(data stored in SCRATCH3701 zone)

EMBL: CP002106

ID   CP002106; SV 1; circular; genomic DNA; STD; PRO; 2051896 BP.
XX
AC   CP002106;
XX
PR   Project:PRJNA36641;
XX
DT   27-JUL-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Olsenella uli DSM 7084, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Olsenella uli DSM 7084
OC   Bacteria; Actinobacteria; Coriobacteriia; Coriobacteriales; Atopobiaceae;
OC   Olsenella.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2051896
RX   PUBMED; 21304694.
RA   Goker M., Held B., Lucas S., Nolan M., Yasawong M., Glavina Del Rio T.,
RA   Tice H., Cheng J.F., Bruce D., Detter J.C., Tapia R., Han C., Goodwin L.,
RA   Pitluck S., Liolios K., Ivanova N., Mavromatis K., Mikhailova N., Pati A.,
RA   Chen A., Palaniappan K., Land M., Hauser L., Chang Y.J., Jeffries C.D.,
RA   Rohde M., Sikorski J., Pukall R., Woyke T., Bristow J., Eisen J.A.,
RA   Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P., Lapidus A.;
RT   "Complete genome sequence of Olsenella uli type strain (VPI D76D-27C)";
RL   Stand Genomic Sci 3(1):76-84(2010).
XX
RN   [2]
RP   1-2051896
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Held B., Brettin T., Detter J.C., Tapia R., Han C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Pukall R., Gehrich-Schroeter G., Schneider S.,
RA   Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Olsenella uli DSM 7084";
RL   Unpublished.
XX
RN   [3]
RP   1-2051896
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Held B., Brettin T., Detter J.C., Tapia R., Han C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Pukall R., Gehrich-Schroeter G., Schneider S.,
RA   Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (19-JUL-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 77a176ccd51d1af3ff6b71bb223779f0.
DR   BioSample; SAMN00016989.
DR   CABRI; DSM 7084.
DR   EnsemblGenomes-Gn; EBG00000993684.
DR   EnsemblGenomes-Gn; EBG00000993685.
DR   EnsemblGenomes-Gn; EBG00000993686.
DR   EnsemblGenomes-Gn; EBG00000993687.
DR   EnsemblGenomes-Gn; EBG00000993688.
DR   EnsemblGenomes-Gn; EBG00000993689.
DR   EnsemblGenomes-Gn; EBG00000993690.
DR   EnsemblGenomes-Gn; EBG00000993691.
DR   EnsemblGenomes-Gn; EBG00000993693.
DR   EnsemblGenomes-Gn; EBG00000993695.
DR   EnsemblGenomes-Gn; EBG00000993697.
DR   EnsemblGenomes-Gn; EBG00000993698.
DR   EnsemblGenomes-Gn; EBG00000993699.
DR   EnsemblGenomes-Gn; EBG00000993700.
DR   EnsemblGenomes-Gn; EBG00000993701.
DR   EnsemblGenomes-Gn; EBG00000993704.
DR   EnsemblGenomes-Gn; EBG00000993706.
DR   EnsemblGenomes-Gn; EBG00000993707.
DR   EnsemblGenomes-Gn; EBG00000993708.
DR   EnsemblGenomes-Gn; EBG00000993709.
DR   EnsemblGenomes-Gn; EBG00000993710.
DR   EnsemblGenomes-Gn; EBG00000993711.
DR   EnsemblGenomes-Gn; EBG00000993712.
DR   EnsemblGenomes-Gn; EBG00000993714.
DR   EnsemblGenomes-Gn; EBG00000993716.
DR   EnsemblGenomes-Gn; EBG00000993718.
DR   EnsemblGenomes-Gn; EBG00000993719.
DR   EnsemblGenomes-Gn; EBG00000993721.
DR   EnsemblGenomes-Gn; EBG00000993723.
DR   EnsemblGenomes-Gn; EBG00000993724.
DR   EnsemblGenomes-Gn; EBG00000993725.
DR   EnsemblGenomes-Gn; EBG00000993726.
DR   EnsemblGenomes-Gn; EBG00000993727.
DR   EnsemblGenomes-Gn; EBG00000993728.
DR   EnsemblGenomes-Gn; EBG00000993729.
DR   EnsemblGenomes-Gn; EBG00000993730.
DR   EnsemblGenomes-Gn; EBG00000993731.
DR   EnsemblGenomes-Gn; EBG00000993732.
DR   EnsemblGenomes-Gn; EBG00000993733.
DR   EnsemblGenomes-Gn; EBG00000993734.
DR   EnsemblGenomes-Gn; EBG00000993735.
DR   EnsemblGenomes-Gn; EBG00000993736.
DR   EnsemblGenomes-Gn; EBG00000993738.
DR   EnsemblGenomes-Gn; EBG00000993739.
DR   EnsemblGenomes-Gn; EBG00000993741.
DR   EnsemblGenomes-Gn; EBG00000993742.
DR   EnsemblGenomes-Gn; EBG00000993743.
DR   EnsemblGenomes-Gn; EBG00000993744.
DR   EnsemblGenomes-Gn; EBG00000993745.
DR   EnsemblGenomes-Gn; EBG00000993746.
DR   EnsemblGenomes-Gn; EBG00000993747.
DR   EnsemblGenomes-Gn; EBG00000993748.
DR   EnsemblGenomes-Gn; EBG00000993749.
DR   EnsemblGenomes-Gn; EBG00000993751.
DR   EnsemblGenomes-Gn; EBG00000993753.
