRNYYGLLRLAESRKFSSAIFHGELAAFRRDLLERVGGFPT
FT                   DLGADDSHTAGLISIMGYRAIIPEDVKCIEYVPSKGYWMWRVRRAQHLIQHFLRFLRYM
FT                   LIEGKDPPRDYRQIMLYESYLHLINPWLFMVGLIFIVLSAIHGALIPIALLLIGAALLA
FT                   NKFFRTWVMTQVILVVAAIRNLWNKELVWRKIEK"
FT   gene            complement(422176..423459)
FT                   /locus_tag="Vdis_0435"
FT   CDS_pept        complement(422176..423459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0435"
FT                   /product="protein of unknown function DUF58"
FT                   /note="InterPro IPR002881; KEGG: cma:Cmaq_1427 hypothetical
FT                   protein; PFAM: protein of unknown function DUF58; SPTR:
FT                   A8M933 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49836"
FT                   /db_xref="GOA:E1QU39"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU39"
FT                   /protein_id="ADN49836.1"
FT                   /translation="MMRRLTSQWVQVLTTSMLIAAAALSLGNVALFAVYMVIVIIAWLY
FT                   WNNYPLPLSLGVTALLSLATPPIDIMLTSISILLIDNALKMGNERPWWFYAAPLAASTS
FT                   LAVILRQFYIAASFTIPLLYILLISFINAIRFHTVIIELRPSRNLRINAGSELSYSLAV
FT                   TTKPPLRAVVEVKAPGNLRVSPARLYLNGEAYINVSARYSLGGVKRPRLIITFTDMRGL
FT                   VRVRRVVRHPRITVIPRARTAIQFARELLAQSALGAEDIREVREYTPGDPIRRLHWKKS
FT                   AKLNRLIIKLLQGPGLTGPIILLSYATNPTLVDRVGEALVYLTAELLTRIPRIEVISVN
FT                   RDGEATNYVLSRDNYFEIIERALGEIENLNVRLVGGGDYADVLSTIKYSIPLRIRGMVR
FT                   EGVIVIGQGLFVEPICNAFKERIVCISV"
FT   sig_peptide     complement(423361..423459)
FT                   /locus_tag="Vdis_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(423456..424421)
FT                   /locus_tag="Vdis_0436"
FT   CDS_pept        complement(423456..424421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0436"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro
FT                   IPR011703:IPR016366:IPR003593; KEGG: cma:Cmaq_1428 ATPase;
FT                   PFAM: ATPase associated with various cellular activities
FT                   AAA_3; SMART: AAA ATPase; SPTR: A8M934 ATPase associated
FT                   with various cellular activities AAA_3; PFAM: ATPase family
FT                   associated with various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49837"
FT                   /db_xref="GOA:E1QU40"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU40"
FT                   /protein_id="ADN49837.1"
FT                   /translation="MSVKWLSAIKRIKDGISRVFIGNEPVIQTLLATLLSEGHALLLGP
FT                   IGSGKTTLAKALASIIGGTFKRVQMTNETLPSDILGFMIYAPGMEPRLVKGPIFANVVL
FT                   LDEINRAPPRTLSALIEAMQEGQVTIDGTPLELPKPHIVLATMNIVEVELGYTQALPMA
FT                   ILDRFMSSIYVNYVSDAEEAMIVKDIDRIERELYTLSNTISLGEVVKLMDDVKGVYVDD
FT                   SVLGYIMGLIKEIRSDPRVQVTLSTRAPISLFKLSRALAYLDGRDYVLPDDVKAAVYPA
FT                   LMHRIILRPEYRGSVTPMDVINDALNKVPVPHYIQTPVKP"
FT   gene            complement(424438..425292)
FT                   /locus_tag="Vdis_0437"
FT   CDS_pept        complement(424438..425292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1429 hypothetical protein; SPTR:
FT                   A8M935 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49838"
FT                   /db_xref="GOA:E1QU41"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1QU41"
FT                   /protein_id="ADN49838.1"
FT                   /translation="MGAGGKAYSIKWILLSLAILLLILMMIALGPSLTPFDAYNTYWDG
FT                   YSEAASICLRPIYALPNNLANVSSIFIVPEDNIGKSLVTELLNYVINGGRLVVLNGNES
FT                   FSNQLLSELGVGSRFTGNVIEDPVLNVINEKFPLAFIVSNPVIQTNATIIALDDATTII
FT                   INDTDVVDIAITSRFSTAGNSTGPFPVVVAIPVGRGYVILVSSPGMFMNSMINEAGNAE
FT                   FLRALCGNGTALYLESTLASNPQGVVRAWLLIVYAYASTYPINYLIVIIPVVIIIAILL
FT                   IKR"
FT   gene            complement(425262..427121)
FT                   /locus_tag="Vdis_0438"
FT   CDS_pept        complement(425262..427121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0438"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR008969; KEGG: cma:Cmaq_1430 hypothetical
FT                   protein; SPTR: A8M936 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49839"
FT                   /db_xref="GOA:E1QUB3"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUB3"
FT                   /protein_id="ADN49839.1"
FT                   /translation="MRVIYLALIALGIVMAVVYLGHAIAWPSLSIPNPLNEKLSVNTQG
FT                   VVQLYITALELNALGNYTGALSITKVLGITAAVKVSPLISQLHNYEVQLTNYLVELRSI
FT                   YNEMVNSISLGNYTGARSLAIEGLLIDSEADNELNAILSMFNNIAPGSAGQVISAAQSI
FT                   RQYLIGLNETFINVLTSNYTRTELTVNATPSTVVVGSQVTVYGVLTTINGTPIPNATIN
FT                   IYVGGNYVGKALTNVYGQYLLTFTMPQVYVSNINLTAIYNPPLGSNYLPSEATVQVNVA
FT                   FNTTSLTANYTSHVMWGEPINVSGYVSGPPIRQVIISIDGVNVSTYTVNNEFSVMISTG
FT                   NMTPGNYSITIYAPPVGPYSPAYVVGSVSVNSVVTNITISTNYLAIAGLPITLRGFVSP
FT                   WVGNLSLSLSIGGETMHLDLNSPNFTVSMPTSLLLSMGRHDIVISVSPNPPVMGIAYTY
FT                   GIFVVNIPEVIIPMAIIVALFLIVRSGAIALPGGEGITINNSRFQASPILIMTRRSAEV
FT                   RALRKEIMRTALRSKIDIKSVRDIVDALASAIYAIGNRTGVRLRSTDTLREYLRAVQNK
FT                   LSEEEYAVFAELVRLGEYALYSPHIPSDEDVRRAWELAGRLTR"
FT   sig_peptide     complement(427047..427121)
FT                   /locus_tag="Vdis_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(427118..427378)
FT                   /locus_tag="Vdis_0439"
FT   CDS_pept        complement(427118..427378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1425 hypothetical protein; SPTR:
FT                   A8M931 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49840"
FT                   /db_xref="GOA:E1QUB4"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUB4"
FT                   /protein_id="ADN49840.1"
FT                   /translation="MVLKRLLVAQLVLYTVVIAFLAYLGINDFAIYVSLITLVYLVTII
FT                   TAHPLPPGARGVANVITAILVAVFLYFAVMRILQILGVAVV"
FT   gene            complement(427368..428093)
FT                   /locus_tag="Vdis_0440"
FT   CDS_pept        complement(427368..428093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1431 hypothetical protein; SPTR:
FT                   A8M937 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49841"
FT                   /db_xref="GOA:E1QUB5"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUB5"
FT                   /protein_id="ADN49841.1"
FT                   /translation="MPGLNSDLGISLIILGAGLTIIGYLILNSTPIFVLGIAVLIMGLL
FT                   AAWGEGSLERTQLELARSGWTNISALLESIGTASRAIYLPSSATEAGTSMALIPLVRPE
FT                   PPSIKLPRGFAIRYGREGETGLLLHTPGSIAVSRCLGVGAIGSDVATSLTNCMVNHLTV
FT                   ARGVTVMPGENGITVVVRDSRVGELYGNELVRAVLGSPTASLVASVVAESLNSPVMIEN
FT                   EEVRGRDVVVRLRVVGGGP"
FT   gene            complement(428081..428668)
FT                   /locus_tag="Vdis_0441"
FT   CDS_pept        complement(428081..428668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0441"
FT                   /product="Protein of unknown function DUF1616"
FT                   /note="COGs: COG4743 membrane protein; InterPro IPR011674;
FT                   KEGG: cma:Cmaq_1466 membrane protein-like protein; PFAM:
FT                   Protein of unknown function DUF1616; SPTR: A8M971 Membrane
FT                   protein-like protein; PFAM: Protein of unknown function
FT                   (DUF1616)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49842"
FT                   /db_xref="GOA:E1QUB6"
FT                   /db_xref="InterPro:IPR011674"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUB6"
FT                   /protein_id="ADN49842.1"
FT                   /translation="MDNRDIRNAIKNAINTNQCASVSELVTEVSRALGVPKGLVAYEVM
FT                   MMWKNGELELEGVPRNSVAYVFSVEGLWYWVSLALVTASILAVTLIGGGPLIYLRYGLG
FT                   ALMLLFMPGYALVESLYPRGDELSPLERLALSIGLSLAVLPLIGLVLNYTPWGIRFVPI
FT                   VVSTNAVTVTLLTVALVRKARIFEAGEDRCQG"
FT   gene            complement(428661..429563)
FT                   /locus_tag="Vdis_0442"
FT   CDS_pept        complement(428661..429563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0442"
FT                   /product="Protein of unknown function DUF1616"
FT                   /note="InterPro IPR011674; KEGG: cma:Cmaq_1465 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF1616; SPTR:
FT                   A8M970 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF1616)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49843"
FT                   /db_xref="GOA:E1QUB7"
FT                   /db_xref="InterPro:IPR011674"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUB7"
FT                   /protein_id="ADN49843.1"
FT                   /translation="MSYRYLLLLVLLLTALGIALHAQQLGALTAYQYIVELSRLGVNTT
FT                   SLVNELNNAISLEASGQVGNASTVIGSIVARAQSLIPGARLWYMVGIVIKAVVVAGVVA
FT                   LSVMFYVKRRELIGLIWLRVRGGNRVRGGGPGRPRTFIFSEEVVAVALSIVIILIVFLT
FT                   AQSIVSGYTQPFSAIGLLGPTGKLGDYPSTVVVGQPISLYIYVYNHMGVPTWFVVRVFV
FT                   TNNTVAQPPLNQTPIMVFQRVLLNNESWIEPLTLSINSTGTYRIIGELWMYSPSNLTLV
FT                   YTGKYVQLWVNVTQVMPSG"
FT   sig_peptide     complement(429498..429563)
FT                   /locus_tag="Vdis_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(429560..429934)
FT                   /locus_tag="Vdis_0443"
FT   CDS_pept        complement(429560..429934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1432 hypothetical protein; SPTR:
FT                   A8M938 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49844"
FT                   /db_xref="GOA:E1QUB8"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUB8"
FT                   /protein_id="ADN49844.1"
FT                   /translation="MIDHNVIKLVREFLTRYVREISLPILTHVRTLAIRYGSWWRVNPF
FT                   RRALIDVAIAYLRSGFIIRSTMLVNMLRDVIIDVLINTVVRRLSFIAYVIGIRLGGFGN
FT                   PIIAGLQWLNRPVQYRWLVK"
FT   gene            complement(429968..431446)
FT                   /locus_tag="Vdis_0444"
FT   CDS_pept        complement(429968..431446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0444"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="InterPro IPR002797; KEGG: cma:Cmaq_1463
FT                   polysaccharide biosynthesis protein; PFAM: polysaccharide
FT                   biosynthesis protein; SPTR: A8M968 Polysaccharide
FT                   biosynthesis protein; PFAM: Polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49845"
FT                   /db_xref="GOA:E1QUB9"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUB9"
FT                   /protein_id="ADN49845.1"
FT                   /translation="MKESPVSGVVFGYLYTAINYVFALAYVILLTRFIPLIQYGYFNTL
FT                   MAMMGMIGLFFPTLGIDAAIAREGAMLHSRGLGIDDHYAALLTISLTVSTLYAAALIIA
FT                   IPLYLITRIPSGYMGLVLVYAAYVVTAGINGALSAYLWMTGRLASQGMGGIVGNITFRS
FT                   IEIALLVLLRSVYAIVIGMAMGQLATLAYYLAIVRHFVNPGRGVALIKRGFRGYLGLGI
FT                   QNWLLGYLSSVSGYVITYVIYSFIGTTYVALYSLAGYMLGAITALGGAVTNVFGSRVAH
FT                   ALGSGLTDRHHLIRDYTVAAISVSGVLATGAILAAPLLPLLGIIHGDYVEAIPYGIALF
FT                   GTAVLGSVNSIYSMYYWVSGRGWVALEVSSVGIAVNVASALTLLIIDRGLGLYSVIIAA
FT                   YLGSLAPLIIYLLIGGNPHTRDIAVNVTTYLFLSIAGALSYILIIDSWPLYQLAIFIVT
FT                   VLVTYIMRPIPRSVIDQLPGLVRPLLMPFTEMGE"
FT   gene            431560..433866
FT                   /locus_tag="Vdis_0445"
FT   CDS_pept        431560..433866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0445"
FT                   /product="peptidase A5, thermopsin"
FT                   /note="KEGG: cma:Cmaq_1218 peptidase A5, thermopsin; SPTR:
FT                   A8ME39 Peptidase A5, thermopsin; PFAM: Thermopsin"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49846"
FT                   /db_xref="GOA:E1QUC0"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUC0"
FT                   /protein_id="ADN49846.1"
FT                   /translation="MRYVIAVVLALVMAILLASVAHALPMTVEPPANGACWGVWNVTIL
FT                   PGQYLLIHALSNNYSLYVFTPGQYSGWASGEEAYAVYAQNVTGGAAYVIPMPQGQYSVV
FT                   LYPTPCGVGVDAIVRVVYQPGVGMASLGPLITNELLAYVNLTEYQPGNPINIALGSLVV
FT                   SHHYYETTEYWVEEVLSAFNGDFLLTIYVINVTNREPQAVGTASIKLGRVEIPCALYLL
FT                   VMVNITNGDAAVWLGYAVIENGTHYNEPAINWAYGMPLGPATEVVIAMNPYLATPSGYS
FT                   YDSELIIGNGLGTAQPFNAQMALLYWNGESFMPVTNTYNFAINMNLTSTYLTTAMCGGL
FT                   PCVTSGEPNYGQLGAFNALSVPMTYVEWEGLGGAVHSTYITSPINITYPRTTEPAPGVL
FT                   MRLTGVWVMTNGSWEFLNTTSVEVTPSGTPRAVFIRPGYSTYYLISIMSAGRINVNGSL
FT                   VNNYTGWVRAGSVINITAAPNYLGNGTRLLPVNGSPLLITVDKPMNITINWVKQYLITI
FT                   GSEYPIDVNGTITTNYTNWVNACSRITVNASAYYMGNGVRYVATNGTGTYEVCSPMRIT
FT                   VGWTNQYLVVLTSPVPILVNGVETMNYTGWLTNGTSLVITVPRYYYLGNSTRLVIKSPV
FT                   NGTVIITGPTHINITGSPQYLVVIRSPLPIMINGTKTTNYVVWVWPGSVIRLSIPRYQV
FT                   LPNLTLAIASSISVNEREYPLRGNTILAIDSPMYVTVNYHDYYTVYLVILLTALVALLI
FT                   MRFRGNGRGNDVTTV"
FT   sig_peptide     431560..431628
FT                   /locus_tag="Vdis_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            433941..434069
FT                   /locus_tag="Vdis_0446"
FT   CDS_pept        433941..434069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0446"
FT                   /product="PaREP1 family protein"
FT                   /note="KEGG: tne:Tneu_0229 PaREP1 family protein; SPTR:
FT                   B1YAV4 PaREP1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49847"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUC1"
FT                   /protein_id="ADN49847.1"
FT                   /translation="MDTETIEKPSPKPTAEDHVSVSYEDYLRPLVKAVKAKLALIP"
FT   gene            434083..435165
FT                   /locus_tag="Vdis_0447"
FT   CDS_pept        434083..435165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0447"
FT                   /product="ATPase"
FT                   /note="InterPro IPR011579; KEGG: cma:Cmaq_1422 hypothetical
FT                   protein; PFAM: ATPase; SPTR: A8M928 Putative
FT                   uncharacterized protein; PFAM: Archaeal ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49848"
FT                   /db_xref="GOA:E1QUC2"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUC2"
FT                   /protein_id="ADN49848.1"
FT                   /translation="MPLRLNAVLSCDKANKGEGGVCVVGRVRLGFANLTIEFVDRDLAL
FT                   KLIDEWAEKSTFPVQVIYGPEGCGKTAWLLQSIELLKDHGFEVVYVNPINRLAFAEVSI
FT                   NSLREEFFKLVKEAIAQSALARIAWIAYNVVYDVIKATRGKVAVIVDDAFQVIGVKESA
FT                   LYVKALLNLIEYPPEHYEKIVTIAATSEGVSRYEIGRHRWASIRIMWNMPKEGFRQLYE
FT                   QLPGGKPPFEEVWRITGGNPAMLESLYRVGWSAERVLREIIARKNLHTFTSSLGPGDRE
FT                   VLVRALEDPDALMSREGIPLMNRLIELNLIINVPPWRDEYLWVDQPPPEKDEELGIGKY
FT                   VAWQSPLHREAVRRVLGMPG"
FT   gene            435217..435318
FT                   /pseudo
FT                   /locus_tag="Vdis_0448"
FT   gene            435472..435984
FT                   /locus_tag="Vdis_0449"
FT   CDS_pept        435472..435984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0449"
FT                   /product="PaREP1 family protein"
FT                   /note="InterPro IPR010268; KEGG: cma:Cmaq_1549 PaREP1
FT                   protein; PFAM: PaREP1 family protein; SPTR: A8M9F3 PaREP1
FT                   protein; PFAM: Archaeal PaREP1/PaREP8 family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49849"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUC3"
FT                   /protein_id="ADN49849.1"
FT                   /translation="MGVIIELPEPLAREITRLGVDVEGFVIDSVSAGLNPDPSTEIETH
FT                   LELANKYLNEGRNLINKDPVQASEKLYKAAEEAIKALAITLNLDEAKAAREQGRWTAAL
FT                   LFSAVDSISDRLGREEVRLWWRVARFLHVEGFHEARLKPSQVMRDLKHVEALVKLAQEH
FT                   AQGRHGQ"
FT   gene            complement(436057..436152)
FT                   /locus_tag="Vdis_0450"
FT   CDS_pept        complement(436057..436152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49850"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUC4"
FT                   /protein_id="ADN49850.1"
FT                   /translation="METVEEGSCEGSVAGRIAEVAKSLLNSGPVT"
FT   gene            complement(436341..437369)
FT                   /locus_tag="Vdis_0451"
FT   CDS_pept        complement(436341..437369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0451"
FT                   /product="polysaccharide pyruvyl transferase"
FT                   /note="COGs: COG2327 conserved hypothetical protein;
FT                   InterPro IPR007345; KEGG: adg:Adeg_0102 polysaccharide
FT                   pyruvyl transferase CsaB; PFAM: polysaccharide pyruvyl
FT                   transferase; SPTR: C9RAK1 Polysaccharide pyruvyl
FT                   transferase CsaB; PFAM: Polysaccharide pyruvyl transferase;
FT                   TIGRFAM: polysaccharide pyruvyl transferase CsaB"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49851"
FT                   /db_xref="GOA:E1QUC5"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUC5"
FT                   /protein_id="ADN49851.1"
FT                   /translation="MNLRVLIHGYFGFGNVGDEAILSALISEFRRVFGDGVEFVVLSSN
FT                   PGRTRRVHGVHAVRERLLSPTFWRVFLGSHVLVFAGGGRYGYSTWRRITLLAFLARLLR
FT                   KVVVFRGVGVYPYEWVGKPVISDRPEPFRGLTGALIRIALNRASLVTVRDAYSYTVLRL
FT                   TGVNRVYLEDDLALRLKVPDPASCRDFAVKYGLIGGGVLGVNLRTLDDETNRVVVDFVA
FT                   GLIRGFLSNGFSKVVFIPFGFGSFKGRFFDDDLIIAKMLRSRVSELRIIAEELSPLQVL
FT                   CLFNYLDHVIAMRHHAIIFALKVGRPLTAIVYDTKSLELLRRFRDGNVSMFLVSDIKGK
FT                   FR"
FT   gene            complement(437412..438278)
FT                   /locus_tag="Vdis_0452"
FT   CDS_pept        complement(437412..438278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0452"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR017850; KEGG: hsl:OE3738F hypothetical
FT                   protein; SPTR: Q9HNT9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49852"
FT                   /db_xref="GOA:E1QUC6"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUC6"
FT                   /protein_id="ADN49852.1"
FT                   /translation="MLRYDFRGFAKSLKMDLKGAVNEALIRHVYSHLFKILYNYDSYSN
FT                   WLSLFYSLISRRRFLLIVLDDARYDAFKAVYGRYLGGDLMIVRVPPPNTYGWLPKAFSH
FT                   PDFNNVRVFYAGIGIESHDIRIGSFVPRGRRIEVIPIRPSKARHLLTVLPSEVNDAVMR
FT                   IGLSGRDIVWYAQPHFPWVLDEELSLMLMKDALIHDYVPPDTIGYRLRMLGVGRDRVIR
FT                   AYYANLVLVLKYVKDLLNYVKRQNIDYDEVVVTSDHGEMLGEFGLYLHQEYDLPQLVLV
FT                   PWLRVSL"
FT   gene            complement(438271..438975)
FT                   /locus_tag="Vdis_0453"
FT   CDS_pept        complement(438271..438975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1461 thymidylate kinase-like protein;
FT                   SPTR: A8M966 Thymidylate kinase-like protein; PFAM:
FT                   Molybdopterin guanine dinucleotide synthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49853"
FT                   /db_xref="GOA:E1QUC7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUC7"
FT                   /protein_id="ADN49853.1"
FT                   /translation="MNIGNGKLIVVLGPVGVGKSTVIRHLMAILNNRGFRVRREFIKSF
FT                   HGPAYLLWVIMAKLLNLPGKYAPWYLIPKSGRVKLASILMILSAYIDVFINVPIKLLVI
FT                   FMSKVLGFTVVSEEYLPSMLFDYLYSYIDLGVRGSLSRLPIRVLLSMFIRYRPDVTVVL
FT                   NAGDAELLRRWLLRGYGDPQPIRYVHLQRWFLINYVANDGRLKTTLINSDGLSIADTVK
FT                   TLIREGSLIGNA"
FT   gene            complement(438972..440039)
FT                   /locus_tag="Vdis_0454"
FT   CDS_pept        complement(438972..440039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0454"
FT                   /product="methyltransferase FkbM family"
FT                   /note="InterPro IPR006342; KEGG: sso:SSO1901 hypothetical
FT                   protein; SPTR: Q97X54 Putative uncharacterized protein;
FT                   TIGRFAM: methyltransferase FkbM family; TIGRFAM:
FT                   methyltransferase, FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49854"
FT                   /db_xref="GOA:E1QUC8"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUC8"
FT                   /protein_id="ADN49854.1"
FT                   /translation="MNARILLLKEYLRELMDSLASKASSLTALSIYDKPIQLLKLYMTK
FT                   DGVVNACIRQINACTVVTANTVNNAIRIAKVLRKYRDYHFNDGNICIRFDDEYCWNLRD
FT                   VLASEDNYQFLKQFLLLKALGASVERKGNGFLVEVNGIKWFVRGSIWQDLMEGPLLPYL
FT                   HEPYEYRIWFSKIITKVRTFIDVGAYVGGYAVRACKAGVKVYAVEPSAENYNVLSQNLK
FT                   FNECNNVILLNVAAGDFKGKALLSPLRGYGPDTSSLVRSGDEKEVINVVPLDDVITDVE
FT                   MPVMVKIDVEGFEEHVLKGMEKLLKYVGYIFIETNTSTHINVVKYLNGHGFKLRDLRLH
FT                   RGSDELRYNSLFIKG"
FT   gene            complement(440064..441182)
FT                   /locus_tag="Vdis_0455"
FT   CDS_pept        complement(440064..441182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0455"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: cma:Cmaq_1459 glycosyl transferase group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: A8M964
FT                   Glycosyl transferase group 1; PFAM: Glycosyl transferases
FT                   group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49855"
FT                   /db_xref="GOA:E1QUC9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUC9"
FT                   /protein_id="ADN49855.1"
FT                   /translation="MRVAFITAESFTEKRHGGFGWLVRLIGGELARRGFEVYVIAWRDP
FT                   GYPGEYVVDGVRVVTYEYDFGTRSVLRHLANYRDALKVIEDVDADVYISIEAMVETLLA
FT                   ELFVRGAKHIIWAQDPFDWRDYELMASVDPYYRISRVRFMANRFIFGMAYRRADLILTQ
FT                   ARFYIDKLRRLYSIDPGRVIYLPNPVHPIPREEDIVKSEEPTICYLARMDPQKRYWLFF
FT                   ELARQFPEYRFIAMGKPSVLYEDRYREVVSRYRDLKNLEIKGFVSEGEKQEVLNRCWIL
FT                   VLPSIREGLPIAMLEALAHKCTLLSSVNPDGLTERFGYWARNDDFSKGLRYLLSGDKWR
FT                   VLGQEGYRYVANNHRVDKVINELLSYINNVNA"
FT   gene            complement(441179..442135)
FT                   /locus_tag="Vdis_0456"
FT   CDS_pept        complement(441179..442135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0456"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR016040:IPR001509; KEGG:
FT                   cma:Cmaq_1446 NAD-dependent epimerase/dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; SPTR: A8M952
FT                   NAD-dependent epimerase/dehydratase; PFAM: NAD dependent
FT                   epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49856"
FT                   /db_xref="GOA:E1QUD0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUD0"
FT                   /protein_id="ADN49856.1"
FT                   /translation="MNRLVLVTGGAGFIGSHLVDRLIKDGYRVRVVDNFSTGRLENLKH
FT                   LEDNPNLEVMRGDLKNEQDAREAVKGADAVFHFAANPEVRVSSISPRVHFEENVVATFN
FT                   LLEAMREYKVKEMVFASSSSVYGEPEEIPVDENAPVRPVSVYGASKAACENLIHAYSKL
FT                   YGIRAVILRYANIIGPRLRHGVIYDLLMKLKKNLDELEVLGDGTQVRSYLYVDDAVEAT
FT                   IIAWRLSNGNYEVYNVGNEDWVTVNDVMNIILNELGLSNVKIVHRPVLHGVGWLGDVKR
FT                   IALKIDRLKTLGFKPSTLSRGAISMTVKALVRELGFV"
FT   gene            complement(442173..443453)
FT                   /locus_tag="Vdis_0457"
FT   CDS_pept        complement(442173..443453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0457"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: sid:M164_0997 glycosyl transferase group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: C4KG90
FT                   Glycosyl transferase group 1; PFAM: Glycosyl transferases
FT                   group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49857"
FT                   /db_xref="GOA:E1QUD1"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUD1"
FT                   /protein_id="ADN49857.1"
FT                   /translation="MKLGVFARNLFVDWFGGSTRTNRELLIRLANRRGVEVDFIPVVDE
FT                   VYWRFRGKSGFRDMVLKWVETYGKLGIHIHNLLIDYYISGDLHKTWGELSSGILKDYDL
FT                   VYDPILMPMANPRLLNQISQIVGPGHYLLDCLKANRDGKALALVIGSGDVPLSLAWGFR
FT                   FAREYLFDDFRRTVGIELFILRVKSLFDALNKFKDRLIYLIPSTGLIRKIPQLRGARYF
FT                   LFFPFYAVDDRVKAVSVGRKGDYVIFFSRLDLTKGILNLPSIVYYMSKYGCGVEVKVVG
FT                   GFEDKATERAFWRRVNSLDVGKFIDFVGFVPEERKVEAYRLLSSARVMIYPSHVDVVPN
FT                   VVVESLFLGTPVVMYGIPGPREVFEGTRAIRFVPEFDVKSMAREVCLLLNSDEDPIDDK
FT                   ALSIVKAHSDWGPIVDRFIGILHSITD"
FT   gene            complement(443456..444358)
FT                   /locus_tag="Vdis_0458"
FT   CDS_pept        complement(443456..444358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0458"
FT                   /product="glycosyl transferase family 2"
FT                   /note="InterPro IPR001173; KEGG: mtp:Mthe_1674 glycosyl
FT                   transferase family protein; PFAM: glycosyl transferase
FT                   family 2; SPTR: A0B9R6 Glycosyl transferase, family 2;
FT                   PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49858"
FT                   /db_xref="GOA:E1QUD2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUD2"
FT                   /protein_id="ADN49858.1"
FT                   /translation="MRIDVVMPTYNSNKGIFPLVLESIRRYVPLNRLIVVDRYSSDGTV
FT                   ELIKEKFPDALIIQTSASLGYARYIGIKFVETEWFAFIDSDVIVLPQWFRVLSGFMKHE
FT                   RIGAVEGSYIQLADILYTQEFRLIIDIYKYINNSILDNQVSLIKYKLPLSKMNILNILK
FT                   NGLTDVRPIFNNSLIRTEAVKDWVPNPYLNAYEDLAVAQHIIRRGYYWLTINIPLVLHG
FT                   NPPRSNLNKLRASIRKGLWEGAGIKYTGIPRDFVALYTVTRLLGALYRLVRNKDPFNLA
FT                   MRIAFLLSLPSNKYLVVKR"
FT   gene            complement(444355..445182)
FT                   /locus_tag="Vdis_0459"
FT   CDS_pept        complement(444355..445182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0459"
FT                   /product="methyltransferase FkbM family"
FT                   /note="InterPro IPR006342; KEGG: cma:Cmaq_1469 FkbM family
FT                   methyltransferase; SPTR: A8M974 Methyltransferase FkbM
FT                   family; TIGRFAM: methyltransferase FkbM family; PFAM:
FT                   Met-10+ like-protein; TIGRFAM: methyltransferase, FkbM
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49859"
FT                   /db_xref="GOA:E1QUD3"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUD3"
FT                   /protein_id="ADN49859.1"
FT                   /translation="METWHFNIKCIDGGKLCVEPEFIGRIIHNYYVGYLKDVHCEDGYL
FT                   VLNGIRISPKPKFNGQYWDFGTFKIRALYNDLLSNIELFEVFIKQQYSLVNVKDRVVVD
FT                   VGAFIGDSPIYFALRGAKKVYAIEPHPDAYKIMLENIMINNMEDKIVPINAALSSKYTL
FT                   IKINTDIKDTHKTYYGLNSKYGTYEVKAITLSQLINDYGIEPDVLKMDCEGCEFDVVMN
FT                   DYEHVRLFKELILEYHEVNDHELSELLSFLNRDYRCEVINERPRFGILHCVRL"
FT   gene            complement(445278..445709)
FT                   /locus_tag="Vdis_0460"
FT   CDS_pept        complement(445278..445709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0460"
FT                   /product="glycosyl transferase group 1"
FT                   /note="InterPro IPR001296; KEGG: tvo:TVN0880
FT                   glycosyltransferase; PFAM: glycosyl transferase group 1;
FT                   SPTR: B5L471 WffI; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49860"
FT                   /db_xref="GOA:E1QUD4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUD4"
FT                   /protein_id="ADN49860.1"
FT                   /translation="MQWVYDKIRDIRNIEIYPHLPINEYSRLLSESHILLFPSRYESFG
FT                   LVILDAMASGVIPVAFNVRGVVRDVLLNDKVLSDYIIDYPNIKLFIKKILELYNLWNRS
FT                   NDKFKELILEACKLANEYSWNNVGILWAKVLGKLLKETH"
FT   gene            complement(445812..446282)
FT                   /locus_tag="Vdis_0461"
FT   CDS_pept        complement(445812..446282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0461"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: C0JJ23
FT                   Allorecognition 2"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49861"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUD5"
FT                   /protein_id="ADN49861.1"
FT                   /translation="MITVVSNWAPAPFRKALIEYGVYMIKMNFTLNDMHNLERFDLIYY
FT                   ARFTPPLISKDLFTLNTIRLGHKVIYGLHMPLTIDHKVRPSHYVYDVAMITQAMIAKAR
FT                   GFRIHASNMTDYNIAKSLGLRPIYLPLGTDTTIFKCRDKPDIFTVIYASWPA"
FT   gene            complement(446288..447778)
FT                   /locus_tag="Vdis_0462"
FT   CDS_pept        complement(446288..447778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0462"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="InterPro IPR002797; KEGG: kcr:Kcr_0849
FT                   polysaccharide biosynthesis protein; PFAM: polysaccharide
FT                   biosynthesis protein; SPTR: B1L566 Polysaccharide
FT                   biosynthesis protein; PFAM: Polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49862"
FT                   /db_xref="GOA:E1QUD6"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUD6"
FT                   /protein_id="ADN49862.1"
FT                   /translation="MSRAGVKAVRGSLWITSGRFIYNAVGFIGSIVIARLLTPGEYGLI
FT                   SIALTYPLFFTSIADLGLSTAIMRYAAAGMHRHALSAVLLRSLSGIAFGLALVPLSTYL
FT                   ALTLRRPYLSLAIQILSIYTIAYMVQTSVNNYLIGVGRYGDFVILDLVRNITRISVSIA
FT                   LILIGLGVYGAYWGFSIGYLAAAFLAIFMLPKVEGKLNIKGVVNELFNYSIPLYIPTLI
FT                   SIPLGQLYNILIAIYVTNTEMGNYQIANNLLAVASLVSGSVSTALFSALPEFIGEDYKL
FT                   RSAINRAAYLMALIISPIALALALFSRQAVYVVYGSSYSLAPLYLSIMAINLLLSPLGV
FT                   ITMYLNIIGDTRLSMVISLINTVIGLPITWALLVRWSMLGAVIASIINGAIGTAITYGI
FT                   VKARHNLTVNIPKTIYYMLPGILSYIATYLILTRIKGLYIQLLIGLPLYVILMGILIAL
FT                   ITDVEDLKYLSNAVRNIKYVGPLISRLVSIEIDLKAIL"
FT   gene            complement(447775..448722)
FT                   /locus_tag="Vdis_0463"
FT   CDS_pept        complement(447775..448722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0463"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1216 glycosyltransferase; InterPro
FT                   IPR001173; KEGG: min:Minf_0497 glycosyltransferase; PFAM:
FT                   glycosyl transferase family 2; SPTR: B5JPV4 Glycosyl
FT                   transferase, group 2 family protein; PFAM: Glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49863"
FT                   /db_xref="GOA:E1QUD7"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUD7"
FT                   /protein_id="ADN49863.1"
FT                   /translation="MRITIIVLTSGSRDRLSLLKHLLKSIAAQTVLPDEVIVATESNGE
FT                   LIKALGDGYLNGVVFRVLETGYWNKCLTANEAILKADGDVIFLLEDDLYLTPSFIEEVV
FT                   ETFRKFPDAGCVYTNCIWVFPEGSGSRGGVVGRAARLLSKLTIHGSVLPRFTRPVSNGV
FT                   FEVGSFTMSVACRREALLRAGLYDVRVWEPILGEDFDLAFRVRKAGYRILQNTRAVSYH
FT                   FTMQVTKGSAKYRSDPSALMGTYATEVYFMAKNRDLLGLSHVITHAIYRMIESVMWGVR
FT                   SGNPLTIIYGIAGSLLGLLRGLLVNPMSGVKPRP"
FT   gene            complement(448719..449828)
FT                   /locus_tag="Vdis_0464"
FT   CDS_pept        complement(448719..449828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0464"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: smr:Smar_0947 glycosyl transferase, group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: A3DN36
FT                   Glycosyl transferase, group 1; PFAM: Glycosyl transferases
FT                   group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49864"
FT                   /db_xref="GOA:E1QUD8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUD8"
FT                   /protein_id="ADN49864.1"
FT                   /translation="MLKVVLLTNTINRAGGAEQVTLAMYKALTSLSNVKVLVLGREELR
FT                   PELLKLWVPGNLLKDFVSHYIYVRRFDHELHKLLNYDLIVNTRSNEILAPAHVHYFHWV
FT                   FSPYGVKDTEALAYYKLAYNIKDGIVRHAIRHVLHYILAKFSKVTLANSKYTANLLKDL
FT                   GIKAHVLYPPVKASEIATRAESLIRDKKPIVITISRIDNGKSLEILPMVAFKIKSMRFI
FT                   LVGSLANYDYYMKLVKLSKALGLDNFIIMPNLPKDKLYDLLAISSIYLHTAHHEQFGIS
FT                   IVEGMAAGCIPVVHRSGGPYEDILDKSDGIYGFSYGDIDELISIINNISIMNKGELADL
FT                   RKNALRRALSFDEGVFIAKFRSIISSLIS"
FT   gene            complement(450057..450254)
FT                   /locus_tag="Vdis_0465"
FT   CDS_pept        complement(450057..450254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0465"
FT                   /product="glycosyl transferase family 2"
FT                   /note="InterPro IPR001173; KEGG: tna:CTN_0026 hypothetical
FT                   protein; PFAM: glycosyl transferase family 2; SPTR: B9KB06
FT                   Putative uncharacterized protein; PFAM: Glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49865"
FT                   /db_xref="GOA:E1QUD9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUD9"
FT                   /protein_id="ADN49865.1"
FT                   /translation="MCDVGIVMVTYNSVTKLGEFFNKVLESLTNLNTGDLNVRIAIVDN
FT                   ASSDATVQVVSERLSKEPKV"
FT   gene            complement(450285..450488)
FT                   /locus_tag="Vdis_0466"
FT   CDS_pept        complement(450285..450488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0466"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pjd:Pjdr2_1928 pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49866"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUE0"
FT                   /protein_id="ADN49866.1"
FT                   /translation="MLGFREDMELLSKLRTKPVIVDTNVRRCYPHTLRDVIRQQLWYGR
FT                   TWLRYVKLNGNLRSDLCVSISH"
FT   gene            complement(450656..451867)
FT                   /locus_tag="Vdis_0467"
FT   CDS_pept        complement(450656..451867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0467"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: hbu:Hbut_1505 glycosyltransferase; PFAM:
FT                   glycosyl transferase group 1; SPTR: A2BMW6 Predicted
FT                   glycosyltransferase; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49867"
FT                   /db_xref="GOA:E1QUE1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUE1"
FT                   /protein_id="ADN49867.1"
FT                   /translation="MRYVVSVLHHSIPSIRPGALAEEDDVGWHFRAAKALTRYGGFKAV
FT                   AMRPSGSEDYLTKIIEDVPVVLTPTINLSPSRRLLKWSEYSPALAQLTEYLVKRHEAVP
FT                   YIHEYRALNSELIIRRLINYPMILQHHGSRPPMLRNALRPDLISDVKELSKIRRETLLK
FT                   RVKGAIFVINRVEKEYLESLGVDAEVMVRTMAVDFNELKPPSMEEKRKLRIKYGIPEDA
FT                   VVLTTYTGVFGEEFSTLKGTHLIARLWKDLRRVLNIRLMLMVTGLGEAWVKAFRELGIV
FT                   AYGFLPHKTFIELLKASDAYFLMATPGYYGGIGVAVMEALALGKPVVSPTLTDYPELRE
FT                   VKYLGAVTEYVSNEDDYYEFLKALTYIVENINNYKSELIRSLAYRHYSWESFIKNFIQV
FT                   INKL"
FT   gene            complement(451864..452481)
FT                   /locus_tag="Vdis_0468"
FT   CDS_pept        complement(451864..452481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0468"
FT                   /product="polysaccharide deacetylase"
FT                   /note="COGs: COG0726 xylanase/chitin deacetylase; InterPro
FT                   IPR011330:IPR002509; KEGG: cma:Cmaq_1454 polysaccharide
FT                   deacetylase; PFAM: polysaccharide deacetylase; SPTR: A8M960
FT                   Polysaccharide deacetylase; PFAM: Polysaccharide
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49868"
FT                   /db_xref="GOA:E1QUE2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUE2"
FT                   /protein_id="ADN49868.1"
FT                   /translation="MTCISINFDDGYLIHYEYAKTLYRMDIPATFFIITGLNEYMGKKL
FT                   IITRTELIKELIDMGHEVGSHTHTHRDLTTVSPSELREEFARSIETLMKVLRNGDGFGI
FT                   AYPYGSFNENIANEASRYFIYGRVMGRFNRWNERPMRYAVGGMGVRHLVKYPLKVLVSK
FT                   PRLIVVVFHDEPSWLIKLTIGYLKAFNVRFVTLREGLRCLGL"
FT   gene            complement(452478..453647)
FT                   /locus_tag="Vdis_0469"
FT   CDS_pept        complement(452478..453647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0469"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: ape:APE_2066.1 glycosyl transferase, group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: Q9YA73
FT                   Glycosyl transferase, group 1; PFAM: Glycosyl transferases
FT                   group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49869"
FT                   /db_xref="GOA:E1QUE3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUE3"
FT                   /protein_id="ADN49869.1"
FT                   /translation="MRIVLLTTDYPPYSGGGIGTFTYELSKGLETFGNEVFIISKKHMI
FT                   NYNSQSLNEYFLTSPAIPPKDIWFYITRSYSITKLVKGLKPDVIHDVSGVTGYLPWISK
FT                   IAPTIVTVHGTPLLGRIRLLMGGEDRIRSILFDLTHSIPARLVQIITKPDIKYIVFASK
FT                   SALWDSLIGLDDKAKNGLLKKVHVVYNGVNINWLRDIAKSTTHVENYSVVFIGRLMEYK
FT                   GVKWLVRAFRLVVNELSKAKLHIVGDGPIYRDIKDLVNKLDLENNVIMHGSLPRTEAMK
FT                   VLAQSMVLTHPSLAEGFGIVIAEAYAMGKPVITHKSTYSYELVAETGAGLMVNTLNERE
FT                   YADALIQLLTDENLYRKLSQRALEVSERFSMENMVKGYLKVYSKAINGS"
FT   gene            complement(453644..454831)
FT                   /locus_tag="Vdis_0470"
FT   CDS_pept        complement(453644..454831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0470"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sul:SYO3AOP1_1399 glycosyl transferase group
FT                   1; SPTR: C4FIR5 Glycosyl transferase, group 1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49870"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUE4"
FT                   /protein_id="ADN49870.1"
FT                   /translation="MKTIAVIGALDLYTRHELGLIATLNYHGYHTYAIALNPFIRDIRK
FT                   NSMWVEIDRGHSKVNIIEIPLNYGSSSLIKALSCCINELDIIILTSGIPWKQSISIYNY
FT                   IKRSIGALLITRFWSIRALKLIDNLLHGSYYDLALFMPSLFVNYVKMISSNAIIYEDHY
FT                   TYKVGKYIAPHIPGSKIYPTPGIPKDTINEVDEKAYEIINNIINKYGGYVLASTILIKA
FT                   FDIEKYEAVPHALLIYGIARRNPEIPIIVFGSTKDEFQRAFPELARRLPQNLVFIGKGL
FT                   SNKFIRYLYRNASVVIIYISNRSVSNRFLETIYFRKPMIFNRTALELYPELVKFIDLNL
FT                   SLADNLDDYTNKIKILFKNDKIQEELSKQIGNAYEMLFSSTGNIRALERFIENSR"
FT   gene            complement(454828..456669)
FT                   /locus_tag="Vdis_0471"
FT   CDS_pept        complement(454828..456669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0471"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mar:MAE_25670 hypothetical protein; SPTR:
FT                   A8YI05 Similar to tr|Q8Z0N6|Q8Z0N6"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49871"
FT                   /db_xref="GOA:E1QUE5"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUE5"
FT                   /protein_id="ADN49871.1"
FT                   /translation="MGISFPSALLLLTGLFTVLFTTLLILTHNKGDREPPLSHGTANAM
FT                   LTAADVLALVTLFLNLATPIRAGYPMIYEVAITAIAALTIIPMIASKPTDSMISKALSS
FT                   VIMLNIILLNDQLPSTGISWGEGIEMYRDMYMAGHWSFSFAYNPAYNPFPAQVAQVVMM
FT                   AKVLNLPWYSSLVWGIWYAVFTIVYDMVIYMLTLRLTQNKAASVLAAFFVGVTPETALT
FT                   LNPHLWLSNLFVLISTVTLINVIEGFEPAQNAVISALSYILAVLSLTTALLMLLVPISF
FT                   IVAWYVLRALRLYKPIHQGATSARKGLILFLFAVYTVVTLLVFLYTQGYFTYVYPMLDS
FT                   LNQAIWQILIRLFVRSITKVKGVQYHFLYSGANPVLAYAWSLAFSIAASYLLYVVFRKR
FT                   RENVWLMTLLVVGLVVPGIAAVQRIFTATYPITVNAYTAIPLTFPIVGLALTRLKDKSK
FT                   AILMLLILLLVAIVPIASYDPSISPIEYAKIHHYNVPPLTRSEYECTLLLNNLLPSNTG
FT                   PLYVYSPIMGTLPWYTPSLGGVGAYPTNVIAQALPMIRFIYNESSVNVYVVVYNGTLSK
FT                   AYYVTLGPGIPPTIVYNPLNNPNIIFNSNYATLLEPS"
FT   gene            complement(456817..457947)
FT                   /locus_tag="Vdis_0472"
FT   CDS_pept        complement(456817..457947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0472"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: cma:Cmaq_1445 glycosyl transferase group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: A8M951
FT                   Glycosyl transferase group 1; PFAM: Glycosyl transferases
FT                   group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49872"
FT                   /db_xref="GOA:E1QUE6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUE6"
FT                   /protein_id="ADN49872.1"
FT                   /translation="MRIIHIHHNYFPVVGGIEVTMNRLGLWQTKFGNEVYVLTGNINDG
FT                   FKGDGILRVHRVPIIHIPNYREISIPINVPNELLKNADIIQGYNQNSLFTYIIERKAYE
FT                   YGKPIITYLIAVDYLHNHYRLLMRTLGFKYQVYLTRRFIKLSRLLFVTNNYERELLMSR
FT                   YGVDSAVIPHGIDDEYLEEPSRAWAFRNKYGITDEIFTYIGRLHWTKGIDMLIKAFKYV
FT                   INKFDNIRLVLAGKGDRKYISYLSKLIDKLRLNGLVLMLGYINEDDKIALIDASRAVIL
FT                   PSRHAGESYPLIANETAARLKPLIATGIGSIPRLSMEHIVITELNETSIAEAMIKMLNS
FT                   EYYKDYVDKAKKVRERLLRWSDVAKLTIKYYNEVIK"
FT   gene            complement(457944..458156)
FT                   /locus_tag="Vdis_0473"
FT   CDS_pept        complement(457944..458156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0397 hypothetical protein; SPTR: Q8ZZ78
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49873"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUE7"
FT                   /protein_id="ADN49873.1"
FT                   /translation="MRSHTHGNRLDYQVAYSTHALIKHRMDVARYTGPETLNIIASKAY
FT                   MNGHGTPDEVPDNLKGIEIERRMIL"
FT   gene            complement(458114..458497)
FT                   /locus_tag="Vdis_0474"
FT   CDS_pept        complement(458114..458497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0396 hypothetical protein; SPTR: Q8ZZ79
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49874"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUE8"
FT                   /protein_id="ADN49874.1"
FT                   /translation="MVTPLDVEILDSQPGLIEVEDYVTIRYRIVGVKAARVGEGYEITA
FT                   LIDVGARFSKQPQQVVGLCGDNVPYRPASFKLVELAHAVVRVDGRVFDVYIEPMAVMIA
FT                   DGFITATGEPCVAIHTAIGWITK"
FT   gene            complement(458481..458780)
FT                   /locus_tag="Vdis_0475"
FT   CDS_pept        complement(458481..458780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0394 hypothetical protein; SPTR: Q8ZZ80
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49875"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUE9"
FT                   /protein_id="ADN49875.1"
FT                   /translation="MVGVWVSNVQSNVVTNSGSQAPVVAVARAYYDASVEVVSIRFRDG
FT                   EVKYVIEGVGNFAIFADDNGVWGVDLEVKRWVSDRGEVVNVFRRVKVGVYGNAT"
FT   gene            complement(458823..459371)
FT                   /locus_tag="Vdis_0476"
FT   CDS_pept        complement(458823..459371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0476"
FT                   /product="PaREP1 family protein"
FT                   /note="InterPro IPR010268; KEGG: pas:Pars_0363 PaREP1
FT                   domain-containing protein; PFAM: PaREP1 family protein;
FT                   SPTR: A4WHS8 PaREP1 domain containing protein; PFAM:
FT                   Archaeal PaREP1/PaREP8 family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49876"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUF0"
FT                   /protein_id="ADN49876.1"
FT                   /translation="MSTETIEKPLPKLTTEDYVSARLLEALVEAYLAIRFLSEGLVRNA
FT                   AGKAFQAWRAFLAALLRLELNNLLKVAKTEEERRWLMDKAVPRVPTTRMVALSQMLEEV
FT                   GYVGLYFTTSAALDLHDYQYNGPDPDMALSKFRNREEAAKAAMELIKELTRRIEEVKTR
FT                   VKWGSDLEEALSELKRVLG"
FT   gene            complement(459425..460429)
FT                   /locus_tag="Vdis_0477"
FT   CDS_pept        complement(459425..460429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0477"
FT                   /product="ATPase"
FT                   /note="InterPro IPR011579; KEGG: cma:Cmaq_1422 hypothetical
FT                   protein; PFAM: ATPase; SPTR: A8M928 Putative