DR   EnsemblGenomes-Gn; EBG00000993755.
DR   EnsemblGenomes-Gn; EBG00000993757.
DR   EnsemblGenomes-Gn; EBG00000993759.
DR   EnsemblGenomes-Gn; Olsu_R0001.
DR   EnsemblGenomes-Gn; Olsu_R0002.
DR   EnsemblGenomes-Gn; Olsu_R0003.
DR   EnsemblGenomes-Gn; Olsu_R0004.
DR   EnsemblGenomes-Gn; Olsu_R0005.
DR   EnsemblGenomes-Gn; Olsu_R0006.
DR   EnsemblGenomes-Gn; Olsu_R0007.
DR   EnsemblGenomes-Gn; Olsu_R0008.
DR   EnsemblGenomes-Gn; Olsu_R0010.
DR   EnsemblGenomes-Gn; Olsu_R0011.
DR   EnsemblGenomes-Gn; Olsu_R0012.
DR   EnsemblGenomes-Gn; Olsu_R0013.
DR   EnsemblGenomes-Gn; Olsu_R0014.
DR   EnsemblGenomes-Gn; Olsu_R0015.
DR   EnsemblGenomes-Gn; Olsu_R0016.
DR   EnsemblGenomes-Gn; Olsu_R0017.
DR   EnsemblGenomes-Gn; Olsu_R0018.
DR   EnsemblGenomes-Gn; Olsu_R0019.
DR   EnsemblGenomes-Gn; Olsu_R0020.
DR   EnsemblGenomes-Gn; Olsu_R0021.
DR   EnsemblGenomes-Gn; Olsu_R0022.
DR   EnsemblGenomes-Gn; Olsu_R0023.
DR   EnsemblGenomes-Gn; Olsu_R0024.
DR   EnsemblGenomes-Gn; Olsu_R0025.
DR   EnsemblGenomes-Gn; Olsu_R0026.
DR   EnsemblGenomes-Gn; Olsu_R0027.
DR   EnsemblGenomes-Gn; Olsu_R0028.
DR   EnsemblGenomes-Gn; Olsu_R0029.
DR   EnsemblGenomes-Gn; Olsu_R0030.
DR   EnsemblGenomes-Gn; Olsu_R0031.
DR   EnsemblGenomes-Gn; Olsu_R0032.
DR   EnsemblGenomes-Gn; Olsu_R0033.
DR   EnsemblGenomes-Gn; Olsu_R0034.
DR   EnsemblGenomes-Gn; Olsu_R0035.
DR   EnsemblGenomes-Gn; Olsu_R0036.
DR   EnsemblGenomes-Gn; Olsu_R0037.
DR   EnsemblGenomes-Gn; Olsu_R0038.
DR   EnsemblGenomes-Gn; Olsu_R0039.
DR   EnsemblGenomes-Gn; Olsu_R0040.
DR   EnsemblGenomes-Gn; Olsu_R0041.
DR   EnsemblGenomes-Gn; Olsu_R0042.
DR   EnsemblGenomes-Gn; Olsu_R0043.
DR   EnsemblGenomes-Gn; Olsu_R0044.
DR   EnsemblGenomes-Gn; Olsu_R0045.
DR   EnsemblGenomes-Gn; Olsu_R0046.
DR   EnsemblGenomes-Gn; Olsu_R0047.
DR   EnsemblGenomes-Gn; Olsu_R0048.
DR   EnsemblGenomes-Gn; Olsu_R0049.
DR   EnsemblGenomes-Gn; Olsu_R0050.
DR   EnsemblGenomes-Gn; Olsu_R0051.
DR   EnsemblGenomes-Gn; Olsu_R0052.
DR   EnsemblGenomes-Gn; Olsu_R0053.
DR   EnsemblGenomes-Gn; Olsu_R0054.
DR   EnsemblGenomes-Gn; Olsu_R0055.
DR   EnsemblGenomes-Gn; Olsu_R0056.
DR   EnsemblGenomes-Tr; EBT00001519083.
DR   EnsemblGenomes-Tr; EBT00001519084.
DR   EnsemblGenomes-Tr; EBT00001519085.
DR   EnsemblGenomes-Tr; EBT00001519086.
DR   EnsemblGenomes-Tr; EBT00001519087.
DR   EnsemblGenomes-Tr; EBT00001519088.
DR   EnsemblGenomes-Tr; EBT00001519089.
DR   EnsemblGenomes-Tr; EBT00001519090.
DR   EnsemblGenomes-Tr; EBT00001519091.
DR   EnsemblGenomes-Tr; EBT00001519092.
DR   EnsemblGenomes-Tr; EBT00001519093.
DR   EnsemblGenomes-Tr; EBT00001519094.
DR   EnsemblGenomes-Tr; EBT00001519096.
DR   EnsemblGenomes-Tr; EBT00001519097.
DR   EnsemblGenomes-Tr; EBT00001519098.
DR   EnsemblGenomes-Tr; EBT00001519099.
DR   EnsemblGenomes-Tr; EBT00001519100.
DR   EnsemblGenomes-Tr; EBT00001519101.
DR   EnsemblGenomes-Tr; EBT00001519102.
DR   EnsemblGenomes-Tr; EBT00001519103.
DR   EnsemblGenomes-Tr; EBT00001519104.
DR   EnsemblGenomes-Tr; EBT00001519105.
DR   EnsemblGenomes-Tr; EBT00001519106.
DR   EnsemblGenomes-Tr; EBT00001519107.
DR   EnsemblGenomes-Tr; EBT00001519108.