FT                   uncharacterized protein; PFAM: Archaeal ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49877"
FT                   /db_xref="GOA:E1QUF1"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUF1"
FT                   /protein_id="ADN49877.1"
FT                   /translation="MKRVKLNFANQQVEFVDRDLALKLIEEWAGKGTYPVQVIYGPEGC
FT                   GKSAWLLQSVVLLREFGFEVIYVNPINKEVLAEFGVASLRDEFLRMVREALAQNALGRL
FT                   AWLAFDFAKELIRVTRGKVAVIVDDAFQVIGVKESALYVKALLNLIEYPPEHYERIVTI
FT                   VATSEGVSLREIGRHRWAWSTPMWNMPREGFKQLYEQLPGDKPDLEEVWRITGGNPAML
FT                   ESLYSANWDVGKIIDKITKEKELSPDFIKKWAGHLREAVGDPDYLWFNAPGELINELIE
FT                   RNLIIHFLPKRKPDYWVDTPPPEKDGELGIGRYVAWQTPIHREAVKKALQEVT"
FT   gene            complement(460426..460986)
FT                   /pseudo
FT                   /locus_tag="Vdis_0478"
FT   gene            complement(461011..462027)
FT                   /locus_tag="Vdis_0479"
FT   CDS_pept        complement(461011..462027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0479"
FT                   /product="ATPase"
FT                   /note="InterPro IPR011579; KEGG: cma:Cmaq_1422 hypothetical
FT                   protein; PFAM: ATPase; SPTR: A8M928 Putative
FT                   uncharacterized protein; PFAM: Archaeal ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49878"
FT                   /db_xref="GOA:E1QUF2"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUF2"
FT                   /protein_id="ADN49878.1"
FT                   /translation="MKRVKLNFAGKEIEFVDRDSALRRVAEEWAVKGTFPVQVVLGPEG
FT                   CGKTAWLLQSIELLREFGFEVVYVNPVNRLALAEISINSLKDEFLRLIKEAIAQNALAR
FT                   IAWIAYNVVYDVIKATRGKIAIIVDDAFQVIGIKESALYVKALLNLIEYPPEHYEKIIT
FT                   IAATSEGVSRREIGRHTWANLRVMWNMPRDGFRQLYDQLPGDKPPFEEVWKLTGGNPRM
FT                   LERLYNAGWGVKAVIRDMRDEKGLDAFIDSLTSEEKRWLDEAINDPDTLMSRERIPLMN
FT                   RLIELNLIIEIPQWRDEYLWIDQPPPEKDPELGIGRRVAWQSPLHREAVRSALQGLM"
FT   gene            complement(462024..463043)
FT                   /locus_tag="Vdis_0480"
FT   CDS_pept        complement(462024..463043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0480"
FT                   /product="ATPase"
FT                   /note="InterPro IPR011579; KEGG: cma:Cmaq_1422 hypothetical
FT                   protein; PFAM: ATPase; SPTR: A8M928 Putative
FT                   uncharacterized protein; PFAM: Archaeal ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49879"
FT                   /db_xref="GOA:E1QUF3"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUF3"
FT                   /protein_id="ADN49879.1"
FT                   /translation="MRRIKLPLALDLQVEFTDREIALKRIDEWVDRGMRLVEVVLGPEG
FT                   CGKTAWLLQSVELLRDYGFDVIYINPLNGRVYAEVGIKDLRNELYRLAQEAISQNALAR
FT                   IAWIAYNVINELIKARRGRVAILADDVFQVIGVRESAMYVKALLNLIEYPPAEYERVIT
FT                   IVATSEGVSRREIGRHTWAHLDIMWNMARDGFRQLYEQIPDNKPSLEEAWKLTGGNPRM
FT                   LGNLYENRWNTDKVISDIISEKRLRTFISSLTNTEKSWLQEATENPDTLMNRERIPLMD
FT                   KLVELNLIIDDIPERKEYLWIGEPPPEKDGELGIGRYVAWQTPIHREAIRKVLGETKP"
FT   gene            complement(463040..464044)
FT                   /locus_tag="Vdis_0481"
FT   CDS_pept        complement(463040..464044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0481"
FT                   /product="ATPase"
FT                   /note="InterPro IPR011579; KEGG: pas:Pars_0336 hypothetical
FT                   protein; PFAM: ATPase; SPTR: A4WHT0 Putative
FT                   uncharacterized protein; PFAM: Archaeal ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49880"
FT                   /db_xref="GOA:E1QUF4"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUF4"
FT                   /protein_id="ADN49880.1"
FT                   /translation="MRRIELRLANVRINFVDRDSAIKWIEQWIDRGMALPHVVYGPEGC
FT                   GKTAWLMQSAEVLRDHGFEVIYVNPIEGSFIVELGIEKLRNKLMDIIREATSQLTWGRV
FT                   AWAVIDVAREAIEARVRRLAVIVDDAFQVIGLDRAAIYVKGLLGLLEHPPANYESMIAI
FT                   AATSEGVSLREIGRHSWSDITPIWNMPKEGFEKLYEQIPGSKPPFEEVWGLTGGNPRML
FT                   ERLYERGWNADKVIEQLILDREVTREFIRRWRREMEAVLSDPDYLWNEGPRELANELIK
FT                   RNLIIYGIPSRDPDQWVDTPPPEKDEELGIGRYVAWQSPLHREAVRRALQGLM"
FT   gene            complement(464044..465057)
FT                   /locus_tag="Vdis_0482"
FT   CDS_pept        complement(464044..465057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0482"
FT                   /product="ATPase"
FT                   /note="InterPro IPR011579; KEGG: pas:Pars_2204 hypothetical
FT                   protein; PFAM: ATPase; SPTR: A4WMY3 Putative
FT                   uncharacterized protein; PFAM: Archaeal ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49881"
FT                   /db_xref="GOA:E1QUF5"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUF5"
FT                   /protein_id="ADN49881.1"
FT                   /translation="MRRIRLSLALSLAVEFVDRDLAMRRVEEWAEKGAGFPKVIYGPEG
FT                   CGKTAWLLQSVELLRDYGFDVIYINPIEQRFMAEVGVEDVRKRLVEILREATSDAWVRA
FT                   VWVIIDLARELIRMRRGRLAVIVDDAFQVIGLDKAAVYVKGLLGLIEHPPGDYEKIVTI
FT                   VATSEGVSLREIGRHEWSDIMPMWNMPKEGFRQLYNQIPGDKPPFDEVWRITGGNPRML
FT                   ERFYENNWSVDKVVNEVINRNKLRRFARSLSSVKRAWLMEAVNDPDTLFARERIPFMDR
FT                   LVELNLIIDDVPERREYLWIDQPPPEKDEELGIGKYVAWQSPIHREAVKRVLESLK"
FT   gene            complement(465054..465467)
FT                   /locus_tag="Vdis_0483"
FT   CDS_pept        complement(465054..465467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1432 hypothetical protein; SPTR:
FT                   A8M938 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49882"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUF6"
FT                   /protein_id="ADN49882.1"
FT                   /translation="MFIPPEEALGLIRDFLNNTINAVSLQLIQSIRRVAIRLGVWWRVN
FT                   SLRRGLLEAAIPYLRRGLRFKSPKALEMLREAVIEALSLVLMRKVRFIAYLVGRRLTER
FT                   LGWVRAVVRRVQDMINIGLMWLNTPMMYRPGLA"
FT   gene            complement(465524..465823)
FT                   /locus_tag="Vdis_0484"
FT   CDS_pept        complement(465524..465823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sto:ST1611 hypothetical protein; SPTR: Q970I4
FT                   Putative uncharacterized protein ST1611"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49883"
FT                   /db_xref="GOA:E1QUF7"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUF7"
FT                   /protein_id="ADN49883.1"
FT                   /translation="MIGRPIRNYTLALLSIPYLVSPVIIYYVANYVLSLYHVPARYPLV
FT                   LMGSGVMGVNYGGASALMAITITPHPIYWAALTAGLMAIPAAMEVRRVNGPGRG"
FT   gene            complement(465813..466775)
FT                   /locus_tag="Vdis_0485"
FT   CDS_pept        complement(465813..466775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0485"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: pas:Pars_0341
FT                   glycosyl transferase family protein; PFAM: glycosyl
FT                   transferase family 2; SPTR: A4WHT5 Glycosyl transferase,
FT                   family 2; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49884"
FT                   /db_xref="GOA:E1QUF8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUF8"
FT                   /protein_id="ADN49884.1"
FT                   /translation="MASGVGNKLLDLVTVVIPTRDEVKGIGLVLDELIGVGVPRDRVLV
FT                   VDGGSTDGTVDVALRYGVRVVQQEGRGKAMAIWTALKYVSTPYMLVMDGDYSYPAKHVL
FT                   ELVEEIVRTGADEVIGVRRPLPGSQRLIYRFGNWLLTRVFNLLFDTRLHDVLSGMYVVR
FT                   VEALRDAVAEVGGFSIEAHIAAHMVSTGRVIREIPIEYRRRVGKKKLGVKDGLAIFGDM
FT                   VRLTTRYNPMLILFLIGALLLIPGLALGAYVGYWYLFYGIKYYLKGLVAIMLTLIGLQF
FT                   LGMAAMAIYMKRMEYRLRKAIESLRRDPGVEHIPSGHDR"
FT   gene            complement(466830..467459)
FT                   /locus_tag="Vdis_0486"
FT   CDS_pept        complement(466830..467459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0486"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="COGs: COG1011 hydrolase (HAD superfamily); InterPro
FT                   IPR005833:IPR005834:IPR006328:IPR006388; KEGG:
FT                   sin:YN1551_1837 haloacid dehalogenase, type II; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; SPTR:
FT                   C3NIE3 Haloacid dehalogenase, type II; TIGRFAM: haloacid
FT                   dehalogenase, type II; HAD-superfamily hydrolase, subfamily
FT                   IA, variant 2 (HAD-like); PFAM: haloacid dehalogenase-like
FT                   hydrolase; TIGRFAM: Haloacid dehalogenase superfamily,
FT                   subfamily IA, variant 2 with 3rd motif like haloacid
FT                   dehalogenase; 2-haloalkanoic acid dehalogenase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49885"
FT                   /db_xref="GOA:E1QUF9"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUF9"
FT                   /protein_id="ADN49885.1"
FT                   /translation="MRVLAFDVYGTLFDVNSIGRRLGDMGFVELWRRKQLEYTWLLTIM
FT                   GKWMSFREVTRMALEYALTQYRIDKPVDELMRYWEELEPFSDVYLLRGLVGRVRMYVLT
FT                   NGDEGMVKPLLSRWGLADLFNGVFTAERVRAYKPSPAIYRTFLDFIGEPGSEVCLVSSN
FT                   YFDVAGAKNAGVCAIHLNRRGSPPELGVVADAEVRSIEGLVSLFKP"
FT   gene            467685..467834
FT                   /locus_tag="Vdis_0487"
FT   CDS_pept        467685..467834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49886"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUG0"
FT                   /protein_id="ADN49886.1"
FT                   /translation="MSRINDLVYPVISLNARPPPMPRELIIRVSVEEEMPNGYYLQIPP
FT                   GAYL"
FT   gene            467905..468060
FT                   /locus_tag="Vdis_0488"
FT   CDS_pept        467905..468060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49887"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUG1"
FT                   /protein_id="ADN49887.1"
FT                   /translation="MFGEWITINIKGNYTKDNYLCWEAPKYLIPALGEDEVNAILINYC
FT                   PNQLNQ"
FT   gene            468236..468309
FT                   /locus_tag="Vdis_R0007"
FT   tRNA            468236..468309
FT                   /locus_tag="Vdis_R0007"
FT                   /product="tRNA-Met"
FT   gene            468474..469121
FT                   /locus_tag="Vdis_0489"
FT   CDS_pept        468474..469121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein ; K06679 mitotic spindle
FT                   assembly checkpoint protein MAD1; SPTR: Q6BSY1 Spindle
FT                   assembly checkpoint component MAD1"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49888"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUG2"
FT                   /protein_id="ADN49888.1"
FT                   /translation="MRFAQDKQAVSDEVIKRNKFCSGVRVGHKYACGGEVNDVELLNES
FT                   VNLLTEAVNRILKWQVWDTWWIDVWRREWNRVRDNVKEQFKGKYSDEVMNNLLVVIDEY
FT                   IRYIDVLKEYWVTNDVGGNIRKLVEDLMSERAEVIVRRTGNSLINSVHGKYVSLTAKRP
FT                   GEGVIVHLELSDLRVMTVKVPDIWNIINVDHDESIKDVLMALRLALPPLMRV"
FT   gene            469202..470026
FT                   /locus_tag="Vdis_0490"
FT   CDS_pept        469202..470026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to Beta heavy chain of outer-arm
FT                   axonemal dynein ATPase; SPTR: B5IPX5 Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49889"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUG3"
FT                   /protein_id="ADN49889.1"
FT                   /translation="MHINAISVNVNDVSILWYLGANDYPSFKDRVFEIVKNLNDKALLI
FT                   FMLAAVLGDGYAGIKKPRIRLVISAAELDMWRPILDKLNSMGFREYQDPLRNTFKITYT
FT                   SGYATDLAKAMVNALPLVLRDLLDALSIKKWLDIKQIASMEVKFRLGESRVLVGGESFT
FT                   MAVSRGSVTLLRRVRDWVEVGRVLEELRVSYGEGFVSQVRVHRSGGYIVIAIPARLIEG
FT                   HEDIRVQVINVLCRKYRRVKDDNKRKEVVKALSRFASMETIRICLGNTSLPS"
FT   gene            470379..471305
FT                   /locus_tag="Vdis_0491"
FT   CDS_pept        470379..471305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0491"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="COGs: COG0379 Quinolinate synthase; InterPro
FT                   IPR003473; KEGG: cma:Cmaq_1792 quinolinate synthetase;
FT                   PFAM: Quinolinate synthetase A; SPTR: A8MAY6 Quinolinate
FT                   synthetase complex, A subunit; TIGRFAM: quinolinate
FT                   synthetase complex, A subunit; PFAM: Quinolinate synthetase
FT                   A protein; TIGRFAM: quinolinate synthetase complex, A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49890"
FT                   /db_xref="GOA:E1QUG4"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUG4"
FT                   /protein_id="ADN49890.1"
FT                   /translation="MGTKDLVNEVLSLKRERNAVILAHNYMDYDIQVVADFIGDSYDLA
FT                   LRAMETRAEVIVFAGVRFMAEQAKALNYDRIVLAPDLNAGCTIADALDVDTLRRVKEEY
FT                   PNAPVVLYVNSNADVKALADYIVTSSTAVKVIKKLSSDVVIFGPDSNLADYVAHLTGKR
FT                   IIKVPPNGKCIVHGSYTVGLVKETRARYPRARVMIHPEAPLEVLGLADFVGSTNQMIEY
FT                   ARNSGYDEFVVGTEIGMLNALRLKVPNKTFYPITTEPYARCPFMAMVTLEKVRRSLRDL
FT                   VHRIEIPRSTAEAIRDAFERTRRLLEG"
FT   gene            471305..472753
FT                   /locus_tag="Vdis_0492"
FT   CDS_pept        471305..472753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0492"
FT                   /product="L-aspartate oxidase"
FT                   /note="COGs: COG0029 Aspartate oxidase;
FT                   InterProIPR015939:IPR001412:IPR003953:IPR004112:IPR 005288;
FT                   KEGG: cma:Cmaq_1793 L-aspartate oxidase; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; SPTR: A8MAY7 L-aspartate oxidase; TIGRFAM:
FT                   L-aspartate oxidase; PFAM: domain; FAD binding domain;
FT                   TIGRFAM: L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49891"
FT                   /db_xref="GOA:E1QUG5"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUG5"
FT                   /protein_id="ADN49891.1"
FT                   /translation="MWLIYVIGDGIAGLSAAIALRRSGRGVTVITKELHGGSSFISKGG
FT                   VAAATSIDDSPQLHAEDTLRVGDGLCDVDAVRYFTSEAPVVIEKLTNMGFEFDSDLRLE
FT                   GGHSRRRIHHKADETGRALMEFLLRKAFELGVNIVEDELTALQVRDGVVKGFVTRERGL
FT                   ISNVDYLVLATGGYAYLWRYTSNPPTNTGDGIAIAFRAGAVVSDMEFVQFHPTIATLGN
FT                   ETMLLTETLRGEGARVVNEFGVRFTFKYHERGELAPRDVLSRAIYMELMSGHRVYMDLG
FT                   GIEDFERKFPGVNDFLRRHGLGNKDWVPIHPGAHFTIGGLRVNVRGETNIRSLYAIGEV
FT                   ADTGLHGANRLASNSLLEALIMGFNLPRYIGEPWDGPRLDDGLMVTVKLRDHGPMMSIG
FT                   EVRRVNWEYVGILRSGDGLRKAVDLYEQMNVAVNSRESNAALVSYLTAYAALLRTESRG
FT                   AHYRVDYPSKDANWRRRIYFKVSA"
FT   gene            472750..473580
FT                   /locus_tag="Vdis_0493"
FT   CDS_pept        472750..473580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0493"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="COGs: COG0157 Nicotinate-nucleotide
FT                   pyrophosphorylase; InterPro IPR002638:IPR004393:IPR013785;
FT                   KEGG: sin:YN1551_1634 nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase; PRIAM: Nicotinate-nucleotide diphosphorylase
FT                   (carboxylating); SPTR: C4KGV0 Nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase, C-terminal domain; Quinolinate phosphoribosyl
FT                   transferase, N-terminal domain; TIGRFAM:
FT                   nicotinate-nucleotide pyrophosphorylase; UbiD family
FT                   decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49892"
FT                   /db_xref="GOA:E1QUG6"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUG6"
FT                   /protein_id="ADN49892.1"
FT                   /translation="MIEELYITRLLNYLEEDAYPEDITSRFLEGIRARGVVRSRDEGII
FT                   AGLRFIVPFLKYLGFEVITHKYDGEAIRKGDVIIEIIGDAGRLLTVERLTLNLLSRLSG
FT                   IATATNTMVRLARSVNPTVRIAGTRKTTPGFRVFEKYAIEIGGGDPHRFNLADAVLIKD
FT                   NHIAVYGDLEGLIKLIKERTSFTKKVEVEVSTYEDAIRAYRAGADAILLDNMKPSDIVP
FT                   IVRELKGKVILEASGGITPDNVVEYARTGVDIISSGYITHSAKSLDLTMDAERV"
FT   gene            473794..474999
FT                   /locus_tag="Vdis_0494"
FT   CDS_pept        473794..474999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0494"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR016196:IPR018170:IPR011701; KEGG:
FT                   cma:Cmaq_1185 major facilitator transporter; PFAM: major
FT                   facilitator superfamily MFS_1; SPTR: A8ME06 Major
FT                   facilitator superfamily MFS_1; PFAM: Major Facilitator
FT                   Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49893"
FT                   /db_xref="GOA:E1QUG7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUG7"
FT                   /protein_id="ADN49893.1"
FT                   /translation="MDIVDKRNARWILTLLPYSVAIGPLGTLITLEIASLRGGPVDVGY
FT                   AMAAGSAAGIIAPLLWGFLLDRYGSRDVLALGFLGTALFILALTYAPNVPQITLYYAAS
FT                   SLFSSAVGVSTSFILVKSSSRLRLNESYSMLNFINSMGYLVGDVSAAVLSGFMDIKAIL
FT                   LIMGLLPIISFAWSLVSVPRVSNGEGPVLSRQLVSGRVRDVGLGELVTLYLALVIFYFS
FT                   SGIFNTLYPYGLRVGGLSRSWVMTIISVGMGIQIMGFMITPRIIRLFGGNARASSRALI
FT                   LRGLSYFLIGLTSTTPEAMMITGLTLYPLAAGIAFSTFYTASSVMVFERLGSGEEGRGL
FT                   GAYNFITGSAYLAGSLTSGYLADSIGIGGSYMVAGAMLWVSSYLFEQMHRSEGVRRILN
FT                   PH"
FT   gene            475101..477014
FT                   /locus_tag="Vdis_0495"
FT   CDS_pept        475101..477014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0495"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="COGs: COG2414 Aldehyde:ferredoxin oxidoreductase;
FT                   InterPro IPR001203:IPR013983:IPR013984; KEGG: pas:Pars_1164
FT                   aldehyde ferredoxin oxidoreductase; PFAM: aldehyde
FT                   ferredoxin oxidoreductase; Aldehyde ferredoxin
FT                   oxidoreductase; PRIAM: Aldehyde ferredoxin oxidoreductase;
FT                   SMART: Aldehyde ferredoxin oxidoreductase; SPTR: A4WK18
FT                   Aldehyde ferredoxin oxidoreductase; PFAM: Aldehyde
FT                   ferredoxin oxidoreductase, N-terminal domain; Aldehyde
FT                   ferredoxin oxidoreductase, domains 2 & 3"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49894"
FT                   /db_xref="GOA:E1QUG8"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUG8"
FT                   /protein_id="ADN49894.1"
FT                   /translation="MTIKGVNGVVGFVNLSTGEIKKIQVPDEVYRNFLGGYGLGVWFLY
FT                   THMKPRVDPLGPDNILGIISGLLNASGIPMTGRSMAVGKSPLTGGWGDSNAGGRFGPKL
FT                   LEAGLDAIFVTGVSEKPVYILIDNGDIHIESASDLWGRNTRETEDELRRRYRGAQVVSI
FT                   GPAGERLQLIAAIINEYGRAYGRSGLGAVMGSKKLKAIVAVGDKKPEIHDRDLLRQKIK
FT                   EMLDALKTTRARAYEIWHKYGTISTLDTSVLSGDTPIKNWAGIGVRDYGTKNLERFGTN
FT                   TVIQDNIKPYGCASCPVSCGAWIRRNTRYGLVDMGHRLEYETASLFGPALLNADQDSVV
FT                   YVGELCNMYGLDTISTANVVGFAFELYEKGILTEKDVGFPLRWGDPDAVVKLVELIGKA
FT                   ESIGKVLGQGVKRAAEIIGRGAEQYAMHVGGQELPAHHPQFLPGLAITYTADPTPARHT
FT                   AGGVHWWGEGGKRLWAPFDVGLDLGASPKYDYGDKGRKAAIIAMSTQVENSLGFCQFAS
FT                   QVIYRTLPYIDLIYAVTGMKYTPQELLKVGHRIHTLRQLFNVREGVNPKKDFKLPRRVL
FT                   EPFPEGPLAGVKLTEEDVERMREQYWETLGWDPSTGYPRRRTVEELGLAEIAGDIINIL
FT                   PP"
FT   gene            477073..477939
FT                   /locus_tag="Vdis_0496"
FT   CDS_pept        477073..477939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3276 Selenocysteine-specific translation
FT                   elongation factor; InterPro IPR009000; KEGG: cma:Cmaq_1182
FT                   hypothetical protein; SPTR: A8ME03 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49895"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUG9"
FT                   /protein_id="ADN49895.1"
FT                   /translation="MLRGSIITVLSTNEQEAFRVASMLGKRDRGEERVYYRKVGELVRS
FT                   ILIPSPNSVLDEAIALSISSSFYFRVNNEVTWLDGEKALLLEASGIPGVVLADDTNLFM
FT                   KYFGELGISRFISEFREFDVEVPDRGLVYVDRAFNVKGVGVVVLGYALTQVSIHDKFIA
FT                   YPMNLEVEVRSIQVLDEDQDSVMPGTRVGLALRNVRLEDIEGIQALIRPGTRFTNSING
FT                   FTRFRWSDDAREVHVIFNGIKVMGKIEGNGITLTRELPMASGRALIVNVNAKPRRPRII
FT                   GYAIINA"
FT   gene            complement(477929..479548)
FT                   /locus_tag="Vdis_0497"
FT   CDS_pept        complement(477929..479548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0497"
FT                   /product="coenzyme A transferase"
FT                   /note="COGs: COG4670 Acyl CoA:acetate/3-ketoacid CoA
FT                   transferase; InterPro IPR004165:IPR014388; KEGG:
FT                   cma:Cmaq_0421 coenzyme A transferase; PFAM: coenzyme A
FT                   transferase; SPTR: A8MBS3 Coenzyme A transferase; PFAM:
FT                   Coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49896"
FT                   /db_xref="GOA:E1QUH0"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUH0"
FT                   /protein_id="ADN49896.1"
FT                   /translation="MGKVVDVNVALDVIRDGDVIAVSGFNMATTPEYLLIRLYERYKET
FT                   GHPRDLFIVTDTLPASRGRALDLIAERMIRDNDFGFIRGFMITFFGVAPSLQRLVIENR
FT                   VEAYSFPIGVATRWFRSVASGVPTITKVGLGTFLDPRQDGIYLNGLARERRTCRVELIS
FT                   INGDEYLLYDCPKPRVGLIRGSTADEFGNLTMSEEAIYGSVLAITQAVKAQPNPGVVIA
FT                   QVLYVSRFVNPRDVHVPGPLIDYIVTSPPEYHTQSASVRYDPSICGRVVVSNACLPNND
FT                   KPNFEYVIARRVVLEFVRLIEKLGRPIAVNLGIGIPALVAKIIRSEGVDDYIVTTVESG
FT                   PWGGIALSDDDFGVAISPKAILPMPDQFIMYEGGIIDAASLGFMQVGPNGDVNPSFLPE
FT                   RVTGPGGFPVIVHGSPRLYFAGAFTAGKRDIAVVNGRLTIIRDGQIIKFIKKPYKVGFN
FT                   AELGLKMGKEVLYITERAVFRLTGEGLVLEEYAPGVDIERDILAKMEFEPIVSRHLQPM
FT                   DDAVFRDGPMGLLEVVEKAVRR"
FT   gene            479739..479826
FT                   /locus_tag="Vdis_R0008"
FT   tRNA            479739..479826
FT                   /locus_tag="Vdis_R0008"
FT                   /product="tRNA-Leu"
FT   gene            479975..480904
FT                   /locus_tag="Vdis_0498"
FT   CDS_pept        479975..480904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0498"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="COGs: COG0421 Spermidine synthase; InterPro
FT                   IPR001045; KEGG: cma:Cmaq_1107 spermidine synthase; PFAM:
FT                   Spermine synthase; SPTR: A8MDS9 Spermidine synthase;
FT                   TIGRFAM: spermidine synthase; PFAM: Spermine/spermidine
FT                   synthase; TIGRFAM: spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49897"
FT                   /db_xref="GOA:E1QUH1"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUH1"
FT                   /protein_id="ADN49897.1"
FT                   /translation="MSLEKVSKEGTWFIEFNTPFSYHVRGIRRVLYSGVTKYQRVAIVE
FT                   FEDLGKALVLDGKIQSSLYDEFVYHESLVHPAMITHPNPRRVLILGGGEGATAREVLKH
FT                   RSVEKVIMVDIDDEVVRLVKEYLPEMSQGVFDNPRFKLILQDGRKFLEESGDKYDVIIL
FT                   DLTDPLEGGPSYLLYTIEFYSIVRDRLSDDGIMVTQATSTSYSLRTFATIYRTVASVFP
FT                   ITRAYQVYMHSYDSTWGFVIGSKKYDPAILTPDEVNNRIRERISGELKFYEGDIHRAIF
FT                   VLPKHIRAVLSDESIKPATDKNPTFLPA"
FT   gene            481011..482342
FT                   /locus_tag="Vdis_0499"
FT   CDS_pept        481011..482342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0499"
FT                   /product="aminotransferase class-III"
FT                   /note="COGs: COG0160 4-aminobutyrate aminotransferase and
FT                   related aminotransferase; InterPro
FT                   IPR015424:IPR005814:IPR015421; KEGG: sto:ST1114
FT                   aminotransferase; PFAM: aminotransferase class-III; SPTR:
FT                   Q972L8 441aa long hypothetical aminotransferase; PFAM:
FT                   Aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49898"
FT                   /db_xref="GOA:E1QUH2"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUH2"
FT                   /protein_id="ADN49898.1"
FT                   /translation="MSSEDVSKVVREHLFGTWRRQRGWEPMNIVKAEGVYFYDSQGKRY
FT                   LDFSSQLVNVNLGYGNENVINVIKRQLEALQYISPAFATEARARAARALLGIMPEGLTK
FT                   FFFSTSGTEANEAAVKIARLFKRPAYKIIVRYRSYHGSTFASISMTGDYRRWFIEPHTM
FT                   HGVVRVPEPYCYRCPLGLKYPECGLACVNYVDYVIKNERNVAAILIEPITGTNGVVVPP
FT                   KEYLPTLRRIAEENDVLFIADEVMTGWGRVGDWWAVNLWGVRPDILTTAKGASASYVPI
FT                   GITAVSRKIADYFEDEFFAHGHTFEAHPVSLAAIPAVIEEYRRLDLLSHVRAMGEYLAK
FT                   RLEELKERHRSIGDVRGVGLFWAIEFIKDSRKTPFGTYEDKYRGVATPVDKVAAELLSM
FT                   GVYVFNGPSWFIIAPPLVITREQIDEGIEKIDQAIKRLDEQYQG"
FT   gene            complement(482357..483217)
FT                   /locus_tag="Vdis_0500"
FT   CDS_pept        complement(482357..483217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0500"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro
FT                   IPR018181:IPR013216; KEGG: pai:PAE3217 hypothetical
FT                   protein; PFAM: Methyltransferase type 11; SPTR: Q8ZTJ8
FT                   Putative uncharacterized protein; PFAM: Methyltransferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49899"
FT                   /db_xref="GOA:E1QUH3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUH3"
FT                   /protein_id="ADN49899.1"
FT                   /translation="MNREVKVEGDDQSSSYESIISTVYDELAPIYERVFLRLSQYYRHV
FT                   YNELYEIFRDYFDGVKIHSKVLDLGSGTGVWTMLLRKRGYHVVSLDISRASLIKCTRSR
FT                   RCSDPVQGDAIKLPFRDGYFDAVIAYGSVFNHIVKSEDAFREVSRVLSSGGYLLFDVDN
FT                   LICPDMAYEALLGGVSIRGFLRGLISGRGHVGYWYGHGNEAVPLRFFTIKEILSILGSY
FT                   GFEVVDLKGIHVLSNIIPSRIHQWGNGKIARVASLLYTFDKVLSRRTPFKYVATTFLII
FT                   GRKLN"
FT   gene            483379..484137
FT                   /locus_tag="Vdis_0501"
FT   CDS_pept        483379..484137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_0370 hypothetical protein; SPTR:
FT                   A8MBC6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49900"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUH4"
FT                   /protein_id="ADN49900.1"
FT                   /translation="MSQGTIEERVKRGLLLVNACDSNRITCRLLGGVAVVYLVRDIYAE
FT                   VPMLLREPKDIDIAAHRRDSGRITRIFEGLGLRADVRFNALHGAERLRFFDTQMNTRVD
FT                   VFLDIFRESHVIELKDRLERFSPTIPPSDLLMTKFQIWEINEKDLRDIVAMLYKFELGD
FT                   RDDTGTIDLGRIIELTSDDWGLYKTTTVNIERTLNYLNTIELPGKVKDKVVNSLNRIRE
FT                   AMDRAPKSMKWRMRAAIGERVRWYETPEEA"
FT   gene            complement(484161..485384)
FT                   /locus_tag="Vdis_0502"
FT   CDS_pept        complement(484161..485384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0502"
FT                   /product="ATPase"
FT                   /note="InterPro IPR011579; KEGG: tne:Tneu_0120 AAA ATPase;
FT                   PFAM: ATPase; SPTR: B1YAA4 AAA ATPase; PFAM: Archaeal
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49901"
FT                   /db_xref="GOA:E1QUH5"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUH5"
FT                   /protein_id="ADN49901.1"
FT                   /translation="MPSRLSVGVNIDELINRVKEGGAYFGVEELGGFPMIFRDREREVK
FT                   ALLRELGGVGIVYGPLGCGKSTFLRNFSAALGGVRDDVIAMYVNLEERTLANSLRTYAI
FT                   GLGSDVRNAVVKAFNSNIMPIITGTEPGLLVGISRFFYDLINELKVRRELRDKYVVLVF
FT                   DELDKRYRAMLNVGDDAQVGYGVVEGEVMAYAGAIEEHSSVIYDNVRGLVVIFGFSNRV
FT                   AVDIARRGGSKGGLNSLLLWYLPKEEFIGIINDVSRRAPPSKPIDVEVLWQLLGGNIRE
FT                   LAMLVLRYGWDVNAWLSSTVIRKVRDVIIHEVRIRSLEVNALLSRAIDPSPRNAYLHLG
FT                   GDYLMRMNILIDIYGTVLSELPREPWVDSDFAYQLPAYYWALKAMIDKSTVDINPEDVI
FT                   DEVTGGHR"
FT   gene            485502..485870
FT                   /locus_tag="Vdis_0503"
FT   CDS_pept        485502..485870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vok:COSY_0659 multicopper oxidase; SPTR:
FT                   A5CWB5 Multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49902"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUH6"
FT                   /protein_id="ADN49902.1"
FT                   /translation="MAQEDRACSIERLLLRFLTYDEVGLTTLYGNTRIFIMGIPVIEGF
FT                   IGSNRVFLSSQEFIVNITRVGNYVIAYVSGIELTMNVESMSVKTGIAHLVGTITVQYYY
FT                   STNINETNTIIIRLTPRQ"
FT   gene            complement(485872..486312)
FT                   /locus_tag="Vdis_0504"
FT   CDS_pept        complement(485872..486312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0504"
FT                   /product="protein of unknown function DUF86"
FT                   /note="COGs: COG2445 conserved hypothetical protein;
FT                   InterPro IPR008201; KEGG: ate:Athe_1667 protein of unknown
FT                   function DUF86; PFAM: protein of unknown function DUF86;
FT                   SPTR: B9MKA3 Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49903"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUH7"
FT                   /protein_id="ADN49903.1"
FT                   /translation="MGCVGRLSDLLAIIKRNVEEVDTLASRYGTDELLNDYVLLNAVLH
FT                   MLQVAIQALIDMGSHIMVERGLKAPSTYSEVPIYLSQAGAINSDDSRIFRRMIGFRNVL
FT                   VHNYSQVSIDVLREILARALYRDLLRIAIKLFDYAVSNNIDV"
FT   gene            complement(486287..486751)
FT                   /locus_tag="Vdis_0505"
FT   CDS_pept        complement(486287..486751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0505"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="InterPro IPR002934; KEGG: pai:PAE1951 hypothetical
FT                   protein; PFAM: DNA polymerase beta domain protein region;
FT                   SPTR: Q8ZW65 Putative uncharacterized protein; PFAM:
FT                   Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49904"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUH8"
FT                   /protein_id="ADN49904.1"
FT                   /translation="MGACSEQCLRVLGVVRDIIINNNYKDFIQFAVLYGSLVYGVFGPL
FT                   SDVDVAVLFRDGVDIVDVLPMLISDLALALGVPEDRVDVAVLNDPLLPFEVRFRALAQG
FT                   VPVYIGDRGVFIREVVRAISLYGDYQVFLRVNGFNELIKRRIGGLRGSIK"
FT   gene            486846..488303
FT                   /locus_tag="Vdis_0506"
FT   CDS_pept        486846..488303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0506"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcl:Pcal_0090 hypothetical protein; SPTR:
FT                   Q96X88 Putative uncharacterized protein ST2622"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49905"
FT                   /db_xref="GOA:E1QUH9"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUH9"
FT                   /protein_id="ADN49905.1"
FT                   /translation="MVGRINTKALLIMIIIALVITDAYLIYTYLLAPPLPYVKVLGYYG
FT                   DYDVASVYKGILVLYEVSLASINLKGVNITSGRYVWMDTIYIPGLLPLIRFIPIGNKLF
FT                   VATYSLYGGIHDDQESPIVANVTMINIFTGKIINYTVLVAVSSTRYYMAMDAIGEDVYV
FT                   VIIPLSDPLRPVNTTIIDLRLLGREPYGVEVWRTEVVNSCIPLSIVAMGIKRFGNYVLV
FT                   TVSCNNKPLTYVLNASNGKLMLRADVGSDVYGIAGDTLIYQCGGKICGLDFISNRTWVL
FT                   PIIGSVTSVTVSGDKALVLTTTGYTIWAYGISSNGSLLFRRELWTYTAPLMLCSVGLRY
FT                   TFMAKSYPIRDYALIIILPEGIWYISGGGFGCMPQSIVILNLSNGHVVISVTKPAWIAY
FT                   LYAYPYSFNNLWQALDINYLSNDYVVYSINNAPNSRTFHHQYNYYLTTPKAITNEWWYY
FT                   LINDTPYIALATTALLIALAIFYKKLH"
FT   gene            488318..489790
FT                   /locus_tag="Vdis_0507"
FT   CDS_pept        488318..489790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0507"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: baf:BAPKO_0615 hypothetical protein; SPTR:
FT                   B9X8C6 Mate domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49906"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUI0"
FT                   /protein_id="ADN49906.1"
FT                   /translation="MGGQLIRKALLIAIIALALLEGYLVYMYVFGSPFPYIGTLSIGPY
FT                   QLIAVRNNEVILYGEYSPPSFRTLITEIIIKGVNMINGRTLWMTNVVSSSLISPLIAFS
FT                   LVNNDLFLITYGQYVYHIDKWIIAETTINATVINALTGNVISSTAIEATPYVAVLNVIN
FT                   NHVYILIFPPSTNSMIITYYKLSDSPPYITLAWNQTLTNVCGPYGSAVVVGIHEGIKYV
FT                   LMTIPCNKAIRIYLLNRINGRVVRSIFIKSPLGVTRVYGVINDTVIYLCGPRICGTNMV
FT                   TNETWSIPIMGYLTSVTTYGDKAIILMMSNNTLIMSTVASNGTVLVSRAIWSYKPPWCA
FT                   PSYAVEIYSFSAGAIHLVGNYFLVLAGPFALTYTASGYVCLPEAMIIVNAGNGKVITRI
FT                   TRSTWSGISGDLGPNLYIDYTSNNTIIYTQCQLGHCTTYETTPRTLIKDQWYYAITDTP
FT                   YPTITTTTLLIASTILYETTKENKIQRNKTNF"
FT   gene            complement(489800..489961)
FT                   /locus_tag="Vdis_0508"
FT   CDS_pept        complement(489800..489961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0508"
FT                   /product="Ribosomal protein S30"
FT                   /note="InterPro IPR006846; KEGG: tpe:Tpen_0362 30S
FT                   ribosomal protein S30e; PFAM: Ribosomal protein S30; SPTR:
FT                   A1RX41 SSU ribosomal protein S30E; manually curated; PFAM:
FT                   Ribosomal protein S30"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49907"
FT                   /db_xref="GOA:E1QUI1"
FT                   /db_xref="InterPro:IPR006846"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUI1"
FT                   /protein_id="ADN49907.1"
FT                   /translation="MCLSHGSLTKAGKVRSQTPRIPPKPKKNLIPRRRNSRNYRRLLYR
FT                   LGQGQQVS"
FT   gene            490100..491686
FT                   /locus_tag="Vdis_0509"
FT   CDS_pept        490100..491686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0509"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cha:CHAB381_1520 hypothetical protein; SPTR:
FT                   A7I3G2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49908"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUI2"
FT                   /protein_id="ADN49908.1"
FT                   /translation="MMEHSSSNYVNDIEMIIHDYNDKTLDIQELHNLLSALRQLITNNW
FT                   DYIKNIYARDSVRNSKLGSLMYPTDIHLKVGIASDSNTLINNDKAIPLLSGFFISDATL
FT                   IRDKNKVTALAINTPDPSLATSFIFTLLSYSGKNYVKDYISVILIEGKNKKSVSFKHII
FT                   SDNAKFLEKFSIYLVTKDDIYQLIDINHNLITSELKDWLKWTLNNWDNPHYYIILRKQL
FT                   KFVKYSINGLLTRDSIFTWYLGDGVRGHFNRGAFDIGLSFITDPLIFKFMNRFLCTLYN
FT                   CDSKFFGGHGARNSEHYIVCPVKAEVIKDIVEWAGKWPKYGLTQRVLDLLEAIKYGKLC
FT                   EGYRKWPTIDIDGFELIIRKHNMGNRWYLTKSAASKEYLDAIAALLKQKFEINANIREN
FT                   KWGYELYVSIEDTRRILRMLGVYERFYGEPRRLPSVDDVIGVLRRYGIRRWHVHEARAR
FT                   NGNGYEYTEACVLISLGDSGEAMRLRDELVGLGVRVRKVVWGTVIVCRTEDRLLLTKAL
FT                   STMGLGGVDST"
FT   gene            complement(491692..492045)
FT                   /locus_tag="Vdis_0510"
FT   CDS_pept        complement(491692..492045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR009007:IPR001969:IPR001995; KEGG:
FT                   cma:Cmaq_1783 hypothetical protein; SPTR: A8MAX7 Putative
FT                   uncharacterized protein; PFAM: Retroviral aspartyl
FT                   protease; TIGRFAM: conserved hypothetical protein
FT                   TIGR02281"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49909"
FT                   /db_xref="GOA:E1QUI3"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUI3"
FT                   /protein_id="ADN49909.1"
FT                   /translation="MRHVWVNARIGSVDLSRVIEVKALVDTGATLTVIPRSLANELGLV
FT                   ITGKSRVETGAGVIKVDRSRAWVEVEGRGEVVPVLVSDVIDKVLIGVTTLEVLELEVDP
FT                   VTGRLRERTLLLY"
FT   gene            492100..492516
FT                   /locus_tag="Vdis_0511"
FT   CDS_pept        492100..492516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0511"
FT                   /product="HEPN domain protein"
FT                   /note="COGs: COG2250 conserved hypothetical protein related
FT                   to C-terminal domain of eukaryotic chaperone SACSIN;
FT                   InterPro IPR007842; KEGG: tpe:Tpen_1687 HEPN
FT                   domain-containing protein; PFAM: HEPN domain protein;
FT                   SMART: HEPN domain protein; SPTR: A1S0V2 HEPN domain
FT                   protein; PFAM: HEPN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49910"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUI4"
FT                   /protein_id="ADN49910.1"
FT                   /translation="MAVDRLSEAERWLRQSLRDLDAARGSLAGGYYEWACFQAQQAAEK
FT                   AVKALLHGLGVGAWGHSIVELLDMLRDRYNIEGLMPLARELDRHYIPARYPNSFESGYP
FT                   AMYYDNEVAERAIKAAEAIITWVRERLRELGLAT"
FT   gene            492474..492884
FT                   /locus_tag="Vdis_0512"
FT   CDS_pept        492474..492884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0512"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="InterPro IPR002934; KEGG: pfu:PF0772 hypothetical
FT                   protein; PFAM: DNA polymerase beta domain protein region;
FT                   SPTR: B7R4Q4 Nucleotidyltransferase/hepn domain protein;
FT                   PFAM: Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49911"
FT                   /db_xref="GOA:E1QUI5"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUI5"
FT                   /protein_id="ADN49911.1"
FT                   /translation="MGEGETKRAWLSDLRKYVSDISSAIPVEAIILYGSAARNLNGSWS
FT                   DIDVLVISDAFRGIPIPDRISLLLRFKRGRIEALGYTFDELVRMVNAMNPLALNALIEG
FT                   RIIVGSDRVRKLAEETRKRFIRRGRAWFMIPG"
FT   gene            complement(493000..493980)
FT                   /locus_tag="Vdis_0513"
FT   CDS_pept        complement(493000..493980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pis:Pisl_1375 hypothetical protein; SPTR:
FT                   A1RUA5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49912"
FT                   /db_xref="GOA:E1QUI6"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUI6"
FT                   /protein_id="ADN49912.1"
FT                   /translation="MNKRGLIIILSVAALFAAVLLTYLLPLYYEPAYLTVKLIFPVTKY
FT                   PNGTTVVNPVLQFVNGGLAVLMLPNGSQYVFNITSVNGFMSLYRVMPQAFIKLSGSKAI
FT                   VLIIPNAFRGWVRVRGVNVTLTYYFYNYTVINGSSLELTYLLDNQVLQELNKTDPSLLK
FT                   YVPYAINVLLAKPSEYGDNIIETAAIKWILKDMLGLILAKSDQYVQYETDCVLNIYWAT
FT                   GWINVGGIPGYTFYNKITIGGQVWSGRGNLAAPQIPFSPPVSFVQVKESTGFYFGINEN
FT                   GYGIYGQVATGSVTWDLYPAGIYYVTSGTAILNSPSSSGWLSICG"
FT   sig_peptide     complement(493930..493980)
FT                   /locus_tag="Vdis_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            494407..494751
FT                   /locus_tag="Vdis_0514"
FT   CDS_pept        494407..494751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0514"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Tmem63a; transmembrane protein 63a; SPTR:
FT                   C4LXG0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49913"
FT                   /db_xref="GOA:E1QUI7"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUI7"
FT                   /protein_id="ADN49913.1"
FT                   /translation="MGLVCLDPHYSYCFSVIGFALITKFLRDDDAEFGLNFRRVLLQSL
FT                   VYLALCLVMPVGELGFIYDVTGFPLRLSTSAPTSNDSAVLYTATHVPVIIITLIPIYAF
FT                   AATRGVYAVP"
FT   gene            494793..496067
FT                   /locus_tag="Vdis_0515"
FT   CDS_pept        494793..496067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pis:Pisl_1481 hypothetical protein; SPTR:
FT                   A1RUK5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49914"
FT                   /db_xref="GOA:E1QUR1"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUR1"
FT                   /protein_id="ADN49914.1"
FT                   /translation="MVVVLRRLSLEDYGPFTKLDIELGDITIFVGRNNTGKSTALEAIT
FT                   LLLSSINNFRVITSSIDVLSNLGLRSRYLINLRSNKGVAVVSGDVVSQGMKHSIEVRVI
FT                   RGINGLGDLRDNAVREIIRSITELTPTSQKILIEAFRRVLRERKDGKDITEAFKEFVDG
FT                   VISVLSNRVDDVLVNAVFVSTYVDGELLNAALLPLSEVRVSEDIIGKLKELGLSSSEAR
FT                   RLLNIQLGKVISGGRIILTSKKLSVEPIRVQHLSLHPFLIDDLPPDKQTELIDLLRKEV
FT                   RYFYDYRGGQVILNFDGSRVSVPYALMGDGFKALVRMLGLIVMGVDVTLIDEPEAHLHP
FT                   GFMEVITKYMVEPRFLDRIQFVMATQSLEFLDYLLRAAEKGGVLGRVKLVRLYLMPNGS
FT                   IDYEQLSGEEAYEEMDELKSDLRGP"
FT   gene            496024..496686
FT                   /locus_tag="Vdis_0516"
FT   CDS_pept        496024..496686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0516"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_1697 hypothetical protein; SPTR:
FT                   Q083L7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49915"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUR2"
FT                   /protein_id="ADN49915.1"
FT                   /translation="MKRWMNSSQTSGVPSHALIILCEGKHDYEFIKELISKINVKCDVK
FT                   DQDPRDKDFIIRHIVDGKRLSYVPVIIEGGKDRLDGNVRLLISKLRSVHGSSTWVLILR
FT                   DSDSNDADSAFDKLRRNIVSLINNPLKFSLYKPSMNCGQGIRVGSFVYYDCVLRYMDGD
FT                   VYFRFIFVVPSLEDFLRDYGYGDSRLHSAIDKALNDPRNNDVVDIFKSLLGSCLFDE"
FT   gene            496679..497077
FT                   /locus_tag="Vdis_0517"
FT   CDS_pept        496679..497077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_0418 hypothetical protein; SPTR:
FT                   C3NA25 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49916"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUR3"
FT                   /protein_id="ADN49916.1"
FT                   /translation="MSSRVLAHGIRAVFPAGFDSVANAVRDYDPASNVYFTVLSTSPRV
FT                   AVAFGQKFFFRIGHYLSCMTLVIERDSETEVRIIAHSGLQLSALSNYGANVDYARDVLD
FT                   RLSKSLGVDPRDVVEVDYMDVTKSQQLG"
FT   gene            497164..497414
FT                   /pseudo
FT                   /locus_tag="Vdis_0518"
FT   gene            497482..497985
FT                   /locus_tag="Vdis_0519"
FT   CDS_pept        497482..497985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0519"
FT                   /product="Protein of unknown function DUF1288"
FT                   /note="InterPro IPR010709; KEGG: cma:Cmaq_0381 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF1288; SPTR:
FT                   A8MBD7 Putative uncharacterized protein; PFAM: GINS complex
FT                   subunit Sld5"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49917"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUR4"
FT                   /protein_id="ADN49917.1"
FT                   /translation="MGFSYLMPSVRAVLTRDVDGVDLGIISIAPAKAGSVINAPPNVLE
FT                   VLIKRGVASLLDEDRVGNEEILKRVWLENRAPSELRELPRDFYVRARLSMVGGDQKSVR
FT                   IYAQQLRELAQLRLRKILTLLSVNPSIADSRDFLDKLTIEEEELVKSIAPIIKEFLNAV
FT                   VGLQ"
FT   gene            497982..500045
FT                   /locus_tag="Vdis_0520"
FT   CDS_pept        497982..500045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0520"
FT                   /product="MCM family protein"
FT                   /note="COGs: COG1241 ATPase involved in replication control
FT                   Cdc46/Mcm family; InterPro IPR016027:IPR001208:IPR012340;
FT                   KEGG: cma:Cmaq_0382 MCM family protein; PFAM: MCM family
FT                   protein; SMART: MCM family protein; SPTR: A8MBD8 MCM family
FT                   protein; PFAM: MCM2/3/5 family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49918"
FT                   /db_xref="GOA:E1QUR5"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUR5"
FT                   /protein_id="ADN49918.1"
FT                   /translation="MTTPETAEVSLDSLIQGLRGFIESSDKYVDEINNMIIQRKRSLVI