DR   EnsemblGenomes-Tr; EBT00001519109.
DR   EnsemblGenomes-Tr; EBT00001519110.
DR   EnsemblGenomes-Tr; EBT00001519111.
DR   EnsemblGenomes-Tr; EBT00001519112.
DR   EnsemblGenomes-Tr; EBT00001519113.
DR   EnsemblGenomes-Tr; EBT00001519114.
DR   EnsemblGenomes-Tr; EBT00001519115.
DR   EnsemblGenomes-Tr; EBT00001519116.
DR   EnsemblGenomes-Tr; EBT00001519117.
DR   EnsemblGenomes-Tr; EBT00001519118.
DR   EnsemblGenomes-Tr; EBT00001519119.
DR   EnsemblGenomes-Tr; EBT00001519120.
DR   EnsemblGenomes-Tr; EBT00001519121.
DR   EnsemblGenomes-Tr; EBT00001519122.
DR   EnsemblGenomes-Tr; EBT00001519123.
DR   EnsemblGenomes-Tr; EBT00001519124.
DR   EnsemblGenomes-Tr; EBT00001519125.
DR   EnsemblGenomes-Tr; EBT00001519126.
DR   EnsemblGenomes-Tr; EBT00001519127.
DR   EnsemblGenomes-Tr; EBT00001519128.
DR   EnsemblGenomes-Tr; EBT00001519129.
DR   EnsemblGenomes-Tr; EBT00001519130.
DR   EnsemblGenomes-Tr; EBT00001519131.
DR   EnsemblGenomes-Tr; EBT00001519132.
DR   EnsemblGenomes-Tr; EBT00001519133.
DR   EnsemblGenomes-Tr; EBT00001519134.
DR   EnsemblGenomes-Tr; EBT00001519135.
DR   EnsemblGenomes-Tr; EBT00001519136.
DR   EnsemblGenomes-Tr; EBT00001519137.
DR   EnsemblGenomes-Tr; EBT00001519138.
DR   EnsemblGenomes-Tr; EBT00001519139.
DR   EnsemblGenomes-Tr; EBT00001519140.
DR   EnsemblGenomes-Tr; EBT00001519141.
DR   EnsemblGenomes-Tr; Olsu_R0001-1.
DR   EnsemblGenomes-Tr; Olsu_R0002-1.
DR   EnsemblGenomes-Tr; Olsu_R0003-1.
DR   EnsemblGenomes-Tr; Olsu_R0004-1.
DR   EnsemblGenomes-Tr; Olsu_R0005-1.
DR   EnsemblGenomes-Tr; Olsu_R0006-1.
DR   EnsemblGenomes-Tr; Olsu_R0007-1.
DR   EnsemblGenomes-Tr; Olsu_R0008-1.
DR   EnsemblGenomes-Tr; Olsu_R0010-1.
DR   EnsemblGenomes-Tr; Olsu_R0011-1.
DR   EnsemblGenomes-Tr; Olsu_R0012-1.
DR   EnsemblGenomes-Tr; Olsu_R0013-1.
DR   EnsemblGenomes-Tr; Olsu_R0014-1.
DR   EnsemblGenomes-Tr; Olsu_R0015-1.
DR   EnsemblGenomes-Tr; Olsu_R0016-1.
DR   EnsemblGenomes-Tr; Olsu_R0017-1.
DR   EnsemblGenomes-Tr; Olsu_R0018-1.
DR   EnsemblGenomes-Tr; Olsu_R0019-1.
DR   EnsemblGenomes-Tr; Olsu_R0020-1.
DR   EnsemblGenomes-Tr; Olsu_R0021-1.
DR   EnsemblGenomes-Tr; Olsu_R0022-1.
DR   EnsemblGenomes-Tr; Olsu_R0023-1.
DR   EnsemblGenomes-Tr; Olsu_R0024-1.
DR   EnsemblGenomes-Tr; Olsu_R0025-1.
DR   EnsemblGenomes-Tr; Olsu_R0026-1.
DR   EnsemblGenomes-Tr; Olsu_R0027-1.
DR   EnsemblGenomes-Tr; Olsu_R0028-1.
DR   EnsemblGenomes-Tr; Olsu_R0029-1.
DR   EnsemblGenomes-Tr; Olsu_R0030-1.
DR   EnsemblGenomes-Tr; Olsu_R0031-1.
DR   EnsemblGenomes-Tr; Olsu_R0032-1.
DR   EnsemblGenomes-Tr; Olsu_R0033-1.
DR   EnsemblGenomes-Tr; Olsu_R0034-1.
DR   EnsemblGenomes-Tr; Olsu_R0035-1.
DR   EnsemblGenomes-Tr; Olsu_R0036-1.
DR   EnsemblGenomes-Tr; Olsu_R0037-1.
DR   EnsemblGenomes-Tr; Olsu_R0038-1.
DR   EnsemblGenomes-Tr; Olsu_R0039-1.
DR   EnsemblGenomes-Tr; Olsu_R0040-1.
DR   EnsemblGenomes-Tr; Olsu_R0041-1.
DR   EnsemblGenomes-Tr; Olsu_R0042-1.
DR   EnsemblGenomes-Tr; Olsu_R0043-1.
DR   EnsemblGenomes-Tr; Olsu_R0044-1.
DR   EnsemblGenomes-Tr; Olsu_R0045-1.
DR   EnsemblGenomes-Tr; Olsu_R0046-1.
DR   EnsemblGenomes-Tr; Olsu_R0047-1.