FT                   DFHDLLISSKDLADMLLERPQLIIQAGSEAVRQAITERDPELAKSVRNFYMRFRRLPES
FT                   LPIRRLRSEVLGKLIMVEGIITRQTPPKHYLRKSVFRCSQCGYEVEIPQPTTGFVQPPK
FT                   RCPKCGALNSMVFVEERSEFIDWQKIIVQEKPEELPPGQLPRSIEAILLDDLVDTVKPG
FT                   DRVYLVGIMNLDLSDLKKGRPPVVSSFMEVNYVESQQRELVEIEITPEDEKRILELSKM
FT                   PDVRERIIKSIAPSIYGMEDIKEAIACLLFGGVPKVYPDGIRVRGDIHILLVGDPGMAK
FT                   TQLLRFVTKIAPRAVYTTGKGSSAAGLTAAVVREKDTGEFYLEAGALVLADTGVAVIDE
FT                   IDKMDAKDRVAIHEALEQQTVSIAKAGIVATLNARCSVLAAANPAFGRYLPNRTVAENV
FT                   DLPVTLLSRFDLIFIIRDEPNLDRDKAIAEHITTLHAGEVPEGFADIVPPDLLRKYIAY
FT                   ARKHVKPVLTPEARERIVQFYVQMRAKSREPDSPIAITARQLEALIRLSEAEAKMRLSP
FT                   VVEAEDADRAIRLFMKYLSSVGIDVESGKIDIDIIMTGKPKSAQERMALIMNLLAQLEE
FT                   SSGGKPVKIEDLYKEAEAAGLDRQAVDKAINMLLKSGDIYMPKPGYVKRVLI"
FT   gene            500100..500468
FT                   /locus_tag="Vdis_0521"
FT   CDS_pept        500100..500468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_0659 methyl-accepting chemotaxis
FT                   sensory transducer; SPTR: Q2L203 Putative bifunctional
FT                   protein,oxidoreductase/cytochrome subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49919"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUR6"
FT                   /protein_id="ADN49919.1"
FT                   /translation="MIDRLNAIITGLRNAVTLTVEKLLERLKETNIDVPEERTIGDWGW
FT                   SVISKAMEVGIISLSDADIDAMYYVFRRCATLEEMVKEALARPEEIDENFVNNLMDDFR
FT                   ENAEALARVRERINQLVS"
FT   gene            500597..501697
FT                   /locus_tag="Vdis_0522"
FT   CDS_pept        500597..501697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0522"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="COGs: COG1144 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase delta subunit;
FT                   InterPro IPR017900:IPR001450:IPR017896; KEGG: sso:SSO2128
FT                   pyruvate synthase delta chain (pyruvic-ferredoxin
FT                   oxidoreductase delta chain) (PorD-like); PFAM: 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; SPTR: P95902
FT                   Pyruvate synthase delta chain (Pyruvic-ferredoxin
FT                   oxidoreductase delta chain) (PorD-like); TIGRFAM:
FT                   2-oxoacid:acceptor oxidoreductase, delta subunit,
FT                   pyruvate/2-ketoisovalerate family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49920"
FT                   /db_xref="GOA:E1QUR7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUR7"
FT                   /protein_id="ADN49920.1"
FT                   /translation="MSVQAPSIYTIEIIYRGIHQRHLARNLSRGIVYAARMAGNVALSY
FT                   QRYGDDPERDGVPAKYFVVVAKGANEEILDAEAARVEPDYVDVSIVLDDTILKGVESWA
FT                   WQGIQPVHLKLRAGGLLIVVSKRSPDELLKFIPTRDSPYTLVVVYGERSIGDFWTFPDD
FT                   GTVERVLGAIAKVMPNVLTIDDVKRYLESLDKPSERVNRALEAYQSLVKLREVKPGEGL
FT                   PYKYEPPHLPGWKDMMIGGAIPGLKPNQRNPYFTGGTAKHYRPVVNFDKCIKCSLCWEY
FT                   CPDSVFDVTPDGYFNPVLAYCKGCGVCAEVCPVPDTIIMVDEMEFEDGYGKFIDEYRAW
FT                   KENREAYRKWFESLLPKAQIISVRKR"
FT   gene            501704..502951
FT                   /locus_tag="Vdis_0523"
FT   CDS_pept        501704..502951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0523"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="COGs: COG0674 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase alpha subunit;
FT                   InterPro IPR009014:IPR002880:IPR015941; KEGG: mse:Msed_1200
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain-containing protein; PFAM: pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain protein; SPTR:
FT                   A4YG09 Pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; PFAM: domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49921"
FT                   /db_xref="GOA:E1QUR8"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUR8"
FT                   /protein_id="ADN49921.1"
FT                   /translation="MSVSALETKRLEAVLKGDEEVEVVGTGTDAVAYALMLADVDVTSA
FT                   YPIRPYGGVMQTVAKLIADGYMKAEYIVAAHEHDQFEIVKHASAVGARTFVGSSGVGWL
FT                   LAIEAIVAISTDRYPVVALIGNRALDDPGAYGVEHNDALMVRDVGWLLVWVDTAQEALD
FT                   TTLIAYRVAEDPRVMLPVGISMDGAFLTHSEHVFRIPPKSKVQKFLPPYDLGNRKLHPS
FT                   NVISVAPQVNEDWVTEIRKQMDEAMKNARKVIEETYRDFAKIFGRDYGNPFVEPYMVED
FT                   ADVVMVGMGTVSKPIKEAVRRLRAKGERVGFLRIRWFRPFPTEDIIRYLSGVKVVAVVD
FT                   RDYSFGSPFDGGAVFTEIRSALYESERRPLMMNFIGGLGGREITYNDAINMFNMALDAA
FT                   RKGKVEQRVIWYGVRE"
FT   gene            503000..504022
FT                   /locus_tag="Vdis_0524"
FT   CDS_pept        503000..504022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0524"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="COGs: COG1013 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase beta subunit;
FT                   InterPro IPR011766; KEGG: sso:SSO2130 pyruvate synthase
FT                   beta chain (pyruvic-ferredoxin oxidoreductase beta chain)
FT                   (PorB-like); PFAM: thiamine pyrophosphate protein domain
FT                   protein TPP-binding; SPTR: P95904 Pyruvate synthase beta
FT                   chain (Pyruvic-ferredoxin oxidoreductase beta chain)
FT                   (PorB-like); PFAM: Thiamine pyrophosphate enzyme,
FT                   C-terminal TPP binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49922"
FT                   /db_xref="GOA:E1QUR9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUR9"
FT                   /protein_id="ADN49922.1"
FT                   /translation="MTISIKLARTVKDLLMMAQTEYFDAGHRTCQGCESAMVLRWVAKA
FT                   AGPNTIVIGATGCMYVANTTYYTTAWALPWIHTQLSGTGSAVVGTAAALKALIEKGKLP
FT                   NEKINVIGICGDLGCADAGLSEVSNALTHTKYNFLILMYDNESSANTDIQETTMTPYGA
FT                   LTTFSPSGKQVRIMKYRWKKNMAAMMAVGHPEVRYVATATAADPIDLYNKVKKALEIGG
FT                   PTFIHTLDPCPKGWGYDPKYSHEIGRLAVETGIWPLFEIEDGKFRLTSTSARIASGEIK
FT                   RKPVKEYLRRQTRFKHLTDEDIEYIQKKVDEMWEKWLIPGLIPLTRELPYPEVTKASTK
FT                   "
FT   gene            504268..505542
FT                   /locus_tag="Vdis_0525"
FT   CDS_pept        504268..505542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0525"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR016196:IPR011701; KEGG: dda:Dd703_2503
FT                   major facilitator superfamily MFS_1; PFAM: major
FT                   facilitator superfamily MFS_1; SPTR: C6C981 Major
FT                   facilitator superfamily MFS_1; PFAM: Major Facilitator
FT                   Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49923"
FT                   /db_xref="GOA:E1QUS0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUS0"
FT                   /protein_id="ADN49923.1"
FT                   /translation="MTGGSQLTDKQILGFSRWFAFIGAFLAMFMISPYEYAFSAFSHDV
FT                   TQFFHIGAVFLGTVFTVNVFLESVFGWPAGFVRDRYGPWFLQLIAAFLVGIGYFAAIFG
FT                   SPALLLWVYAIIGGIGAGIVYNNSVTVANKWFPDYRATVAGTISAGFSWGSIPIILLIG
FT                   VLPKMHPIAVFKSIMLGLAVVSFVIILISAFLMRKDPPKGWRPPTYNPQASRSKLIRAT
FT                   DYQFTFSETVRTWQFWILVITFLLVASEGLTIVSKAVQYGLYFHFALVVAVAAALGSSI
FT                   MAGLGKFITGVVSDAIGVIKTLILFYTLSGVFTLLSILFGIVHNEIGFVVSVALAILTW
FT                   ASIYTVNPAAVGYFYGEVASGNNYGLLYAIAKGSGAIYGGVLTAIMIGALGWINTMIVS
FT                   GLFGIIAALLAIPLLWKIPKPPKKV"
FT   sig_peptide     504268..504393
FT                   /locus_tag="Vdis_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            505704..507113
FT                   /locus_tag="Vdis_0526"
FT   CDS_pept        505704..507113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0526"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="COGs: COG0277 FAD/FMN-containing dehydrogenase;
FT                   InterProIPR016166:IPR016164:IPR006094:IPR004113:IPR 016167;
FT                   KEGG: pai:PAE1286 glycolate oxidase subunit GlcD; PFAM: FAD
FT                   linked oxidase domain protein; SPTR: Q8ZXH3 Glycolate
FT                   oxidase subunit glcD; PFAM: FAD binding domain; FAD linked
FT                   oxidases, C-terminal domain; TIGRFAM: glycolate oxidase,
FT                   subunit GlcD"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49924"
FT                   /db_xref="GOA:E1QUS1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUS1"
FT                   /protein_id="ADN49924.1"
FT                   /translation="MGITKDIITELERIVGSNNIITDDVELTVYEADGSFVYTAKPDVV
FT                   VFPRSTEEVAKVVRVAWENRIPIIGRGSGTSLSGGALPIEGGIVISLTRMNRVLELDVE
FT                   NETATVEAGVINLWVSDALAKLNYQYPIDLGYYFPADPGSQRVSTIGGNISHNAGGVKC
FT                   FKYGVTVNNVRGLKVVLPNGEVRFFGGKVVENPGYDVIGIMSGSEGTMAIVTEAVLRIV
FT                   SNYESVKTILAAFNSVEDAGTAVSRIISSGIRPVALEFMDKIAVNAIEAGPWGGGLPTD
FT                   AEAILLIDVEGSEPGTNAEASRIIEILKSSGAYMVKLAKDRAEANRWWNARKQAFGAMG
FT                   FVGPNYITGDGTIPRKKLPEALHRIREIGNKYGFRIANVFHAGDGNLHPLILYDERRPG
FT                   ERERALQAEDEILRMCVEIGGTITGEHGVGYYKKHLIGLLYTDYELNVMKNIKSVFDPL
FT                   GIMNPGKIFPR"
FT   gene            507118..508311
FT                   /locus_tag="Vdis_0527"
FT   CDS_pept        507118..508311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0527"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="COGs: COG0277 FAD/FMN-containing dehydrogenase;
FT                   InterPro IPR016166:IPR006094:IPR004113:IPR016168; KEGG:
FT                   pas:Pars_0491 FAD linked oxidase domain-containing protein;
FT                   PFAM: FAD linked oxidase domain protein; SPTR: A4WI69 FAD
FT                   linked oxidase domain protein; PFAM: FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49925"
FT                   /db_xref="GOA:E1QUS2"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUS2"
FT                   /protein_id="ADN49925.1"
FT                   /translation="MALEAALKGIEREVSNDSIREPTSKYVIDGLMPKVVLYPRDVNEL
FT                   STMMRGISKEKLSVIPIVNGSKTFIGNIPKSYDVALDLSRVNRVIEPDPEEMVGVYGVS
FT                   ASFNEVQETLRRVSRRLPIDPPLSSRSSIGGVFSCNLFGPLAYTFMTTRDITLRVRAVM
FT                   PDGTVVRWGTGMIKDVAGYNVKRLFIGSCGSLGIIYEVMSRIAAIPDVIAVTRLNKELD
FT                   LFITRRLKPYGAIVVNGTMYLRFEGVKEEVEYRLGKLSEVSGFDVFYGNEAEELWYKLT
FT                   SMDELFNNYNVIIKVVTPQARLNNALRELPSDYLVKMPMIGEAYLGINSIDVNTLNTIR
FT                   GKVGDLGGYLMILKAPPELKRGIDVWGLNQNLDIMSKLKSVFDPLGIMSPGRFVGGL"
FT   gene            508311..509594
FT                   /locus_tag="Vdis_0528"
FT   CDS_pept        508311..509594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0528"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="COGs: COG0247 Fe-S oxidoreductase;
FT                   InterProIPR009051:IPR017900:IPR001450:IPR004017:IPR
FT                   012257:IPR017896:IPR012285; KEGG: pai:PAE1282 glycolate
FT                   oxidase subunit GlcF; PFAM: protein of unknown function
FT                   DUF224 cysteine-rich region domain protein; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; SPTR: Q8ZXH5
FT                   Glycolate oxidase subunit glcF; PFAM: Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49926"
FT                   /db_xref="GOA:E1QUS3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUS3"
FT                   /protein_id="ADN49926.1"
FT                   /translation="MGSDDLYRRFVEEGLNEAYKCVHCGFCLPTCPTYRATWNEADSPR
FT                   GRIYLVKALLTGKLQPTETLLEHLDACVICRRCETACPSGVQYSKVLEAAYAYLGDKLI
FT                   NYGYPWHVRTGFKLLESPMAIKLALSVSNSLPGIPSHMKGFARSRDRERLDDVLGKVFR
FT                   VPSDKPVRGRVLLFVTNSCVAWQSHTHLVYATIRVLTWNGFEVVVPREFKCCGAPYMHM
FT                   GMFNKAVELARHNIDVFDKYDKAYGIDYIVVPDSGGCQAQWLEYERLLNAKLNLRQRVM
FT                   NTLQLLDRVGLVGELGPVKMRISIQHSCHLMNAAKAHDAILRIISKIPGLEIRGLDTAD
FT                   ICCGAGMMYPDRHPDIAREITRQKIEDLMRHKPDALILESVTCKAHWANIIRDNNISIR
FT                   LLYPTELLDTSYMSGGNPGYGMIEGVIL"
FT   gene            509660..510592
FT                   /locus_tag="Vdis_0529"
FT   CDS_pept        509660..510592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0529"
FT                   /product="homoserine kinase"
FT                   /note="COGs: COG0083 Homoserine kinase;
FT                   InterProIPR020568:IPR006203:IPR000870:IPR006204:IPR
FT                   013750:IPR014721; KEGG: cma:Cmaq_0261 homoserine kinase;
FT                   PFAM: GHMP kinase; GHMP kinase domain protein; SPTR: A8MAS3
FT                   Homoserine kinase; TIGRFAM: homoserine kinase; PFAM: GHMP
FT                   kinases C terminal; GHMP kinases N terminal domain;
FT                   TIGRFAM: homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49927"
FT                   /db_xref="GOA:E1QUS4"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUS4"
FT                   /protein_id="ADN49927.1"
FT                   /translation="MSICIRSLASIANLGPGFDVMSLAIMEPYDDAYIELSRGEDRVEF
FT                   IGNYAHYLPSDYKVTTLYPVIEEFRRIMGIDFHVHVVVKKNIKPASGLGSSGADAAAMA
FT                   YALNKLLNAGLDYKSLIRIAALGEVAAAGTPHMDNVAASLLGGLVIINPVTGDFVRVDL
FT                   PDNYWVVIVMAGSKPSTKEMRKLLPNAVDMNSLKNNSAYASMLVYALITGNREALGKAL
FT                   MGDAVVEPVRAKLYPHYNAVKEALLKAGAIGVALAGAGPSLFGIFDFEPSKERINELLH
FT                   ARGLRDHALIITRPSNIGVHEIPCEDLNT"
FT   gene            510620..511744
FT                   /locus_tag="Vdis_0530"
FT   CDS_pept        510620..511744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0530"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG0665 Glycine/D-amino acid oxidase
FT                   (deaminating); InterPro IPR006076; KEGG: siy:YG5714_2221
FT                   FAD dependent oxidoreductase; PFAM: FAD dependent
FT                   oxidoreductase; SPTR: D0KR81 FAD dependent oxidoreductase;
FT                   PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49928"
FT                   /db_xref="GOA:E1QUS5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUS5"
FT                   /protein_id="ADN49928.1"
FT                   /translation="MNVIIIGGGVIGTVLTHLFSLRGVNVTLINSGLQKPRFPLIHSKL
FT                   LRFPEDIRLARISEDVYMELSRELRVDVLRPMESITIIPEACYNDALHIMSMWYEVGAK
FT                   VRVISDVHEYGLKRVNDQEIYIFSTNGDNFVNYLSLMNRVHKIDGVNYINGTATIKFSD
FT                   HDVRVLINDNELKGDYVILASGAWNSIMIRNAGLNVPLLPYKCQAAAFISRGISTIVYD
FT                   YVLNIYVRPLGLRIDNALNKLGLSIIVGGDGNSKVTEPGRDRGVDREFLNEVRGKVRAR
FT                   LGRVLLIGSRFGYCEITPDMRPVVGTVGSENLLLIGGFNGYGAEVGPALALAVVNYVIS
FT                   GSWPDYARPYLIDRFGNNWPSTWDIGVEAHELCV"
FT   gene            511799..514090
FT                   /locus_tag="Vdis_0531"
FT   CDS_pept        511799..514090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0531"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="COGs: COG1204 Superfamily II helicase;
FT                   InterProIPR010995:IPR011545:IPR001650:IPR014021:IPR 014001;
FT                   KEGG: cma:Cmaq_0318 DEAD/DEAH box helicase
FT                   domain-containing protein; PFAM: DEAD/DEAH box helicase
FT                   domain protein; helicase domain protein; SMART: DEAD-like
FT                   helicase ; helicase domain protein; SPTR: A8MB76 Putative
FT                   ski2-type helicase; manually curated; PFAM: Helicase
FT                   conserved C-terminal domain; DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49929"
FT                   /db_xref="GOA:E1QUS6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUS6"
FT                   /protein_id="ADN49929.1"
FT                   /translation="MRVADLPLPDILRDFVIRERGIQELYPPQEEAVRKGLFDGKSIVM
FT                   CTSTATGKTLMAELAMINAVLTKGVKAILAVPLRALAYEKARDLRIYEKLGVRIAVTTG
FT                   EYDKEDAWLMNYDIVVTTYEKLDSLLRHKAEWLRQVGVLVIDEIHYIDDDKRGPTIESI
FT                   IAKVKALGLSTQLLALSATIGNAEEIANYLDADLVVSDWRPVKLKEGVYYDGVIYYSDG
FT                   SRALIKDLGNPVLSLVMDTIVNGGQALVFTNSRSNTVKLAQQIAHYICNYGAKIIEPGT
FT                   LMKISNSIIEASQSKLLGEELARVVKCGVAFHHAGLDMDARSIVENSFRDRLIKAVVAT
FT                   TTLAAGVNLPARRVIIHEYRRYEPGIGMEELPVMEYKQMAGRAGRPGLDPYGEAVLIAR
FT                   SEDEIDYLIRNYISARVEDIRSKFLTDKNLATHILSAIASGYASSIDDVMRFVSSTLGY
FT                   VQGGFQKNEFLRDLLKRKIDDVINFLVESGFLERRNDNVVATPLGSLLNNLYLDPYTAN
FT                   TYIRGLKARDETNDLGYTHLIIQSPEVPRLRVRRNEFDDYLELVLDNWDYLLIKPPITR
FT                   DEIENGEFEDEEIEDYLSTVKTAVMLLDWANEVSEDDLYKNYDVGPGDLRVYSDLMDWL
FT                   ASAVARLAGALGMRRHEERLNLLKWRLTYGVKDELIELVVNLEGVGRARARALYNAGFK
FT                   SVEDIANADPRVISMIRGFGDKLARSIIEQARRLTKEGRVVKPSTINLGKEGGNKQGYT
FT                   RRKGSLLDYL"
FT   gene            514140..514922
FT                   /locus_tag="Vdis_0532"
FT   CDS_pept        514140..514922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0532"
FT                   /product="Nucleotidyl transferase"
FT                   /note="COGs: COG1209 dTDP-glucose pyrophosphorylase;
FT                   InterPro IPR005835; KEGG: sai:Saci_0422 nucleotidyl
FT                   transferase; PFAM: Nucleotidyl transferase; SPTR: Q4JBJ4
FT                   Nucleotidyl transferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49930"
FT                   /db_xref="GOA:E1QUS7"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUS7"
FT                   /protein_id="ADN49930.1"
FT                   /translation="MITKAVITAAGLGTRMRNMTLIMPKALLPLIRKNETPMLIPIIDL
FT                   IIARLQEVGVSKFIIVVGRNGKPLIDYLMDKLFTDSLRAQISFTFQEKPLGFGDAVLRA
FT                   EDFVNNDPFFVHADDGILTKGYLEGVKLFEELRPDAVLFLRRVNNPSRYGIAVVRSEGM
FT                   YNGYGLVRVLNVEEKPSNPKSDIAISAVYIFNRRIFDGLRSARVNGELELTYGIENVIN
FT                   SGGEVYGLLLSDDSWLSVGDPESYFNTIIRTFNLNEGD"
FT   gene            514964..515965
FT                   /locus_tag="Vdis_0533"
FT   CDS_pept        514964..515965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0533"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: cma:Cmaq_0756 glycosyl transferase group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: A8MCT6
FT                   Glycosyl transferase group 1; PFAM: Glycosyl transferases
FT                   group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49931"
FT                   /db_xref="GOA:E1QUS8"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUS8"
FT                   /protein_id="ADN49931.1"
FT                   /translation="MLVNIIVSRNRVSGEIRTGIRLRLENPPPGVDYRVINEPVDLSPS
FT                   SNDFYITRDTTTKWFLKALIEPVYSLKLRGLTHAFFLNLFIPRTPWVQEIDQPIFNLFE
FT                   KYIGRSRKGTLYRLAVKTFRYLFNRDNVVMITWTQWSKEGLEEEGFRDVRVVPPPMRTS
FT                   FRKIDNEITVGFVGVEYHRKGGDIAENVMSKLPRRVRKVYVGKSPRRVEGIEYHNPMRR
FT                   DELLKLMAEFDVLLFPTRGEAYGFTALEAMSMGIPIVASNVDSVPEVVGDGGILCEVND
FT                   IKCFLDSVKELINSPDYAMELGARAKAIVTQRHSPSVVGKELLAIYNELSEE"
FT   gene            515962..517152
FT                   /locus_tag="Vdis_0534"
FT   CDS_pept        515962..517152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0534"
FT                   /product="acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro
FT                   IPR011650:IPR001261:IPR002933:IPR010182; KEGG:
FT                   hbu:Hbut_1469 succinyl-diaminopimelate desuccinylase; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; SPTR:
FT                   A2BMT2 Predicted Acetylornithine deacetylase; TIGRFAM:
FT                   acetylornithine deacetylase or succinyl-diaminopimelate
FT                   desuccinylase; PFAM: Peptidase family M20/M25/M40;
FT                   Peptidase dimerisation domain; TIGRFAM: acetylornithine
FT                   deacetylase or succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49932"
FT                   /db_xref="GOA:E1QUS9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUS9"
FT                   /protein_id="ADN49932.1"
FT                   /translation="MSELIRQVVNVLMDLIKVRTVALPGENYLEVVTYLDNLMTSYGLG
FT                   TRIIKVPKSVVKEHYPEFADYPRYILLAELCNVRDKRIHFNAHYDVVPGGSGWLVTEPF
FT                   KPVLINGRVYGRGASDDKGGVTALVLLAERLSELGEFHGCVEFSFTPDEEIGGESGVGY
FT                   LINQIRKPDYAIVAEPTGLDTVWIGSMGILQLDVIVRGVSSHASQPWYGTNAFEDGIKV
FT                   AYALIKELKPKVESRQFMGERATITLGGLARGGVSRNLVPDYFQFSIDRRILPSESIEH
FT                   ALNEIMSGIDNLRNNIKSTVEVHIVNKIEPAISKESTLLTKLMNAVKNVLGMNPKVTIS
FT                   RVPVDTRYLQNMGIDSLTYGPGNVSSAHGPDEYINVSDIVNAVNVYTELIRNIYDK"
FT   gene            complement(517192..518616)
FT                   /locus_tag="Vdis_0535"
FT   CDS_pept        complement(517192..518616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0535"
FT                   /product="sugar transporter"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR016196:IPR005829:IPR003663:IPR005828; KEGG: sto:ST2557
FT                   sugar-proton symport; PFAM: General substrate transporter;
FT                   SPTR: Q96XF9 459aa long hypothetical sugar-proton symport;
FT                   TIGRFAM: sugar transporter; PFAM: Sugar (and other)
FT                   transporter; TIGRFAM: MFS transporter, sugar porter (SP)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49933"
FT                   /db_xref="GOA:E1QUT0"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUT0"
FT                   /protein_id="ADN49933.1"
FT                   /translation="MDDIVDLRNKQIAYEDIIERLDENIASRIYWLVSIITALGGFLFG
FT                   YDTGVIGSALIYIGPYFHLTSFEVAVLTSFTSVFAGIGALVAGPFIDRFGRKSLLIIDG
FT                   IFYALFAVLSGLAISSIDLIIWRSLVGFAIGADTAVATGYISEFAPKRHRGKLASLQQL
FT                   MIVVGMMTSFWVGYYLSMALPQTTNWRWMFGLGAIPAVILVALRFYLPESPRWLLIQGR
FT                   EEDAKKALAKLGVHVSEHIIPPKRELGFKEALSKQYIRRILLVVGLWLVFQQVTGINII
FT                   LYYGPYIWKYLGFTGPRAILSTVIPYSIGFIATLFQIYLVDRWGRRTLGTIGFTGLLVS
FT                   LVIMTVGAHYFALNDISIAVPLIFSAMVLFQVLFALGVGGVGWVLQGETMPTEFRGRGG
FT                   GILAAIDWFANFAIIYIFPIWLSAYGMFSFWVLEDVLALAAVIYVLLLVPETKGLSVDQ
FT                   MPQLFSRPLREIRKRQ"
FT   gene            518933..519487
FT                   /locus_tag="Vdis_0536"
FT   CDS_pept        518933..519487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0536"
FT                   /product="ribosomal protein L22"
FT                   /note="COGs: COG0091 Ribosomal protein L22; InterPro
FT                   IPR001063:IPR005721; KEGG: cma:Cmaq_1930 50S ribosomal
FT                   protein L22P; PFAM: ribosomal protein L22/L17; SPTR: A8MBL4
FT                   50S ribosomal protein L22P; TIGRFAM: ribosomal protein L22;
FT                   PFAM: Ribosomal protein L22p/L17e; TIGRFAM: ribosomal
FT                   protein L22(archaeal)/L17(eukaryotic/archaeal)"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49934"
FT                   /db_xref="GOA:E1QUT1"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUT1"
FT                   /protein_id="ADN49934.1"
FT                   /translation="MARIDWSIDAEDIIKRVKEIYGASITEDQVVKALGYEYRISWKKA
FT                   VEVARFIRGFTIKQAEEYLNNVIKMRTPIPIRRFTKKQAHHTTPWEGWPVAKWPVKVAK
FT                   AYLEVLKNLENNASYRGLNVDNVVIIHAAVHKGRKIRNYMPRAFGRSTPWFQDTVTIEL
FT                   AGAEIPEENVPKRLKLRPRPY"
FT   gene            complement(519481..519855)
FT                   /locus_tag="Vdis_0537"
FT   CDS_pept        complement(519481..519855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0537"
FT                   /product="PilT domain-containing protein"
FT                   /note="KEGG: pis:Pisl_0736 PilT domain-containing protein;
FT                   SPTR: A1RSI1 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49935"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUT2"
FT                   /protein_id="ADN49935.1"
FT                   /translation="MSSRDTVILDASAILHMRDLRPLMGMGDLVTTNHVINELKDARAI
FT                   VVPEILNISVYDISEDEIVRARRNYHLPRLLSDADVSLIVLALKLRDRNPMVITDDSLL
FT                   IKFLRKLGIRYSVIFLRRRQ"
FT   gene            complement(519852..520655)
FT                   /locus_tag="Vdis_0538"
FT   CDS_pept        complement(519852..520655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0538"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /note="COGs: COG0061 sugar kinase; InterPro
FT                   IPR016064:IPR002504:IPR017437; KEGG: cma:Cmaq_0436 NAD(+)
FT                   kinase; PFAM: ATP-NAD/AcoX kinase; SPTR: A8MBT8 NAD(+)
FT                   kinase; PFAM: ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49936"
FT                   /db_xref="GOA:E1QUT3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUT3"
FT                   /protein_id="ADN49936.1"
FT                   /translation="MRIMMYIGKYEDYALAKLIINRLSSNGVETIAARDVEVKNLGIPK
FT                   WDGSQDVDMAMVIGGDGTVLRFIHEIANSINTPILHIGTGRVNYLSDVSARELPQVLDK
FT                   IVKGEYTVEERLTLKAIATDFECTALNEVLVKGVDPGHLINVTIVEDGGEEIMRARMDG
FT                   VIIATPTGSTAYALAAGGPAVDSRLAVKLIVPLAPFSRALVPIVHPYEVPVKVLTSEVA
FT                   HILCDGIVAQRGAEIRIVPSDRKVRFVRTRQYRMYDRLFRRLFIP"
FT   gene            520756..521154
FT                   /locus_tag="Vdis_0539"
FT   CDS_pept        520756..521154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0539"
FT                   /product="translation initiation factor eIF-5A"
FT                   /note="COGs: COG0231 Translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A (eIF-5A);
FT                   InterProIPR008991:IPR016027:IPR019769:IPR005824:IPR
FT                   020189:IPR001884:IPR014722:IPR012340; KEGG: cma:Cmaq_0895
FT                   translation initiation factor IF-5A; PFAM: KOW domain
FT                   protein; Translation elongation factor, IF5A-like; SPTR:
FT                   A8MD73 Translation initiation factor 5A; TIGRFAM:
FT                   translation initiation factor eIF-5A; PFAM: Eukaryotic
FT                   elongation factor 5A hypusine, DNA-binding OB fold;
FT                   Elongation factor P (EF-P) KOW-like domain; TIGRFAM:
FT                   translation initiation factor eIF-5A"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49937"
FT                   /db_xref="GOA:E1QUT4"
FT                   /db_xref="InterPro:IPR001884"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR019769"
FT                   /db_xref="InterPro:IPR020189"
FT                   /db_xref="InterPro:IPR022847"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUT4"
FT                   /protein_id="ADN49937.1"
FT                   /translation="MSTKPTEAGSVKEGSYIMIDGEPCKVVEVEKSKTGKHGSAKVRIV
FT                   GIGVFDNVKRTLIVPADAQVEVPIIEKFVAQVVAKVGDSWQLMDLRNYSTFEVGQDQME
FT                   EEVKGRIEPGVEVEVWDIAGRRKIIRVR"
FT   gene            complement(521162..521725)
FT                   /locus_tag="Vdis_0540"
FT   CDS_pept        complement(521162..521725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0540"
FT                   /product="Protein of unknown function DUF655"
FT                   /note="COGs: COG1491 RNA-binding protein; InterPro
FT                   IPR007003; KEGG: cma:Cmaq_1981 hypothetical protein; PFAM:
FT                   Protein of unknown function DUF655; SPTR: A8MC13 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function,
FT                   DUF655"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49938"
FT                   /db_xref="InterPro:IPR007003"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUT5"
FT                   /protein_id="ADN49938.1"
FT                   /translation="MVKREDYAYILDIIPPEQMLIKDPSLIKKGFPRNEVYVQAVGEQF
FT                   FTLLELTLKPNATAEVGERVYIGSGTRDKVNKIVRRISYDELTNEAKNALPEVVAKIVK
FT                   AQENRFVDFFNKAGPITLKMHSLELLRGIGKKTLWQILEERRKKPFQSFEDIKSRVGID
FT                   PEKLIIDRILRELQGADQYRIFVG"
FT   gene            complement(521738..522085)
FT                   /locus_tag="Vdis_0541"
FT   CDS_pept        complement(521738..522085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0541"
FT                   /product="RNA polymerase Rpb4"
FT                   /note="COGs: COG1460 conserved hypothetical protein;
FT                   InterPro IPR010997:IPR005574:IPR006590; KEGG: cma:Cmaq_1982
FT                   RNA polymerase Rpb4; PFAM: RNA polymerase Rpb4; SMART: RNA
FT                   polymerase II, Rpb4, core; SPTR: A8MC14 RNA polymerase
FT                   Rpb4; PFAM: RNA polymerase Rpb4"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49939"
FT                   /db_xref="GOA:E1QUT6"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR006590"
FT                   /db_xref="InterPro:IPR010924"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR038324"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUT6"
FT                   /protein_id="ADN49939.1"
FT                   /translation="MVKRIINSEDIPMAEALRILEEKLLSANPSITDEVVNNTLDYLRK
FT                   FSKVGPDKARELISELMKRFGLARLTTIQIVDLMPQTADELRVLLGAEKREFSDKDVEE
FT                   ILNLLKNARGS"
FT   gene            522196..522519
FT                   /locus_tag="Vdis_0542"
FT   CDS_pept        522196..522519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0542"
FT                   /product="Ribosomal protein L21e"
FT                   /note="COGs: COG2139 Ribosomal protein L21E; InterPro
FT                   IPR008991:IPR018259:IPR001147; KEGG: pas:Pars_1748 50S
FT                   ribosomal protein L21e; PFAM: Ribosomal protein L21e; SPTR:
FT                   A4WLN2 50S ribosomal protein L21e; PFAM: Ribosomal protein
FT                   L21e"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49940"
FT                   /db_xref="GOA:E1QUT7"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="InterPro:IPR022856"
FT                   /db_xref="InterPro:IPR036948"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUT7"
FT                   /protein_id="ADN49940.1"
FT                   /translation="MHRTHGLRYKSRKLLSKKPREKGRPGISRWLYEYNVGDKVVIDID
FT                   PTFITTAPHRRYQGKVGTIIGRRGKAYEIEIYVGGKRKVIITTPDHIVPFKAQPTETKA
FT                   SAS"
FT   gene            complement(522527..523765)
FT                   /locus_tag="Vdis_0543"
FT   CDS_pept        complement(522527..523765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0543"
FT                   /product="THUMP domain protein"
FT                   /note="COGs: COG1258 pseudouridylate synthase; InterPro
FT                   IPR004114; KEGG: cma:Cmaq_0954 hypothetical protein; PFAM:
FT                   THUMP domain protein; SPTR: A8MDD0 Putative uncharacterized
FT                   protein; PFAM: THUMP domain; TIGRFAM: conserved
FT                   hypothetical protein TIGR01213"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49941"
FT                   /db_xref="GOA:E1QUT8"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR005912"
FT                   /db_xref="InterPro:IPR039894"
FT                   /db_xref="UniProtKB/Swiss-Prot:E1QUT8"
FT                   /protein_id="ADN49941.1"
FT                   /translation="MSIERAMDILRKYPLCNHCLGRLFARLGTGLDNEERGRAIKDYLL
FT                   MRIHERILNEGLSDELLNDVKALAVSGHEPSIKFLSNMGINVSPARCYVCGDTIFNRLN
FT                   EWVNNIVNSLRSLGIEFRSFRLGSRVPLDIQNRELSITTEFNISSAESIKREINRELGK
FT                   RVSAMLGVSFNREEPDVEVVIDVNTGSVEVQIMPIYISARYRKVHRLINEEGQVKWPID
FT                   RVIQAYNAQDVVIHTGGEDPMGVRVLGNGRPVILQVVKPSKRPDVNDVYALLKDSGYDI
FT                   VLDNLSRVRASAVVKMKARVRDYVITYRVLAITDNSVTNENIKSLHDYFRNRQVVQVFR
FT                   RGRRIRRRISMVYELDGRVIRDRLVEFLIRCQGNLYIRGFVHGGLGDVEPSIAGTLGFS
FT                   VRPVEIDILNISD"
FT   gene            523824..524378
FT                   /locus_tag="Vdis_0544"
FT   CDS_pept        523824..524378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcl:Pcal_1684 hypothetical protein; SPTR:
FT                   A3MWT4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49942"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUT9"
FT                   /protein_id="ADN49942.1"
FT                   /translation="MDPYLIGAFMNECSVMWRSVEGFSDAVDYVRSLEPGITMSNNILN
FT                   ATSSLCDEVNKILQKPTRLLMFFNINDWIRLLRGLYDFYGELIDPEPSLDIPNFVLSIR
FT                   IPNKSLGLALRIALKFLGINSNVFPGNDGKLYLVIHERESIARFIKTVKPHLDPELNIA
FT                   LRNKWIKHYIGSGEPLVIIKE"
FT   gene            complement(524521..525087)
FT                   /locus_tag="Vdis_0545"
FT   CDS_pept        complement(524521..525087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0545"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="COGs: COG1898 dTDP-4-dehydrorhamnose 3 5-epimerase;
FT                   InterPro IPR011051:IPR000888:IPR014710; KEGG: tne:Tneu_0476
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase; PFAM:
FT                   dTDP-4-dehydrorhamnose 35-epimerase related; PRIAM:
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase; SPTR: Q704C4
FT                   DTDP-4-dehydrorhamnose 3,5-epimerase; TIGRFAM:
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase; PFAM:
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase; TIGRFAM:
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49943"
FT                   /db_xref="GOA:E1QUU0"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUU0"
FT                   /protein_id="ADN49943.1"
FT                   /translation="MPFKNFVRLEIPDVILVEPVVFPDVRGFFAELYKRTDFLAGGIPY
FT                   DFVQVSLSKSRRGVVRGLHYQLKPMEQGKLVTVIRGRVVDVAVDVRRGSPWFGKYVMVE
FT                   LSADNPRLLWVPPGFAHGFQALEDDTLFLYLQTKEYSPQHERCVAWNDPEIGIPWPIRE
FT                   NVIISEKDSKCPPLRQAETNFDYPI"
FT   gene            525194..525796
FT                   /locus_tag="Vdis_0546"
FT   CDS_pept        525194..525796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0546"
FT                   /product="regulatory protein ArsR"
FT                   /note="InterPro IPR001845; KEGG: cma:Cmaq_1058 regulatory
FT                   protein ArsR; PFAM: regulatory protein ArsR; SPTR: A8MDN1
FT                   Regulatory protein ArsR; PFAM: Bacterial regulatory
FT                   protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49944"
FT                   /db_xref="GOA:E1QUU1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUU1"
FT                   /protein_id="ADN49944.1"
FT                   /translation="MNAVVKPEIVVTLNGENIGVIPRYDSEYVLMRERDFNVILDNTNL
FT                   EIMLAVISGHNTFTQIMKRTNLQRGKLSRHLRRMLNAGWIIKSGNRYLPSGRIYVVYDV
FT                   RDVDGEIMLSILMSKGAFIDPFHGLVIINGEPLSNYCSTCPLRQACVNNVKSLARKYNI
FT                   ELRGAEPSEAYVELFRELVRRDLIRKFKSGWRIVVMK"
FT   gene            525843..526217
FT                   /locus_tag="Vdis_0547"
FT   CDS_pept        525843..526217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0547"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="InterPro IPR004942; KEGG: sul:SYO3AOP1_0078
FT                   roadblock/LC7 family protein; PFAM: Roadblock/LC7 family
FT                   protein; SPTR: C4FKP5 Roadblock/LC7; PFAM: Roadblock/LC7
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49945"
FT                   /db_xref="GOA:E1QUU2"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUU2"
FT                   /protein_id="ADN49945.1"
FT                   /translation="MEETNETLGKVVKEFLNSTDIISGVYIASLDGLLVAHASRIDVDP
FT                   DRVAAMVASLSAVGDRVSKELLNEDSSHVIVQASTGYIIIKRFRDFVIGVLVHSGDNST
FT                   IGLTMLELERLISLIQKQLR"
FT   gene            526273..526683
FT                   /locus_tag="Vdis_0548"
FT   CDS_pept        526273..526683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0548"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="COGs: COG0432 conserved hypothetical protein;
FT                   InterPro IPR001602; KEGG: tne:Tneu_0167 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0047; SPTR:
FT                   B1YAP5 Putative uncharacterized protein; PFAM:
FT                   Uncharacterised protein family UPF0047; TIGRFAM: conserved
FT                   hypothetical protein TIGR00149"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49946"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUU3"
FT                   /protein_id="ADN49946.1"
FT                   /translation="MRVVTKEITIQSRRRREVINITSHIEDFIKSSGIRNGIVLVFLPH
FT                   ATSALFANEDEPRIRRDYENLFERLVPVNGNYYHNDIDNNADAHLLSSIFKQFYVLPIV
FT                   NGELIHGTWQEVFLAEFDGPRNRRVVLVALGE"
FT   gene            complement(526693..527184)
FT                   /locus_tag="Vdis_0549"
FT   CDS_pept        complement(526693..527184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0549"
FT                   /product="protein of unknown function DUF151"
FT                   /note="COGs: COG1259 conserved hypothetical protein;
FT                   InterPro IPR003729; KEGG: cma:Cmaq_0036 hypothetical
FT                   protein; PFAM: protein of unknown function DUF151; SPTR:
FT                   A8M9K9 Putative uncharacterized protein; PFAM:
FT                   Uncharacterised ACR, COG1259"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49947"
FT                   /db_xref="GOA:E1QUU4"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUU4"
FT                   /protein_id="ADN49947.1"
FT                   /translation="MVREESSGNSKYLKADLLDVIEIPEEGVAVMLFTTEEWDDRVLPI
FT                   RIDVTASFSIKKALGLVSFHRPLTHDLLVDLINRLDVVVEKVTIDAMIDGVYLATIFIK
FT                   DNRTNETFQLDARPSDATAIAVRLGAPIYVAEHLVAYTEPLENYRELRARYGFSFNKNF
FT                   "
FT   gene            complement(527216..528517)
FT                   /locus_tag="Vdis_0550"
FT   CDS_pept        complement(527216..528517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0550"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="COGs: COG0124 Histidyl-tRNA synthetase;
FT                   InterProIPR004154:IPR002314:IPR015807:IPR004516:IPR 006195;
FT                   KEGG: cma:Cmaq_0658 histidyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; PRIAM: Histidine--tRNA ligase; SPTR: A8MCJ2
FT                   Histidyl-tRNA synthetase; TIGRFAM: histidyl-tRNA
FT                   synthetase; PFAM: Anticodon binding domain; tRNA synthetase
FT                   class II core domain (G, H, P, S and T); TIGRFAM:
FT                   histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49948"
FT                   /db_xref="GOA:E1QUU5"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUU5"
FT                   /protein_id="ADN49948.1"
FT                   /translation="MVFDDKDLRPVRGMKDLTPEEYYPMLQVFDKLARVAESFGYLRVE
FT                   TPALEHYEILKAKAGEDVINEIYYFKDKAGREVGLRFDMTVPVARVVSYRVDVPKPIRW
FT                   YYITKVWRYDEPQHGRYREFHQFGIEFIGSSSVRADAEVLTVGVEALKALNIGDFRVRI
FT                   NDRRIIDQLLSKLGISNELKPSVLRVMDKRGKVPDDEILRMLRDLGLSNDTAQEVLRLA
FT                   NTSEGIDKAIDSFKEFGVSDEFIKYYSELIDLLDMYGVRNYMDLDMGIVRGLDYYTGIV
FT                   FEMYVPDYKLSVGGGGRYDNLIEIYSGKPMPASGFAMGIERLLEVLEQRGSIKRAFPQI
FT                   DYYVYVLGNDRNYLALGYRLAANLRARGNKVIVDTGEKSLRSALEYASKVNVRYFIIVG
FT                   PKEVSQGVVRVRDMSNWSERDVPITEFGINAKGE"
FT   gene            complement(528563..529324)
FT                   /locus_tag="Vdis_0551"
FT   CDS_pept        complement(528563..529324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0551"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="InterPro IPR000045; KEGG: cma:Cmaq_1769 hypothetical
FT                   protein; PFAM: peptidase A24A prepilin type IV; SPTR:
FT                   A8MAW3 Putative uncharacterized protein; PFAM: Type IV
FT                   leader peptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49949"
FT                   /db_xref="GOA:E1QUU6"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUU6"
FT                   /protein_id="ADN49949.1"
FT                   /translation="MVNIYVLLMVDYLLVLAVQVAASIQDLRTREISDWTWIIGSIMCV
FT                   PLGLYVVIMLNQLILYIVSVVVGSVFALAVYWLRAMGGADSKSIAFISASIPTLPMATP
FT                   ALTIINITPLSILINSLIIALVLYIPYNVIQNIRYGSNCEALARVKGLNRLIYLLTLMC
FT                   VPVHKVLRNPNNYAISQVLTEDGFQPIIRLGLDVDDPRELLIEWLSKGKISIGTPVLTS
FT                   YHIPFIVPITLGLVVYVLTHVNVLTLILAAL"
FT   gene            529434..530591
FT                   /locus_tag="Vdis_0552"
FT   CDS_pept        529434..530591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0552"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase; InterPro
FT                   IPR016039:IPR002155; KEGG: pai:PAE2486 acetyl-CoA
FT                   acetyltransferase; SPTR: Q8ZV26 Acetyl-CoA
FT                   C-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49950"
FT                   /db_xref="GOA:E1QUU7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUU7"
FT                   /protein_id="ADN49950.1"
FT                   /translation="MSRRVAIIGVGWYGFRPVVEEASFREMMFEAATRAYEDAGGLNPR
FT                   TDVDAFASCQEDFWEGIAIADEFAPEPIGGTLKPVFTTPGDGLQCVASAYMLIKTGQFD
FT                   IVVAESHAKPSDIINMHDVMLFAMDPITIRAINTPNYHALAALEAQAYMTRYNVPREAL
FT                   AYVVVKNKRNALYNDRASYGANLTIDEVLNSPYAVSPLTKLDIAPFVDAAVVVVLAGED
FT                   VARRYTDTPVWVDGIHWITEDPSLEFHNWEFPIHAMKAAEVAYKMAGIQDPIKELHFAE
FT                   IDARYSFKELQFIEALKLAPIGEAHKLLLEGAFDRDGLFPVNPSGGALGEGVPLEVHGL
FT                   ARLVDAVLQLRGEAGRMQLSKAERAVIHSWRGVPTTTSVVAVLSR"
FT   gene            530630..531811
FT                   /locus_tag="Vdis_0553"
FT   CDS_pept        530630..531811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0553"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase; InterPro
FT                   IPR016039:IPR002155:IPR016038; KEGG: pai:PAE2488 acetyl-CoA
FT                   acetyltransferase; SPTR: Q8ZV25 Acetyl-CoA
FT                   C-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49951"
FT                   /db_xref="GOA:E1QUU8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUU8"
FT                   /protein_id="ADN49951.1"
FT                   /translation="MSRNIYVKHRPAVIGAGLTLFRRRMLETPKELAWIAAKQALDEAG
FT                   LTLKDIDCVVIGSAPDTFDGVHMKGEYLADGAGGVGKPTMRVFVGGATGVMVPIAAWWH
FT                   VASGHCKTVLAVAEEKMSDADIPHPQAVFRYIWDPVTEVPLQPNLIWIFALEMHRYMYK
FT                   CGVKKEDIALVSVKNKRNALDHPAAQVAANITVDDVLKSEVLVWPVQLLDISPVSDGAA
FT                   AFVVASEDVARRQTDTPVWIDGVGWALDTTSWTNRDLAFPEYANVAAQMAYRMAGITNP
FT                   RKEIDVAEVYDPFDYKELHHMEGLGLAKKCEASKLTKEGVTQRDGDLPINPSGGLLGVG
FT                   NPIAAAGVMKVAEIYWQLAGKAGKRQVKKPVYTGLAHAWGDLMQASTVVVMRV"
FT   gene            complement(531829..532725)
FT                   /locus_tag="Vdis_0554"
FT   CDS_pept        complement(531829..532725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1396 hypothetical protein; SPTR:
FT                   A8M903 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49952"
FT                   /db_xref="InterPro:IPR016797"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUU9"
FT                   /protein_id="ADN49952.1"
FT                   /translation="MINARDLLRGAFDFHVHSAPDIVPRLLDDIDLARLYRDYGFGGFI
FT                   IKNHYSPTYDRAYLVRRAVNGIEVFGGVVLNNSVGGLNPRIVYVAGRSGAKVVWFPTVD
FT                   SANERSSLLNWRGKPNPPAWAKAQLELHDRGLLGNALSIFDEDGRIRPEVDEILDIIRE
FT                   FNMILATGHLSPSEGMQLIKRAVERGVKKIVITHPEFPTTRYSIEQQRELVNYGVYFER
FT                   CYESILTGRVSINDVVKAIRETGIEKNILSTDLGQAHNEPPPQGYIEFVEKLIENGITK
FT                   EEIEIMTKENQRKLLYE"
FT   gene            complement(532760..534064)
FT                   /locus_tag="Vdis_0555"
FT   CDS_pept        complement(532760..534064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0555"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR016196:IPR002355:IPR005829:IPR011701;