DR   EnsemblGenomes-Tr; Olsu_R0048-1.
DR   EnsemblGenomes-Tr; Olsu_R0049-1.
DR   EnsemblGenomes-Tr; Olsu_R0050-1.
DR   EnsemblGenomes-Tr; Olsu_R0051-1.
DR   EnsemblGenomes-Tr; Olsu_R0052-1.
DR   EnsemblGenomes-Tr; Olsu_R0053-1.
DR   EnsemblGenomes-Tr; Olsu_R0054-1.
DR   EnsemblGenomes-Tr; Olsu_R0055-1.
DR   EnsemblGenomes-Tr; Olsu_R0056-1.
DR   EuropePMC; PMC6562231; 30701700.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002106.
DR   SILVA-SSU; CP002106.
DR   StrainInfo; 14188; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4084274
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Olsenella uli VPI, DSM 7084
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Missing
CC   environment         :: Missing
CC   num_replicons       :: 1
CC   ref_biomaterial     :: DSM 7084, ATCC 49627
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Anaerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02539
CC   Type Strain         :: Yes
CC   Greengenes ID       :: 46592
CC   Funding Program     :: DOE-GEBA 2007
CC   Gene Calling Method :: Prodigal, GenePRIMP
CC   Isolation Site      :: Human gingival crevice
CC   Host Name           :: Homo sapiens
CC   Body Sample Site    :: Oral
CC   Body Sample SubSite :: Gingival crevices
CC   Temperature Range   :: Mesophile
CC   Temperature Optimum :: 37C
CC   Gram Staining       :: Gram+
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2051896
FT                   /organism="Olsenella uli DSM 7084"
FT                   /host="Homo sapiens"
FT                   /strain="DSM 7084"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="gingival crevice"
FT                   /db_xref="taxon:633147"
FT   gene            47..847
FT                   /locus_tag="Olsu_0001"
FT   CDS_pept        47..847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0001"
FT                   /product="chromosome segregation ATPase"
FT                   /note="COGs: COG1192 ATPase involved in chromosome
FT                   partitioning; InterPro IPR002586; KEGG: apv:Apar_1363
FT                   cobyrinic acid ac-diamide synthase; PFAM: Cobyrinic acid
FT                   ac-diamide synthase; SPTR: B9CLR4 SpoOJ regulator protein;
FT                   PFAM: CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67136"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXM2"
FT                   /protein_id="ADK67136.1"
FT                   /translation="MSYQDVKKAFPDKQGKVISIINQKGGVGKSTTAVNLSACLGESKK
FT                   KVLVIDLDPQGNTSSGYGIEKEGLEHDIYDALLNDVQLADVIAPTLEPHVFIVPATIQL
FT                   AGAEIELVSVMSRESVLKGILTGIRDEFDYVFIDCPPSLGLLTINALVASDALLIPIQC
FT                   EFYALEGVTKLLESMKMVKSRLNPELDIFGVVMTMYDARTTLSKQVVEEVSTYFGKKVF
FT                   KSIIPRSVKLSEAPSHGLPISKYARMSKGALAYSRLAREVVRRG"
FT   gene            882..1709
FT                   /locus_tag="Olsu_0002"
FT   CDS_pept        882..1709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0002"
FT                   /product="parB-like partition protein"
FT                   /note="COGs: COG1475 transcriptional regulator protein;
FT                   InterPro IPR003115:IPR004437; KEGG: apv:Apar_1362 ParB-like
FT                   partition protein; PFAM: ParB domain protein nuclease;
FT                   SMART: ParB domain protein nuclease; SPTR: B9CLR3 Stage 0
FT                   sporulation protein J; TIGRFAM: parB-like partition
FT                   protein; PFAM: ParB-like nuclease domain; KorB domain;
FT                   TIGRFAM: ParB-like partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67137"
FT                   /db_xref="GOA:E1QXM3"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXM3"
FT                   /protein_id="ADK67137.1"
FT                   /translation="MGGADGEIGTVAPDLSLSISRIKANRNQPRKNFDPDALEELADSI
FT                   RQNGILQPILVRKKGKDYEIVAGERRYQAAKKAGLKEVPVVIRDIEDEEVFKLALIENL
FT                   QRSDLDPIEEALGYQRLIKDNGFTQEELGRALSKSRSAIANTLRLLDLPKEVQEMMAAG
FT                   KLTAGHARAILAVGSEDGRLKLAHKVVGENLTVRQTESLAPLFSGMKGDRPKRQAQPQY
FT                   FKRAARQLRLALDTNVKVKTVRNRNRIEIEFKDEDDLVRLVNVLSPVEPLAGE"
FT   gene            complement(2069..3148)
FT                   /locus_tag="Olsu_0003"
FT   CDS_pept        complement(2069..3148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0003"
FT                   /product="23S rRNA m(2)A-2503 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG0820 Fe-S-cluster redox enzyme; InterPro
FT                   IPR004383:IPR007197; KEGG: apv:Apar_1361 radical SAM
FT                   enzyme, Cfr family; PFAM: Radical SAM domain protein; SPTR:
FT                   C8W8J4 Radical SAM enzyme, Cfr family; TIGRFAM: radical SAM
FT                   enzyme, Cfr family; PFAM: Radical SAM superfamily; TIGRFAM:
FT                   radical SAM enzyme, Cfr family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67138"
FT                   /db_xref="GOA:E1QXM4"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXM4"
FT                   /protein_id="ADK67138.1"
FT                   /translation="MQDANSGKPTAKKRKQRRDLRAMSHGQLLELLGDLGQPGFRAKQI
FT                   EEWVWEKNVSSFDDMSNLPKSLRAHLSQACSLGGPREVGRQQSSDGSRKYLLRYEDGVS
FT                   VECVGMPTRNKLAVCASTQAGCAMSCAFCATGAAGLTRSLTAGEIYEQVMHARDDFNAR
FT                   VTSVVLMGQGEPFMNYDATLGALRRLNSPEGAGIGARHLTVSTCGIIPMIKRFAGEPEQ
FT                   FTLAVSLHSAVQRTRDMLMPGVRKYSLLHLYEIMEEYVDKTGRRPTYEYALIKGVNDSE
FT                   DEMGALCDFCRGNLAHVNLIRLNDVKDSPFQPSSDRRAEEFVRRLGAVGVDATIRNSRG
FT                   SDIDAACGQLRQEMERLSR"
FT   gene            3261..4253
FT                   /locus_tag="Olsu_0004"
FT   CDS_pept        3261..4253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0004"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="COGs: COG1181 D-alanine-D-alanine ligase and related
FT                   ATP-grasp protein;
FT                   InterProIPR016185:IPR005905:IPR011761:IPR013817:IPR
FT                   013816:IPR000291:IPR011127:IPR011095; KEGG: apv:Apar_1360
FT                   D-alanine/D-alanine ligase; PFAM: D-alanine--D-alanine
FT                   ligase domain protein; PRIAM: D-alanine--D-alanine ligase;
FT                   SPTR: C8W8J3 D-alanine/D-alanine ligase; TIGRFAM:
FT                   D-alanine/D-alanine ligase; PFAM: D-ala D-ala ligase
FT                   C-terminus; D-ala D-ala ligase N-terminus; TIGRFAM:
FT                   D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67139"
FT                   /db_xref="GOA:E1QXM5"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXM5"
FT                   /protein_id="ADK67139.1"
FT                   /translation="MEKTDVTQCAVAVLSGGWSDERDISLQSGMACMGALREAGFVRVE
FT                   LLDIAAPDFAARLLDGRFDVAFVALHGRYGEDGCIQGLLEVLHIPYTFSGVLASAVGTE
FT                   KAVAKALYREAGIPVPEGVDLPEGTRLTSDQADRLVRTLGLPLFVKPAANGSSFGVTRV
FT                   TETAQLADAVARAASEGDRVLVETCVEGTEITVPVIGNDDPVALPIVEIAFDSEFYDAK
FT                   VKYEPAALHHVIPARLDQTTYERASELAVRAHRALGCRGVSRSDFIVTAEGAPVILETN
FT                   TIPGMTETSLLPDSARHAGIGFPDLCRRFVELALEGRGVTGGTSGGGEA"
FT   gene            4254..7259
FT                   /locus_tag="Olsu_0005"
FT   CDS_pept        4254..7259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0005"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG1199 Rad3-related DNA helicase;
FT                   InterProIPR012337:IPR006054:IPR014013:IPR006055:IPR
FT                   006555:IPR002345:IPR013520; KEGG: apv:Apar_1359 DNA
FT                   polymerase III, epsilon subunit; PFAM: Exonuclease RNase T
FT                   and DNA polymerase III; PRIAM: DNA-directed DNA polymerase;
FT                   SMART: Exonuclease; helicase c2; SPTR: C8W8J2 DNA
FT                   polymerase III, epsilon subunit; TIGRFAM: DNA polymerase
FT                   III, epsilon subunit; PFAM: Exonuclease; TIGRFAM:
FT                   exonuclease, DNA polymerase III, epsilon subunit family;
FT                   DnaQ family exonuclease/DinG family helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67140"
FT                   /db_xref="GOA:E1QXM6"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXM6"
FT                   /protein_id="ADK67140.1"
FT                   /translation="MSGETPPSEGRQPSGPGTTPSVDVLLLPGTPPSVATRYRSLAERA
FT                   KHAELGLLGEDFVVLDTETTGLSFRDCELIEIAAARIRGGVVEERFQTFVHPMGPIPPE
FT                   ISALTHISDLDVTDAPSAVDAVAALSEFVAGDPVLAHNATFDRTFVESVPGGRDVSDNW
FT                   IDTLALSRIALPRLSSHRLADMARAFGCDSATHRATADVEALAGMWRIMLVALMDLPSG
FT                   LLDLLSTMHEEVDWQLRPILSYLAHEAADEGASERGAEVAPFSLKLARRGLVSEGQGHV
FT                   RDDAAEKDEPLSAPTRLEVEEAFSADGIVGSLYAHFEVRPDQVQMAREVRDALASSTHR
FT                   SIEAGTGVGKSMAYLLPEVLFAQRNDLTVGIATKTNALTDQLVTHELPILDSALPQGLR
FT                   FTSLKGYEHYPCLHRLERAALGELPTVLVEGESRSLAAMEADMLTAIAVTYAFCCQSPE
FT                   GDLDALGIRWRYVPRMMLTTTPAECLRGSCPYYPNECLVHGARRRAACSDVVVTNHSLL
FT                   LRDVEMDGRILPPVRHWVVDEAHAFEAEARRQWAVEVSGDEARQAFELLGGTKSGALHN
FT                   LMVQTAGLEGAALIQRLLTKAAAAVARAAASTSDLFLALHSLGCLASGGGGYESTTLWI
FT                   DGGVRLTPEWDALSEVAHVALARLEEASKDMDETAEKISESSPQLGANLIEAGGFLHAL