FT                   KEGG: cma:Cmaq_1395 major facilitator transporter; PFAM:
FT                   major facilitator superfamily MFS_1; SPTR: A8M902 Major
FT                   facilitator superfamily MFS_1; PFAM: Major Facilitator
FT                   Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49953"
FT                   /db_xref="GOA:E1QUV0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUV0"
FT                   /protein_id="ADN49953.1"
FT                   /translation="MRTLAIISTSIGIGFEWYDFFLYSLLGPIIAELFFPSKVAVLSLL
FT                   LYYLVFLIGFLGRPLGGIIFGHIGDRLGRIYALYFTLLFAGVASLVVAVLPTYYQIGIV
FT                   APIILAAMRFLDGVALGGEWGGSFSLTSEYINPNRRGLYSGILQSTVSIASLLISGLTL
FT                   LLTSILGSTGFKAIGWRILFGIGFIIAILGVFVRLRVEDSPVFKQLQSRGQIVKSPLLE
FT                   AVKKYWKLILIGLFLVGVFNGIWYYMNYAFSIAYATTIAKEFGKPYVTYVVTQLGIFIV
FT                   SIIGIFASIFFGYLSDLIGRRPQMLADAVFGIVFAAPYFLMLISGNPALVITALVIGGL
FT                   FVYYLAGAITPIVLVEMFPPQVRYTGISMAYQIGVGFLGGSAPLIMTYLIAATHNIYSP
FT                   IYFMIGTGVLVLAMALLVGETKGRLYMGEEVLKQQ"
FT   gene            534185..534910
FT                   /locus_tag="Vdis_0556"
FT   CDS_pept        534185..534910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0556"
FT                   /product="Asp/Glu/hydantoin racemase"
FT                   /note="COGs: COG3473 Maleate cis-trans isomerase; InterPro
FT                   IPR015942; KEGG: cma:Cmaq_1394 Asp/Glu racemase; PFAM:
FT                   Asp/Glu/hydantoin racemase; SPTR: A8M901 Asp/Glu racemase;
FT                   PFAM: Asp/Glu/Hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49954"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUV1"
FT                   /protein_id="ADN49954.1"
FT                   /translation="MAWFKIGVIIPSSNTTVEREFSRVIKEPEITIHSSRITLREVTLK
FT                   GLEEMEKETERAAMELSTINPDIIAYACTTGSLFKGPNHHVEIKERIERLTKVRAVATA
FT                   GAVIDALKKLGANKVLVVTPYIDELNVKERDFLEAHGFKVVNIRGLGIVDNTVIGSLDP
FT                   RTAYEAALSAYNQFGSDFDVLFISCTNWRTFEVISAIERRINKPVVSSNSATLWSVLKE
FT                   LGVRVKLNYDLGMLFSDVQ"
FT   gene            complement(534919..535617)
FT                   /locus_tag="Vdis_0557"
FT   CDS_pept        complement(534919..535617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0557"
FT                   /product="beta-lactamase domain protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; KEGG: siy:YG5714_0954 beta-lactamase domain
FT                   protein; SPTR: C3NCZ7 Beta-lactamase domain protein; PFAM:
FT                   Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49955"
FT                   /db_xref="GOA:E1QUV2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUV2"
FT                   /protein_id="ADN49955.1"
FT                   /translation="MNKWEILLPGMPITTNLGFLGLCNVVLIRIDDKYVIFDPGHYGNK
FT                   EPLLSALRNRGLGVNDIDYVVLSHLHFDHAINALLFPRAKIIISRDEIYYAQSNPNDPY
FT                   LVTYLIDLIKDRLITVKDNEEFLGANFILLPGHTGGTMGLLLKDKVLLAGDAIKYMSEA
FT                   VNRRASFTYYNGELANESITRALSIAKVIIPGHDIPFIVEGNSIKPLMDEPFNFQLTLR
FT                   GHVKLTIVNE"
FT   gene            535696..537660
FT                   /locus_tag="Vdis_0558"
FT   CDS_pept        535696..537660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0558"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="COGs: COG0145 N-methylhydantoinase A/acetone
FT                   carboxylase beta subunit; InterPro IPR008040:IPR002821;
FT                   KEGG: cma:Cmaq_1392 5-oxoprolinase (ATP-hydrolyzing); PFAM:
FT                   Hydantoinase/oxoprolinase; Hydantoinaseoxoprolinase domain
FT                   protein; PRIAM: 5-oxoprolinase (ATP-hydrolyzing); SPTR:
FT                   A8M8Z9 5-oxoprolinase (ATP-hydrolyzing); PFAM:
FT                   Hydantoinase/oxoprolinase; Hydantoinase/oxoprolinase
FT                   N-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49956"
FT                   /db_xref="GOA:E1QUV3"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUV3"
FT                   /protein_id="ADN49956.1"
FT                   /translation="MAIVAVDVGGTFTDFVVLRDDGTIYSIKVLSTPRSPEVAVLEGLR
FT                   KIREPISEVLHATTIGTNTLLGQVGLEIPRVALFTTKGFRDIIEIGRQNRPRLYDLFFD
FT                   KPRPLVPRELRFEVDERVMADGTVAKSVDPREVEEYAVRAKSMGVVSVAVSYLHSYINP
FT                   SNEEITDGVLRRYFKYVSLSSRVAPEPREYERTSTTVVNAVLMPIVSEYIARFSEGLKE
FT                   LGIGRFYIMSSAGGLIDANEAVERPVQLIESGPAAGAVAAAEFSKLIGVENVIGFDMGG
FT                   TTAKASSILKHEPEVTTEYEVGGEVHHGRLVKGSGYPVRFPFIDLAEVSSGGGTIIWRD
FT                   DAGALRVGPISAGADPGPICYGRGGKEPTLTDANVALGRIGEYLLGGEMRLDRDAAVKG
FT                   LSRLGDSINVALEAIRLAVVEMARAVRLVTVERGLDPRDFALMAFGGAGPQFAPYIAEE
FT                   LSINSVIVPPEPGAFSALGLLMADERFEARSSFPKDLEDGFKRLEDELLSRLGRVDYFL
FT                   RYADVRYVGQGWELTIPIGRPASMDDVERVFNDRHYATYGFRLNKPIEVVTIRVFAVIT
FT                   RVKPRFRAPRAEGEAKPRSFRRVFFDDWVETPIYWREDIPMNQVIEGPAVIEEYGSTIL
FT                   IPPRWRATVGMYGEVRMTH"
FT   gene            complement(537657..538538)
FT                   /locus_tag="Vdis_0559"
FT   CDS_pept        complement(537657..538538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0559"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1462 hypothetical protein; SPTR:
FT                   A8M967 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49957"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUV4"
FT                   /protein_id="ADN49957.1"
FT                   /translation="MRISTKDPGNVKEFRALLRVLVNGEHVEINRGIIELAKLNKVLLH
FT                   VLRVVNYEGELRWGQENGLRRVINVVSEVEDALNGIEHAFIKLIKPVVYVPADVDVLVR
FT                   RDQVLLAAARLIRRGYRLLLYEPYTITLVKDGINVDLYVHPSVADLTYARGEDFLRLKT
FT                   VGEYHGVKVSAINRSAEVVLTILHAIYKEGIITLNDALTIINWLSDDAVNLCEQLRCGR
FT                   AMELALSIVLSSIAGSLVLPYKLSMGLWFMNLLMRVLGHGEYAPSVFMGIRRIGDSRSM
FT                   TQLINRIIRISY"
FT   gene            538612..539259
FT                   /locus_tag="Vdis_0560"
FT   CDS_pept        538612..539259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0560"
FT                   /product="transcriptional activator, TenA family"
FT                   /note="InterPro IPR016084:IPR004305; KEGG: sso:SSO2089
FT                   hypothetical protein; PFAM: TENA/THI-4 domain protein;
FT                   SPTR: P95864 Putative uncharacterized protein; PFAM:
FT                   TENA/THI-4/PQQC family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49958"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUV5"
FT                   /protein_id="ADN49958.1"
FT                   /translation="MEPRELLEGIRKALEPLNETILNHPMIKDAEEGRLSINAIKAFVM
FT                   NQWYIVNHDLRSLAIALSRTRNITELEFMKMLLDGDYNALHELMKLMRELNIEIRDPLM
FT                   LEVVPEAVQYTHYLAWLANYATVQEFALAIIVNMPVWGQNVTRLGNALRSKYGIREVGF
FT                   FEAFKGPFTELENKALEVIRGIDEQSVVRARNMAYIIQNYEKAFWDAIYNVR"
FT   gene            539409..539798
FT                   /locus_tag="Vdis_0561"
FT   CDS_pept        539409..539798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: transcription regulatory protein ; K12604
FT                   CCR4-NOT transcription complex subunit 1; SPTR: Q5CKT8
FT                   Transcription regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49959"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUV6"
FT                   /protein_id="ADN49959.1"
FT                   /translation="MGPDPISLVNTARRDLQTLVNLVSNYERTKDVTILSNIVKLSLSI
FT                   YDNAINAFLAVKGIRVKDPEHMSQVAHDFIPSEVASADLRDFLIKCLSQTDCNDDYISA
FT                   RIGELGRLVDYVHSVSTHSAIHRGL"
FT   gene            complement(539795..540154)
FT                   /locus_tag="Vdis_0562"
FT   CDS_pept        complement(539795..540154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcl:Pcal_0452 hypothetical protein; SPTR:
FT                   A3MTB8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49960"
FT                   /db_xref="GOA:E1QUV7"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUV7"
FT                   /protein_id="ADN49960.1"
FT                   /translation="MVSEDVERLKRNPEILIEALNELLTTNPEALIRALMNRPETLIRL
FT                   VALTASLPLVIPTMLLRILAALANPLGSPGDMDALRARISDVERRLDDIESKMVKREDL
FT                   ESLIKELISKYGVKG"
FT   gene            complement(540197..541420)
FT                   /locus_tag="Vdis_0563"
FT   CDS_pept        complement(540197..541420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0563"
FT                   /product="Peptidase A5, thermopsin"
FT                   /note="InterPro IPR007981; KEGG: cma:Cmaq_1218 peptidase
FT                   A5, thermopsin; PFAM: Peptidase A5, thermopsin; SPTR:
FT                   A8ME39 Peptidase A5, thermopsin; PFAM: Thermopsin"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49961"
FT                   /db_xref="GOA:E1QUV8"
FT                   /db_xref="InterPro:IPR007981"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUV8"
FT                   /protein_id="ADN49961.1"
FT                   /translation="MGKFSLLMIPYVNYAMRLGDTVLIIVIALMALVFLVNPSLDSLVL
FT                   SGINYVINSVINSTVTMPVTKPASGPCTSWGLVNVNLTNSESLFIEVVNGSYVYLLTNS
FT                   QLHSWGGGPEAPSNYTWFSSVPGIYVVSPGPGSYGLLVCGNTGIAYRILNYTAMGIAAY
FT                   YGPGYSNITSDAVLGLFNITNAYVENSTGAAGPGFSLQLNAYVVIKYGGNYMVHWVQDA
FT                   LVVVDGQYWFQGEMDVVNYVGSSRNVVYEQGRCVLGCFETPMAGLLIISVNSTGYGVVI
FT                   NFGYSLLQLGNETFSPRVYWFAHELIPIPNATAYIVTSPTEGPYGWPMDTEFVIGGPGN
FT                   GGGVEFRSLDAYLSLLYWNGTSWAPYPITYSFGISTGEYAVNVYVLPIGPSTAELVVGH
FT                   NNYQQLGG"
FT   gene            541483..542159
FT                   /pseudo
FT                   /locus_tag="Vdis_0564"
FT   gene            542515..543567
FT                   /locus_tag="Vdis_0565"
FT   CDS_pept        542515..543567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0565"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mse:Msed_0801 hypothetical protein; SPTR:
FT                   A4YEX4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49962"
FT                   /db_xref="GOA:E1QUV9"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUV9"
FT                   /protein_id="ADN49962.1"
FT                   /translation="MGLSNWWYYTGSATKAITITGIIAIALLATVIASPHVKPLQPIAK
FT                   SLGLIQTQVQTVYVPVNHTVVKYVNQTVVKYVNQTVPVYVNRTVYVYVGNASLAPIVAM
FT                   AGKCAGDLVILPNNTAWFVFAWLIPKEYLVGNPVLYRALVANGIPPIYYNSTNHYAQLY
FT                   GLLDTAFFGLSPKPMSLYTYNACYLDNVTFNGYYIAICGDTTGGGPFAVSAGEFPPAGI
FT                   INVSGIYYQRITLLQFSDQPAFVGSQLILSNRTYSNATLVIPSVNTTYTGVMFIYGGVT
FT                   VGRNLGYPLSTLGPACNITVIYAPNPQAALYITLPQEYINYWRESVNTIWGYYNPNDVY
FT                   MGYWVWNYPS"
FT   gene            complement(543607..545685)
FT                   /locus_tag="Vdis_0566"
FT   CDS_pept        complement(543607..545685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0566"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q8TGE1 Cell wall
FT                   protein AWA1"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49963"
FT                   /db_xref="GOA:E1QUW0"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUW0"
FT                   /protein_id="ADN49963.1"
FT                   /translation="MGKSPGVTMRLVRCYYSWMVVWLLLGPWVMPVVMRCLVMALADLV
FT                   LEGLTLILAIALGLVLIGGLAYLTITVSTVNNARLAYAGLYIYLPQPIYVNGTLYVPMY
FT                   NIGYYRAIVKYVYVRGVDGSMHVYAPNLVLGVNQYYVYTLSLSYEPASITVLASPVGYP
FT                   GIIKEFSANVSTVTSIPLIPQAQLQPGSGLINVVVNDPFGAGWRVVWSYAGQSYSVSES
FT                   QSYSWFINPPYVPIQIQFLAYITNTPHGYTCQIVPSQVAKTYTAGSIQAFNVTCSVMPI
FT                   TVSVDDPYGAGWSVSWSGGASGSKSGSSSASWTVSALSTVNFQASITSVPSGYSSCSIS
FT                   PTSTSAGPGQSVAFTVSCTGNQSPSPPPGGGGSSYTVTVYVYAPSGVSWTVYLDQYIAG
FT                   STIDIDWWSGAGNGGPYTATVSGGLTYLFTVKNLPSGCTASGSPYGIGQTFTPKGSFTE
FT                   QITITCTNKPPPPPPPPPSNNQQCTYSYSSSISASGVHGSIQQSVSCSGPSSEPVGSGQ
FT                   VGMYGCTAPLTITDTSGDEFQFQSWSVSVSPSGYAWSGTTDLSEFGAPLYCPSPASVSI
FT                   SGTASYTFLKCTSYTVKFTYYTSSSATFEWSFCPDDPANSWSATGKIYQGTGIQVTAKV
FT                   YANFGSGSASFTIDNVCQYGVQSVNTNPSGGSASGFTGSASFNIIVVCQSSGGKGKQ"
FT   gene            545811..546506
FT                   /locus_tag="Vdis_0567"
FT   CDS_pept        545811..546506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0567"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mae:Maeo_0852 hypothetical protein; SPTR:
FT                   A6UVB2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49964"
FT                   /db_xref="GOA:E1QUW1"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUW1"
FT                   /protein_id="ADN49964.1"
FT                   /translation="MPGKVLVVGVVVAVVVIAIALILLMHPFASKPSVAYLTVNAPYAF
FT                   LRPLGSGQYELFYYDQQGNLHDLGTYNVSSTVLSEAVNEINSFNQQNAGTMINGQNFIP
FT                   LSYEVVIGNSTGVVKIPIQGDTILLDKVNPGYWTVLVTDQNDLTKLAYALDVGYKEAAI
FT                   VASTSDLWYQPGVGTVLTETLNLQSMSGFVGGYVIVMNNGTLVPWGFGGGNTGYYLQFI
FT                   TQASGTGYS"
FT   sig_peptide     545811..545915
FT                   /locus_tag="Vdis_0567"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(546509..547123)
FT                   /locus_tag="Vdis_0568"
FT   CDS_pept        complement(546509..547123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sso:SSO1985 hypothetical protein; SPTR: Q97WX6
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49965"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUW2"
FT                   /protein_id="ADN49965.1"
FT                   /translation="MLFLNPIISEVIVWGGNNYAGTTPYIPLTPRDQQKNQNYMYHGVF
FT                   YTYYWFSLDESNKYALDVYFMVNGNIYNNNLPMQFVPSIGAYALSPLSPSTYLATSYQN
FT                   AYQTAFEAEGNVTLNLYNTIDYNSLKSEFINGTFGYNERYYSFVIGQENTINEPPLVEE
FT                   IANYIDTPYLFISTGSGGGDGYMYLNWIIATFGVPYELVIP"
FT   gene            548231..549916
FT                   /locus_tag="Vdis_0569"
FT   CDS_pept        548231..549916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0569"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpe:Tpen_0559 hypothetical protein; SPTR:
FT                   A1RXN5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49966"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUW3"
FT                   /protein_id="ADN49966.1"
FT                   /translation="MDGKNGIKGQTPDDAVGKPTADELKPHRLGVYGGDTESGEGRGDK
FT                   PTRLPMLREGHAADWGPAIRICWGVKVKGKRRPRCGEEVSDVRVIEEVMKLINEFLDRV
FT                   ERHRDVLLGESTTPFDKAINDLNGWLMAMEEKAKESNDPTTTELRKAMIDIGRKMLQLA
FT                   RQARKKWLTAYRKELEELIEKLRRGEIMIIVRGEALNKNKSFGIYFYARNITIIISKVA
FT                   NSNSVIIHTVLVGLRGTDIVIPRLFGDDVLKPMRYGLMMTDGSIDKRGYLVMNTNQLWQ
FT                   SVMWILTWPGRNAMCIASMNLNETNVNIKWRLTAVDHRNEVESKTKVAEEVSKLSDEEF
FT                   LTFLLFTIFGDGDINVGVKRIGLTIGDLKHELWRGIIERIKNLGFKDHNNRNTKEYMIH
FT                   SSKAVELARKWLSNALIRVMIEDLSSLPDAEKLRRLVALASAKVKPRGRSSVEVAGVRM
FT                   NVRVGNNRVELVIMRSRLEDAETILKKLRNAGYNAKLSKRNKNFAVYINNDEIKKYPEL
FT                   VAKVCEVLRRMHEEAVNEGKTERAWRVAKAMANLNCPAQGPRAQ"
FT   gene            550084..550353
FT                   /locus_tag="Vdis_0570"
FT   CDS_pept        550084..550353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0570"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1225 hypothetical protein; SPTR:
FT                   A8ME46 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49967"
FT                   /db_xref="GOA:E1QUW4"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUW4"
FT                   /protein_id="ADN49967.1"
FT                   /translation="MPFTCLYCSRAIRIRSVHAVFRWRLLVFVFSHSMCLYTVYDIASL
FT                   WATLTALGMGERPSGRGIVGVSLVITTITFTLLVYGCRKAQGAH"
FT   gene            complement(550307..550588)
FT                   /locus_tag="Vdis_0571"
FT   CDS_pept        complement(550307..550588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0571"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ele:Elen_1951 DNA ligase D"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49968"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUW5"
FT                   /protein_id="ADN49968.1"
FT                   /translation="MRAALDAGADVVQFDAPDILQFDVYGEYNPDKGRAKERVRRAVEL
FT                   NNEVLSKLPTEHFKRIQVIINCWVILPNLLSVLINELPGPCGIHTPIM"
FT   gene            550744..551202
FT                   /locus_tag="Vdis_0572"
FT   CDS_pept        550744..551202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0572"
FT                   /product="PaREP1 family protein"
FT                   /note="InterPro IPR010268; KEGG: cma:Cmaq_0294 PaREP1
FT                   protein; PFAM: PaREP1 family protein; SPTR: A8MAV6 PaREP1
FT                   protein; PFAM: Archaeal PaREP1/PaREP8 family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49969"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUW6"
FT                   /protein_id="ADN49969.1"
FT                   /translation="MEELLRLINEESRKRGVTTELFLADLLAQRLDPKDRVYIYLKIHE
FT                   ELLKHSDEEYVKGDLVQASEKLWGAVAALLNAIAEARGWEHYSHRDYDVIINRLFRETG
FT                   DKDLPLYFGAAERLHANFYHNFMTKDEYELHREYVLRLINKLRDLLKR"
FT   gene            551272..552297
FT                   /locus_tag="Vdis_0573"
FT   CDS_pept        551272..552297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0573"
FT                   /product="Vitamin B6 biosynthesis protein"
FT                   /note="COGs: COG0214 Pyridoxine biosynthesis enzyme;
FT                   InterPro IPR011060:IPR001852:IPR013798; KEGG: pas:Pars_0228
FT                   pyridoxal biosynthesis lyase PdxS; PFAM: Vitamin B6
FT                   biosynthesis protein; Indole-3-glycerol phosphate synthase;
FT                   SPTR: A4WHH6 Pyridoxal biosynthesis lyase pdxS; PFAM:
FT                   SOR/SNZ family; TIGRFAM: pyridoxine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49970"
FT                   /db_xref="GOA:E1QUW7"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUW7"
FT                   /protein_id="ADN49970.1"
FT                   /translation="MSVAPSFEYLEKLRDFFYGMLELRDRLRERGFSWPRPYELDGIIT
FT                   GTVKVKVGFPSMLRNGVIMDVTNVEQAQIAEEAGAVGVMVLDKLPYDVRKAGGVARMAD
FT                   VKVIEDVMRHITIPVSAKVRIGHYYEAFILEQIGIDLIDESEVLTPVDEQHHINKWLFS
FT                   VPFVNGCRELCEALRRISEGASMIRSKGEAGTGNVSEAVKHFKVLYKAINELYAAYGDG
FT                   DEEKLRDFARQCQVPIELVTLTARLGRLPVITFAAGGIATPADAALMMWLGADGIFVGS
FT                   GIFKSQDPRERAEAIVIATAHWDDPEVVVEAQRMVSEKASMMGIDIRSLKPEELLQVRG
FT                   V"
FT   gene            552290..552913
FT                   /locus_tag="Vdis_0574"
FT   CDS_pept        552290..552913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0574"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="COGs: COG0311 glutamine amidotransferase involved in
FT                   pyridoxine biosynthesis; InterPro IPR002161; KEGG:
FT                   pis:Pisl_1336 glutamine amidotransferase subunit PdxT;
FT                   PFAM: SNO glutamine amidotransferase; SPTR: A1RU67
FT                   Glutamine amidotransferase subunit pdxT; PFAM: SNO
FT                   glutamine amidotransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49971"
FT                   /db_xref="GOA:E1QUW8"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUW8"
FT                   /protein_id="ADN49971.1"
FT                   /translation="MSSVRVGVLALQGDVEEHEYAIKRASEELGINVDIIRVKKTEQLS
FT                   DLSALVIPGGESTTIGSLARRVGLLDRLRDSIINGLPTLGTCAGAIFMAREVRDSVVGE
FT                   TGQPILGVMDIAVVRNAFGRQRDSFETDLSIDGIGTVRAVFIRAPAIVRAWGNARALAY
FT                   VKHPRLGNVIAAAQEGDMMATAFHPELTTTKVHKYLLELALGKH"
FT   gene            553095..553397
FT                   /locus_tag="Vdis_0575"
FT   CDS_pept        553095..553397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0575"
FT                   /product="phosphoribosylformylglycinamidine synthetase
FT                   PurS"
FT                   /note="InterPro IPR003850; KEGG: cma:Cmaq_0662 hypothetical
FT                   protein; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; SPTR: A8MCJ6 Putative uncharacterized protein; PFAM:
FT                   Phosphoribosylformylglycinamidine (FGAM) synthase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase, purS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49972"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUW9"
FT                   /protein_id="ADN49972.1"
FT                   /translation="MNEAVGRYLVHVAIVLKGSRDPEGETILRDLVLASGFSDVNRVVS
FT                   GKYLGFIVRARDDAEAVRYVRDVCEKTRVFNPTVHRLIILGVENAEGSGDQVSRY"
FT   gene            553360..554031
FT                   /locus_tag="Vdis_0576"
FT   CDS_pept        553360..554031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0576"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="COGs: COG0047 Phosphoribosylformylglycinamidine
FT                   (FGAM) synthase glutamine amidotransferase domain; InterPro
FT                   IPR010075:IPR017926; KEGG: cma:Cmaq_0661
FT                   phosphoribosylformylglycinamidine synthase I; PRIAM:
FT                   Phosphoribosylformylglycinamidine synthase; SPTR: A8MCJ5
FT                   Phosphoribosylformylglycinamidine synthase I; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I; PFAM:
FT                   Glutamine amidotransferase class-I; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49973"
FT                   /db_xref="GOA:E1QUX0"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUX0"
FT                   /protein_id="ADN49973.1"
FT                   /translation="MPRVAVIRFPGTNGDLDVIHVLRNVVRVDAELVWHEDFRHGIYDA
FT                   VVVPGGFSYGDWLRAGAIAARSRAMKEVVMDAEGGVPVLGICNGFQILVEAGLLPGALL
FT                   PNDPPRFIAKWVWVRVNDAKTPFTRLYEPGEVISMPIAHGEGRYFIDNIDEVKVAFTYF
FT                   GENPNGSVASIAGVVNYEGNVLGLMPHPERSAEAVLAPRGFMPGGLKLWLSLRESLRGG
FT                   W"
FT   gene            554031..555230
FT                   /locus_tag="Vdis_0577"
FT   CDS_pept        554031..555230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0577"
FT                   /product="ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp"
FT                   /note="COGs: COG0027 Formate-dependent
FT                   phosphoribosylglycinamide formyltransferase (GAR
FT                   transformylase);
FT                   InterProIPR016185:IPR003135:IPR011761:IPR013817:IPR
FT                   013815:IPR013816; KEGG: cma:Cmaq_0660
FT                   phosphoribosylglycinamide formyltransferase 2; PFAM:
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; SPTR: A8MCJ4 ATP-dependent carboxylate-amine
FT                   ligase domain protein ATP-grasp; PFAM: ATP-grasp domain;
FT                   TIGRFAM: phosphoribosylglycinamide formyltransferase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49974"
FT                   /db_xref="GOA:E1QUX1"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUX1"
FT                   /protein_id="ADN49974.1"
FT                   /translation="MEFGPPLLEDSRKIMLLGSGELGKEMAIEAQRMGVEVIAVDRYDM
FT                   APAMHVAHRRYVINMLDGNAIKALVRREGPDAIIAEIEAINTEALIELEEEGFRVIPNA
FT                   RAVKICMNRIELRRLAAEKLRLPTTKYFFAEDAEDVRRACKDLGFPCLIKPEMSSSGHG
FT                   HVLISSYEDAERGFREALVHARGGGRRVVVEEYVKIDRELTVLTYRYPLGGNAVIATIP
FT                   PIEHQRPEGIYHYVESWHPATVGGDVVERAREYAIKVVNELGGFGIYGVEILITKDGRI
FT                   LFSEVAPRPHDTGLVTLVSTDINEFQIHVRSALGLPTPEVKLVTPAAAHVILADTETWT
FT                   PRITGLEEALRIPGVQVRLFGKPFTYRHRRMGIVLATGNTVQEAREKARLAASLIKVSR
FT                   "
FT   gene            complement(555280..556683)
FT                   /locus_tag="Vdis_0578"
FT   CDS_pept        complement(555280..556683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0578"
FT                   /product="General substrate transporter"
FT                   /note="InterPro IPR016196:IPR005829:IPR005828; KEGG:
FT                   siy:YG5714_1046 general substrate transporter; PFAM:
FT                   General substrate transporter; SPTR: C3NDC9 General
FT                   substrate transporter; PFAM: Sugar (and other) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49975"
FT                   /db_xref="GOA:E1QUX2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUX2"
FT                   /protein_id="ADN49975.1"
FT                   /translation="MNTVNNPFKPLDDISMRSFHLKYMLVAAMGTFTDGYDLTVLGVVL
FT                   PYVLMSYGISSLKSPAGVFWSIWLNALPVLGFFVGAPLFGYLSNLGRKTFYGWDALLMA
FT                   VGAAFQPFMPNLILLGVARFIMGIGLGADYVLSPTIIAEVSNARDRGKLLALGFGGFWI
FT                   FGSAVAAIAVLIMLIAGFNPGLIWRVALGIGAVWPAGVIYLRRRFPETPRYSVIIAKNF
FT                   EEFRRFMMAIFGAHYNIQPQHGTLNHEEAEEIMLFRKYLKYIALGALLWLIFDIPAYGL
FT                   NFFVSYIAQSIKMTPVYLQLLGTAFTLPGIVLAWLLLDRWGRRNAQGYGFLLTGLTFLI
FT                   FSYFVYTYSRSPNAAALLFLPTIISFGLAKTWMQMGPGSVVAVGAHGVEFSPTKIRGIG
FT                   QAINVISGRTGVLITTFVFPTLFVASSYTAYIFLGLVSVIGAVLTFTLIPETKGLGLED
FT                   ISLRLSGDS"
FT   gene            complement(557163..558638)
FT                   /locus_tag="Vdis_0579"
FT   CDS_pept        complement(557163..558638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0579"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="COGs: COG0151 Phosphoribosylamine-glycine ligase;
FT                   InterProIPR016185:IPR011054:IPR020562:IPR020561:IPR
FT                   020560:IPR000115:IPR011761:IPR013817:IPR013816; KEGG:
FT                   cma:Cmaq_0663 phosphoribosylamine--glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, N-domain;
FT                   Phosphoribosylglycinamide synthetase, C-domain; PRIAM:
FT                   Phosphoribosylamine--glycine ligase; SPTR: A8MCJ7
FT                   Phosphoribosylamine--glycine ligase; TIGRFAM:
FT                   phosphoribosylamine/glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, N domain;
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, C domain; TIGRFAM:
FT                   phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49976"
FT                   /db_xref="GOA:E1QUX3"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUX3"
FT                   /protein_id="ADN49976.1"
FT                   /translation="MIRSKVLIVGDGAREHALAVRLSLSVHEPRVSALVAHENPGIKRV
FT                   VERTGGELVRSRLDPSGLVKAIDRVNPDIVVIGPEEPQFAGVADKAIELGIPTFGVPRS
FT                   LAIIEQSKAFARALMWRHRIPGRIAFRAFRDIDEALRYVSNAGSVAIKPARQSGGKGVR
FT                   VFWDRQAYLKDGVNKAKMSQVIAASSDVKAYGDIDDLIVVEEAVTGVEYTVQVISDGRS
FT                   IIALPPIQDHPHVFDHDIGPECGGMGAIVGPGPSLPFITQEEYEESIEIVRKTLDALQH
FT                   EVGLRYVGVLSGQFMLTTYGPTLIEYYSRFGDPEVLNALAMLDGDLLEIIEAAVEGKLS
FT                   SVKYSFKEGVVAISKAVAPLGYPHNRDLARGRSITIDMGEIGRLGCEVYFGSVTEEGGT
FT                   YRTLGSRAVEVLAVGNTYEETHERVENCIANIKSPDWQLIHRRDIGSRELLERRMREAE
FT                   RVRTVYRWRRSHGLGRVRIDWVPGGEVTIYDYT"
FT   gene            558823..559542
FT                   /locus_tag="Vdis_0580"
FT   CDS_pept        558823..559542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0580"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamides
FT                   ynthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="COGs: COG0152
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
FT                   synthase; InterPro IPR018236:IPR001636:IPR013816; KEGG:
FT                   cma:Cmaq_0664
FT                   phosphoribosylaminoimidazolesuccinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase; PRIAM:
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide synthase;
FT                   SPTR: A8MCJ8
FT                   Phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase; TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49977"
FT                   /db_xref="GOA:E1QUX4"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUX4"
FT                   /protein_id="ADN49977.1"
FT                   /translation="MVDNWVGELIYEGKAKRVYKVNDELLIMEFKDEVTAFDGARKEHA
FT                   PGKGRLAAAQTVFFMQLLGKYGIRNHLVDWDGDRKILVKSLRMIPIEVIVRNYAYGSFL
FT                   KRMPLVKPLTKFRKPLVEFHLKSDELHDPLITTDDIIEAGLVNYGQLNEIINTALRVNS
FT                   ILSEFMASRGLTLVDFKLEFGFDKSGNIVLADEISGDTMRILINGRHLDKELFRKGASA
FT                   LDLVRAYEEMNRLLNIP"
FT   gene            complement(559539..560540)
FT                   /locus_tag="Vdis_0581"
FT   CDS_pept        complement(559539..560540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0581"
FT                   /product="Phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="COGs: COG0150 Phosphoribosylaminoimidazole (AIR)
FT                   synthetase; InterPro IPR010918:IPR016188:IPR000728; KEGG:
FT                   cma:Cmaq_0665 phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein; PRIAM:
FT                   Phosphoribosylformylglycinamidine cyclo-ligase; SPTR:
FT                   A8MCJ9 Phosphoribosylformylglycinamidine cyclo-ligase;
FT                   PFAM: AIR synthase related protein, N-terminal domain; AIR
FT                   synthase related protein, C-terminal domain; TIGRFAM:
FT                   phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49978"
FT                   /db_xref="GOA:E1QUX5"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUX5"
FT                   /protein_id="ADN49978.1"
FT                   /translation="MGWTYEKAGISLAKHWEMHSIAREVIHELSNELGIGLVEGGFTRS
FT                   INLGNYEVTLHTDGVGTKSMVAWSTGRLEVIGWDCVVGNVNDIACDGFSPMALTDYIAI
FT                   SSNDADAVGKVLRGIRDAALRVGAVLLGGETAIMPDLVNGIDVSCTVLGIRRVRAVGNA
FT                   APGDVVIGIESNGLHMNGYTLARKVLLGRYGVNDEICGDELGNWLLRPTAYYGDLLTKL
FT                   YGRGLIKAAVHVTGGGFTKLRRAIGELGVELEVPEPPCIFRVIKEVGNVGWDEMYRVFN
FT                   MGVGLMVLTSEGQVGEVTSVIREAGFNYWVLGKVTSSGGISILMPNGVKLRL"
FT   gene            complement(560524..561750)
FT                   /locus_tag="Vdis_0582"
FT   CDS_pept        complement(560524..561750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0582"
FT                   /product="Amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="COGs: COG0034 Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase; InterPro IPR000836; KEGG: cma:Cmaq_0666
FT                   amidophosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; PRIAM:
FT                   Amidophosphoribosyltransferase; SPTR: A8MCK0
FT                   Amidophosphoribosyltransferase; PFAM: Phosphoribosyl
FT                   transferase domain; TIGRFAM:
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49979"
FT                   /db_xref="GOA:E1QUX6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUX6"
FT                   /protein_id="ADN49979.1"
FT                   /translation="MVVAGVIGVVSFHDGWDVGEILRYALPVLRHRGDDAWAVTLGKGG
FT                   VLTGRQVRDEDQIPSGEAGLLCLGTDGDARGIVRCGHADVAYCLEGLIVRPQDVCRLIN
FT                   GEVKAFPYTSLVALTSDGELIAHRPITGLRGLAIGAYGFDLAMVSNESSAIDALGGDVR
FT                   TFIRPGSTVRISRLNLTIQEGPGGSRGMLCAMEFIYLSRPDSVFDGHPIYEFRRALAVK
FT                   LAGRLMGRVDDVDIVIGMPETGVIYGIKVAESLRKPFEYALINIERRRSALRRELLDKL
FT                   SSIHLKLSPVTSAVSGRRVLLIDDSLLTGLSIKEASQVLRHRAGVSEVHVAIASPKVVR
FT                   SCPYGVDMPPNNQLLANAFNDENAQRVLEVDSLTWLSLEDLYEAADEVGIGRDSLCTYC
FT                   FGGAHGLDL"
FT   gene            complement(561744..563075)
FT                   /locus_tag="Vdis_0583"
FT   CDS_pept        complement(561744..563075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0583"
FT                   /product="Amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="COGs: COG0034 Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase; InterPro
FT                   IPR000583:IPR000836:IPR005854:IPR017932; KEGG:
FT                   cma:Cmaq_0667 glutamine amidotransferase class-II; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; PRIAM:
FT                   Amidophosphoribosyltransferase; SPTR: A8MCK1 Glutamine
FT                   amidotransferase class-II; PFAM: Phosphoribosyl transferase
FT                   domain; Glutamine amidotransferases class-II; TIGRFAM:
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49980"
FT                   /db_xref="GOA:E1QUX7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUX7"
FT                   /protein_id="ADN49980.1"
FT                   /translation="MGCNVMCGIWAFLGHNAGNYVVKLTPWLIHRGQEGVSFVCRVNGS
FT                   FMKVGDASTVASTLCLGHARYSTSGPYGVELQPIVLGNDFALVFNGTITNYVDLIRVLR
FT                   GLGVDVGVNYDALVLAHYMRELLVRLGVDDGIRELFRTVRGGYSIIAIWRDSLIVVRDP
FT                   WGFRPLVIGGDGNGIAIASESAALEALGMAWREVEPGKALVLRGSGREYWVDGPRVRRA
FT                   YCALEYIYFLRPDSQFNGISVYEARRRLGMALARKEAVHDIDFVSPIPETARIAAEAYA
FT                   SGIGKPIHELVVKNRYAGRGFIKPPGERSLDMYGVVKSAVRGASVALVDDSIIRGDTLR
FT                   KILPKLRASGARAIHVRVSSPPIRYPCFMGMDFPTRRELVAHGRSIDEVREYLGANSLV
FT                   YLTVDELMDAIGTTELCTACFTGNYPFTVNIDDAEKAFTGGRSW"
FT   gene            complement(563060..565240)
FT                   /locus_tag="Vdis_0584"
FT   CDS_pept        complement(563060..565240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0584"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="COGs: COG0046 Phosphoribosylformylglycinamidine
FT                   (FGAM) synthase synthetase domain; InterPro
FT                   IPR010918:IPR016188:IPR000728:IPR010074; KEGG:
FT                   cma:Cmaq_0668 phosphoribosylformylglycinamidine synthase
FT                   II; PFAM: AIR synthase related protein domain protein; AIR
FT                   synthase related protein; PRIAM:
FT                   Phosphoribosylformylglycinamidine synthase; SPTR: A8MCK2
FT                   Phosphoribosylformylglycinamidine synthase 2; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase II; PFAM: AIR
FT                   synthase related protein, N-terminal domain; AIR synthase
FT                   related protein, C-terminal domain; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49981"
FT                   /db_xref="GOA:E1QUX8"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUX8"
FT                   /protein_id="ADN49981.1"
FT                   /translation="MPLSDNEKSVIRKSLGREPTQAEWLVFEAEWSEHCSYKSSRRFLK
FT                   LLPSGAPHVIRGPGLDAPLIRVGNLVVSFKIESHNHPSAVDPYDGAATGVGGIVRDILT
FT                   TGLRPIALMDNLHFGPPNNPHSQWLMRNVVRGISDYGNRIGVPVVAGEVWFDESFTTNP
FT                   IVLVTCIGVGRPEDVVVGEASPGDIVLVIGNDVGRDGMLGSSFASKILERNEDNIGAVQ
FT                   VGNPLLEKLLIDALIELRGRGLVKAIKDVGGGGLATALSELADQFGLGIEVHLDRIRTR
FT                   EGMAPEEILVSESQERMVIVVSKEGLDEVEGILRRYGVGYDVVGVLTNNGMFVAYYGGE
FT                   AIVNLPVKLITHAPETNYDIREPHYLGELRAIPELPDVPLEEALTKILSDPNMASKEPI
FT                   FSLYDYEVGVRTVIKPGRAGAAVLRLLDVDGGDGKLGIAVKADANPRYSFLDPFIGAAN
FT                   SLAKAYRNVVAVGAEPLAAVDSINVGNPEKPDRYWYFVNSVLGLAWFARELGIPVVGGK
FT                   VSFYNEDSRGNVIKPVVAVAVLGRVDDVDEAVDGGLIGDGALIIIGNTSNEMGGSEYLY
FT                   AVHGIVRGIPPRPRPRDEVRNSRAILRLIHEGLVTASMDVGVGGLLTTLSKMALINGVG
FT                   FNIDLSRVPTDECGIDPTALAFSETNARYVIEVRNKDVDRAMGILSSLGVPFSVIGGSG
FT                   GDHLVVRWGHHELMSLKLNDLKTAYNSLWGVM"
FT   gene            565343..565828
FT                   /locus_tag="Vdis_0585"
FT   CDS_pept        565343..565828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0585"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="COGs: COG0041 Phosphoribosylcarboxyaminoimidazole
FT                   (NCAIR) mutase; InterPro IPR000031; KEGG: cma:Cmaq_0669
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; PRIAM: Phosphoribosylaminoimidazole
FT                   carboxylase; SPTR: A8MCK3 Phosphoribosylaminoimidazole
FT                   carboxylase, catalytic subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM: AIR carboxylase; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, PurE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49982"
FT                   /db_xref="GOA:E1QUX9"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUX9"
FT                   /protein_id="ADN49982.1"
FT                   /translation="MNTKPLVGVIMGSKNDWDVMREAVELLNQLGIPNEARVVSAHRTP
FT                   EFMFEYAKTALDRGLEVIIAGAGGAAHLPGMTASLTPLPVIGVPIPSKHLNGLDSLLSI
FT                   VQMPYGTPVATVAIGNARNAALLAARILGIKYPSIRAKVIELMESMKSEVLNTALSL"
FT   gene            565825..566949
FT                   /locus_tag="Vdis_0586"
FT   CDS_pept        565825..566949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0586"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="COGs: COG0026 Phosphoribosylaminoimidazole
FT                   carboxylase (NCAIR synthetase);
FT                   InterProIPR016185:IPR011054:IPR006140:IPR003135:IPR
FT                   005875:IPR011761:IPR013817:IPR013816; KEGG: cma:Cmaq_0670
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; PRIAM: Phosphoribosylaminoimidazole carboxylase;
FT                   SPTR: A8MCK4 Phosphoribosylaminoimidazole carboxylase,
FT                   ATPase subunit; TIGRFAM: phosphoribosylaminoimidazole
FT                   carboxylase, ATPase subunit; PFAM: ATP-grasp domain;
FT                   TIGRFAM: phosphoribosylaminoimidazole carboxylase, PurK
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49983"
FT                   /db_xref="GOA:E1QUY0"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUY0"
FT                   /protein_id="ADN49983.1"
FT                   /translation="MSRVLGILGGGQLGLMMILESRKLGIKFLVHDEDPEAPALGVADG
FT                   KYVGNSWRELVHKSDVVTFEFEHVNPNAVSTAESLGKLRPNSLTIWLKQDKIREKVFLR
FT                   DNGFPVPNFMIINGPEDVDRAFEQFGRVVFKEPQGAYDGRGQYYVMKREDLSKVPRKFP
FT                   LLAEEFVDIRKEVSVVLVRSSSGEVLTYPVTENYHYNGILLYSIAPAEVDEEVANKARE
FT                   IAVRLANALNYVGVLTVEFFITREGDVLINEFAPRVHNSGHWTLMGAAVSQFENHVRAV
FT                   LDMPLGPTTLLRPSGIVNMLGVPYDEEVIKRVLAIPGTSVWWYGKARVRPRRKMGHINI
FT                   VADTTNELRKRINEVLGIVYGNEIDKYVPPWSSV"
FT   gene            complement(567124..567573)
FT                   /locus_tag="Vdis_0587"
FT   CDS_pept        complement(567124..567573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpe:Tpen_1299 hypothetical protein; SPTR:
FT                   A1RZR7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49984"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUY1"
FT                   /protein_id="ADN49984.1"
FT                   /translation="MSVRVGRIKYGSFAYVGRIRVGNKAVEEVALLNSGFEAPTPQLLI
FT                   PISTARALGLWPPTEDAREVRVDTAGGPLNVWFYPRAATVKVVTGDAESREVLVDVLVS
FT                   PLADEPLISDLLADELEIIVESFGKGLWRFRSDPPGKLRPSEGKR"
FT   gene            complement(567613..569103)
FT                   /locus_tag="Vdis_0588"
FT   CDS_pept        complement(567613..569103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0588"
FT                   /product="exsB protein"
FT                   /note="COGs: COG0603 PP-loop superfamily ATPase;
FT                   InterProIPR000583:IPR018317:IPR004479:IPR017932:IPR 014729;
FT                   KEGG: cma:Cmaq_1261 ExsB protein; PFAM: Queuosine
FT                   synthesis-like; glutamine amidotransferase class-II; SPTR:
FT                   A8ME82 ExsB protein; TIGRFAM: exsB protein; PFAM: ExsB;
FT                   TIGRFAM: exsB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49985"
FT                   /db_xref="GOA:E1QUY2"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUY2"
FT                   /protein_id="ADN49985.1"
FT                   /translation="MCTIGGVLIFGDRLDRDRAKRIEEVLRMIVVKGEERGRDSFGIVA
FT                   LDKNGELNVFKSRDRPSIAVSRMPSIINENTVAAIFNNRAEPTTEYVRAKTEDDIQPMI
FT                   GEHVVVAHNGTIANDKDLETKFNLTRRSRIDTAILPPLLERLWDGSLNGLRDVLINHVI
FT                   GSYALAIMDTRRPGKVWLATNFKPLYMAWYSDLKALFFASLDDYLVNDQGRPIWDMPTI
FT                   RRVEPYTAMEIGIDGTWSTVSLRREEQGRRRRVLVIASGGLDSTTAATYLLKQGYDVAL
FT                   LHFNYGHRAETQEDRAIRRIAEFLGVPLLEVSMDFFKVVRHSPLLGDGEINRVDEGREG
FT                   AEFAHEWVPARNFVFIALATAIAEAYGYDYIATGINLEEAGAYPDNEMEFIRLLNKVMP
FT                   YAVGPNKHVELLMPVGHLVKHEIVKLGLEVGAPLHLTWSCYDNGERHCGRCGPCYMRRW
FT                   AFRINGVRDPVEYDLPVEVEEEFWRDARPYKIPKRPSK"
FT   gene            complement(569137..569799)
FT                   /locus_tag="Vdis_0589"
FT   CDS_pept        complement(569137..569799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0589"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG0602 Organic radical activating protein;
FT                   InterPro IPR007197; KEGG: pas:Pars_1091 radical SAM
FT                   domain-containing protein; PFAM: Radical SAM domain
FT                   protein; SPTR: A4WJV2 Radical SAM domain protein; PFAM:
FT                   Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49986"
FT                   /db_xref="GOA:E1QUY3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUY3"
FT                   /protein_id="ADN49986.1"
FT                   /translation="MKSVRVIEIFKSWQGEGPNAGREAVFLRLALCNLRCSWCDTKYSW
FT                   FGGTEMNVHDVYEVLMKTAGGVRHLVVTGGEPLLWSRELLQLLRFIRAQGFFVEVETNG
FT                   TLRPGELVNYVDEFNVSPKLSNSGVSVRVRVNELAIRDFVMSGKAIFKFVVDKPGDVDE
FT                   VLWFINKFGIPRDRVYLMSQCTTREECIAKDEGVTKPMAMKLGVNYTPRLHILMGFK"
FT   gene            569806..570675
FT                   /locus_tag="Vdis_0590"
FT   CDS_pept        569806..570675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0590"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="COGs: COG1893 Ketopantoate reductase;
FT                   InterProIPR008927:IPR016040:IPR013332:IPR013752:IPR
FT                   003710:IPR013328; KEGG: pcl:Pcal_0383 2-dehydropantoate
FT                   2-reductase; PFAM: Ketopantoate reductase ApbA/PanE domain
FT                   protein; PRIAM: 2-dehydropantoate 2-reductase; SPTR: A3MT51
FT                   2-dehydropantoate 2-reductase; TIGRFAM: 2-dehydropantoate
FT                   2-reductase; PFAM: Ketopantoate reductase PanE/ApbA;
FT                   Ketopantoate reductase PanE/ApbA C terminal; TIGRFAM:
FT                   2-dehydropantoate 2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49987"
FT                   /db_xref="GOA:E1QUY4"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QUY4"
FT                   /protein_id="ADN49987.1"
FT                   /translation="MLILRVNQGLMMFGIIGLGGVGILLAHFLNNAGYVPYVVTRTHYG
FT                   RYVIKFGEEREVRVRLVDKLPSDVKYTLIAVKAYDTESIIDKVVNIPVIFQNGIGGVEL
FT                   IRKRLGVGYGAVITYGVTRSGSVAEVRGVGEVILPSSVGEVADVLRAGGANVRVVDDIE
FT                   PYRWLKVIVNAAINPITAILRARNGVILEDPNARALVEAVVREGVDVVNRLGIRLPSDP
FT                   LVETLRVAEATRDNQSSMLQDVLNRRRTEVDYINGAIVTRGREVGVSTPVNYVLWLLVK
FT                   SLEVNAYK"
FT   gene            570696..571784
FT                   /locus_tag="Vdis_0591"
FT   CDS_pept        570696..571784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vdis_0591"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazolephosp
FT                   horibosyltransferase"
FT                   /note="COGs: COG2038 NaMN:DMB phosphoribosyltransferase;
FT                   InterPro IPR003200:IPR002805; KEGG: sai:Saci_0020
FT                   hypothetical protein; PFAM:
FT                   Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; SPTR: Q4JCM9 UPF0284 protein
FT                   Saci_0020; PFAM: Phosphoribosyltransferase; TIGRFAM:
FT                   conserved hypothetical protein TIGR00303"
FT                   /db_xref="EnsemblGenomes-Gn:Vdis_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADN49988"
FT                   /db_xref="GOA:E1QUY5"
F