FT                   HDGIDLIVSGEDESYVYSAQLSRRRRDIGSERLLAEKIDVGADLGSRWLPEMMSVVFAS
FT                   ATMAVGESFEHFDHSVGLDLLGGSLHKDVRLSSSFDYRDNMAVIVAQDMPQPNDPRYLS
FT                   ALEDLLFDVHRSMGGSVLTLFTNRRDMERVYAGLQPRLSQLGLPVICQERGSSARRLRE
FT                   RFMADRSCSLLALRSFWEGFDSPGDTLRCVVIPKLPFASPCDPLVRERELREERAWWRH
FT                   SLPEAVISVKQAAGRLIRSSSDAGVLVLADSRLVSKRYGRQFTSSLPNPDCTRLKRSNV
FT                   SRYIGLWRSSHE"
FT   gene            complement(7282..8238)
FT                   /locus_tag="Olsu_0006"
FT   CDS_pept        complement(7282..8238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0006"
FT                   /product="transcriptional regulator protein"
FT                   /note="COGs: COG2378 transcriptional regulator protein;
FT                   KEGG: apv:Apar_1358 hypothetical protein; SPTR: B9CLQ8
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67141"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXM7"
FT                   /protein_id="ADK67141.1"
FT                   /translation="MAVREGPAGRGRGRRGGIEVARELVTLISALRHEGDLLSAGVVAA
FT                   RMGCSLDHARHLLNLLLDVADEEGTGRLCLGADDDGMEVELCFGGVAGRALRLTTSETI
FT                   AVEAALRALGVAQGDVLADKVRRALCNPVTGPGVQTSLESLETDDPNGAVCACAKAIAA
FT                   GDELSFAYRSVSGEPSERLVLPLGLRHDGGLWYLDAFDLVRRGERTFRCDRMTKLGTSA
FT                   VTEGGTQGDGPRRDGSITGTREVELTFTDPRLLEFFRWPALEVMAEGGGRTRARIPFYG
FT                   GMWLIRRLAACGDGVIVDDEDLRRKVSDYATGLLGKG"
FT   gene            complement(8228..9220)
FT                   /locus_tag="Olsu_0007"
FT   CDS_pept        complement(8228..9220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apv:Apar_1357 transcriptional regulator
FT                   protein-like protein; SPTR: C2D9I9 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67142"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXM8"
FT                   /protein_id="ADK67142.1"
FT                   /translation="MGKGSRESVEGRTKDDEQALRLASLATAFMNAQGALTSRRIRELY
FT                   YPHLSEDSFRRTFLRDRARLALCGIALRGDRRAGGETTWVVDRTLSFADGDALTAHEAL
FT                   TIDAACAGLVSDGAFAYRDELARALAKINSSYNTLATRRVGHAGEGVDMRLATLRGCLE
FT                   RGEAAEVTYTDARGCQSERLLALYGSFGLRGNTYFVAVRYDRERGRPAETPKTYRLDRF
FT                   VRVRACAQERYVVPEDFDIRDFVLLPFQMGATEGHATFACTRPATPEARRALTTHGALS
FT                   PDGSTWRVDVSDIRDAALWSIDVGLVPLGPPELVEERRRILDEASRHGR"
FT   gene            9388..13077
FT                   /locus_tag="Olsu_0008"
FT   CDS_pept        9388..13077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0008"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR020392; KEGG: apv:Apar_1356 hypothetical
FT                   protein; SPTR: C2D9I8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67143"
FT                   /db_xref="GOA:E1QXM9"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXM9"
FT                   /protein_id="ADK67143.1"
FT                   /translation="MPNSRTYLDYLNEKIDISPANSQEELEAAELVRSLMDEHGLETTV
FT                   QDFTVPAAGDLPHNVLYVVMFLGMLLSGILGSAVGLVGLLLVIAALALLVAEFSGHDLL
FT                   GRLGPAARSQNVIGVHRATGPLVVKGNRPIVIVAHYDSPNEGLLYQPQLARYQVPLRRA
FT                   RFLCVIVVSVLSLLQAMPFLPTTARHVLWVLGILASLPLLIVGVSTIYARFAPCTTGAN
FT                   DNKASIAAMLGVMDAVRPAGDEAKRYMELHPHTEPEPEPVVEPEPEDYPAAPLPVSGPR
FT                   PGLDLASEEDPASPQADGDIPSVSDEGSSPVGEAPTHEPPAAPAPMPSVDRGGLVDWGG
FT                   VRRGPELMQSLNILPPECEIVYQEPPVPKVDPATLPEIPRFTDKDFADELNTKYGLDGI
FT                   GSTAAPSEEGSSLPDGEPPSQTTRPERHTGYVPSFFSQAKGRAEHPDTRIRLGKGYAGK
FT                   PAQDALPSPGRDEYPTFDEDYLVAEYEVIEDPTSSQEEPSSHPDIVTPLEETIAPSGAA
FT                   DADVAAGVADALGVPDATGAPADAATSAGVMEQPTLERPAPEVTKPSVPMNVPEVTATT
FT                   PPQTFETEYNYYEPTSAADTVVSEPVSDQVTPIEGLPTIEEAPEGLDAEATSSTGPMSQ
FT                   DAKANDALPLSASGTEPTSGVSPASEETPPEVPGAPASASGFVPAVRSAWGRLVGGIRR
FT                   HTLPATSEPSASSENEVGATSGEAPLAEWEPIGSPEPTEATSPMAASDDVEGDDAAERG
FT                   VVPATESVGHGRASDSETDPGSGEEPVDEPMGEGADDGSTEHDPAASDPAATIAISAAT
FT                   LSIDEDIPESELASKDATGLDTLSDDLPSSQDSADEGDRPAAVDDPNWGTSEFRPAEPN
FT                   LARRAVLFDLPDPSEATSDPFVTDPDASGTMPRAFDNVLVRGTASTKLQPRYARDSQPR
FT                   GTRETIGLLTGSEVGMHSQAARPKASDARQAGKRRLRFFGHRGDARPQQESLSEWLGVE
FT                   EDYDAKKDGRAIGNWDNFDKADGETKVDPSEGSGEPPRRGDWKGGATTRSDLHVVEGAD
FT                   PTAEVPPDAQVIEAQSPEEMEQLREAILGMGDDELVSHDVWFVALGASSLRRAGIKEFL
FT                   AGFRRDIRGSFLVNLDSVGAGDVTLLTSEGAGKTRRADRRMVRMLMGIADDLHIPVKRS
FT                   RYDWASTDATPAMQASVRAVTVMGMTDDRLPALSHTADDTPENIDQGQVAAVSDMLCEL
FT                   IRRS"
FT   gene            13122..13196
FT                   /locus_tag="Olsu_R0001"
FT   tRNA            13122..13196
FT                   /locus_tag="Olsu_R0001"
FT                   /product="tRNA-Gly"
FT   gene            13244..14527
FT                   /locus_tag="Olsu_0009"
FT   CDS_pept        13244..14527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0009"
FT                   /product="aminopeptidase II"
FT                   /note="COGs: COG2309 Leucyl aminopeptidase (aminopeptidase
FT                   T); InterPro IPR000787; KEGG: apv:Apar_1352 peptidase M29
FT                   aminopeptidase II; PFAM: peptidase M29 aminopeptidase II;
FT                   SPTR: B9CLQ2 Aminopeptidase 2; PFAM: Thermophilic
FT                   metalloprotease (M29)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67144"
FT                   /db_xref="GOA:E1QXN0"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXN0"
FT                   /protein_id="ADK67144.1"
FT                   /translation="MSAPMTSEECLRAMEGLSVRVEGYAELIVRRGCALRPGQELVLQA
FT                   PVERADFARLVVSQAYAAGAGHVTVIWDDDAITRMDYENVPLEYFSHTPSWRREQLDSL
FT                   AEGGAAFLFLEGADPSALDGIDPAKPAAASRARNTECVAFRSGMDFGRNAWCIAGVPVR
FT                   AWARRVYPGLSDDESVYRLWRTILAVARADGEDPQGAWEAHNATFEKNKRRLNAYSLDC
FT                   LHYLSRNGTDLTIGMNPGHVWEGGAGHLADGTTFFPNIPTEEVFTSPDRLRADGIVHSA
FT                   MPLVHAGCVVSDFWFRFEAGRVVDFGAKSGKDVLSHIVETDENSCRLGECALISKNTPI
FT                   RQTGILFYDTLYDENASCHLALGTGFPECLPGGLNMDRGQLLAAGVNQSSTHVDFMIGS
FT                   DDLDVWGITAAGEEVPVFTEGQWAWENE"
FT   gene            14581..14656
FT                   /locus_tag="Olsu_R0002"
FT   tRNA            14581..14656
FT                   /locus_tag="Olsu_R0002"
FT                   /product="tRNA-Lys"
FT   gene            14964..16010
FT                   /locus_tag="Olsu_0010"
FT   CDS_pept        14964..16010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0010"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="COGs: COG0111 Phosphoglycerate dehydrogenase and
FT                   related dehydrogenase; InterPro
FT                   IPR016040:IPR006140:IPR006139; KEGG: tex:Teth514_0124
FT                   phosphoglycerate dehydrogenase; PFAM: D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding; D-isomer specific
FT                   2-hydroxyacid dehydrogenase catalytic region; SPTR: C7ITW9
FT                   Phosphoglycerate dehydrogenase; PFAM: D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD binding domain; D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67145"
FT                   /db_xref="GOA:E1QXN1"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXN1"
FT                   /protein_id="ADK67145.1"
FT                   /translation="MGANWVVCSTAVTFGRSAKEPVQRLESAGCEVRLNPYGRPLDKKE
FT                   MYEFARDADAIILGNDDLPASVIKRLKKLKIIARYGVGFDGVDISEARERGIEVTYAPA
FT                   ANREETADFTLGLILDLERHISQMVIDTRAGLWNKRTGTSLYGKTIGIIGVGQIGTAVA
FT                   RRAMGFGMDILGYDIEQRNEATVYGVVYTTLNDLLRRSDVITIHLPLDDSTRNLIGSRE
FT                   LRLVKSGSILINTARAGIVKHGALDHALQTGALAGFAIDVFSKEPPEHQPYYDYENVLV
FT                   TPHIAGNTYESSLRMGNVVVDNVLAVKDGAQPPDPVTPQHLYESMLSMGVKAMFGRDKR
FT                   VPQQALCD"
FT   gene            16385..17014
FT                   /locus_tag="Olsu_0011"
FT   CDS_pept        16385..17014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0011"
FT                   /product="KDPG and KHG aldolase"
FT                   /note="COGs: COG0800 2-keto-3-deoxy-6-phosphogluconate
FT                   aldolase; InterPro IPR013785:IPR000887; KEGG: lrh:LGG_02668
FT                   2-dehydro-3-deoxyphosphogluconate aldolase /
FT                   4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and KHG
FT                   aldolase; SPTR: A8RK19 Putative uncharacterized protein;
FT                   PFAM: KDPG and KHG aldolase; TIGRFAM: Entner-Doudoroff
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67146"
FT                   /db_xref="GOA:E1QXN2"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXN2"
FT                   /protein_id="ADK67146.1"
FT                   /translation="MIDSSIVTYPKVTAILRGYDYDQVRCVVKNMVGTRLGAVEVAMNT
FT                   PGAPQIIQKVAEEFGDDILVGAGTVISAERAKAAVRVGAKFALSPICFTEEIFRICKDG
FT                   GLMTVPSAFTPSEVWNMFQMGADIVKVFPAGTLGPQYVKDIQAPLNSMPLMVVGGVNAD
FT                   NCQEFFDNGATYAGIGSGIFQHRHIIQMDSEGLKADIQAFEKKVRW"
FT   gene            17048..17506
FT                   /locus_tag="Olsu_0012"
FT   CDS_pept        17048..17506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0012"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="COGs: COG1762 Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type); InterPro
FT                   IPR016152:IPR002178; KEGG: cbe:Cbei_0541 putative PTS
FT                   IIA-like nitrogen-regulatory protein PtsN; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2; SPTR: C2JT07 PTS family fructose/mannitol
FT                   porter component IIA; PFAM: Phosphoenolpyruvate-dependent
FT                   sugar phosphotransferase system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67147"
FT                   /db_xref="GOA:E1QXN3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXN3"
FT                   /protein_id="ADK67147.1"
FT                   /translation="MAMKLFTEDVFLNVDVKSDSDVLSFMARHLLKEGKVKKGYEEHLL
FT                   AREFDYPTGLYLGEINVAIPHTDYQYANTTQVAIATLSNPVLWRSMEDPDETLSVSVVV
FT                   LSIFDHPEHQLKVLQQIMGVLQNQECVAEITKATTPQQVISAFEKKER"
FT   gene            17510..17812
FT                   /locus_tag="Olsu_0013"
FT   CDS_pept        17510..17812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0013"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="InterPro IPR003501; KEGG: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; PFAM:
FT                   phosphotransferase system lactose/cellobiose-specific IIB
FT                   subunit; SPTR: C2JT08 Putative uncharacterized protein;
FT                   PFAM: PTS system, Lactose/Cellobiose specific IIB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67148"
FT                   /db_xref="GOA:E1QXN4"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXN4"
FT                   /protein_id="ADK67148.1"
FT                   /translation="MEKKTVIVCCASSMITSTMAVAKVKEVAASIGAPEPKIIQCKFSE
FT                   VQGNLVSNRVDFIVPTGKLKGVETGGIPVVKGTAFITGIGEDKAKAKIAEWLQAQ"
FT   sig_peptide     17510..17596
FT                   /locus_tag="Olsu_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            17843..19111
FT                   /locus_tag="Olsu_0014"
FT   CDS_pept        17843..19111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0014"
FT                   /product="PTS system Galactitol-specific IIC component"
FT                   /note="COGs: COG3775 Phosphotransferase system
FT                   galactitol-specific IIC component; InterPro
FT                   IPR013014:IPR004703; KEGG: PTS system galactitol-specific
FT                   IIC component; PFAM: PTS system Galactitol-specific IIC
FT                   component; SPTR: C2JT09 PTS family galactitol (Gat) porter
FT                   component IIC; PFAM: PTS system sugar-specific permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67149"
FT                   /db_xref="GOA:E1QXN5"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXN5"
FT                   /protein_id="ADK67149.1"
FT                   /translation="MEIIVTTLQTVASMGPMVMMPLIILVLGLIFRVKANILLKSALLV
FT                   GIGFAGVNMVINWFVSQVAGSVSGMVANWGIQTSIMDVGWPARAAATWAFPLAAVVVFV
FT                   VLGANALMLLTKTTKTVMVDFWSYNHFIFTGALVWYATNGNPWVSIIAAAVDFIITIKI
FT                   ADWTTPVVEDYFELEGVNFPTSNSVIWAPVSFALNKLWDVIPGINRIDVNPKGVQEKFG
FT                   FVGEPMFMGFIIGAAIGILAGDSVDTILIVAMSTAVTMVLTPKMMQILMEGLLPFADAV
FT                   KDILQKKFPGTNFTMGVDAALTIANESAITVGIIMVPITLLLAAVLPGNKLLPIADIAY
FT                   QAMWLSAWPVAFGKGNIFRGILSTVIITCIVLWIATALAPVHTQLAISGGFVLPDGMQF
FT                   ISTEDAGEHVIGFISQWLAGFIG"
FT   sig_peptide     17843..17947
FT                   /locus_tag="Olsu_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            19192..20337
FT                   /locus_tag="Olsu_0015"
FT   CDS_pept        19192..20337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0015"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="COGs: COG4948 L-alanine-DL-glutamate epimerase;
FT                   InterPro IPR018110:IPR013341:IPR013342; KEGG: lrh:LGG_02664
FT                   mandelate racemase / muconate lactonizing enzyme,
FT                   N-terminal domain protein; PFAM: Mandelate
FT                   racemase/muconate lactonizing protein; SPTR: B5QPI4
FT                   Mandelate racemase/muconate lactonizing enzyme, N-terminal
FT                   domain protein; PFAM: Mandelate racemase / muconate
FT                   lactonizing enzyme, C-terminal domain; Mandelate racemase /
FT                   muconate lactonizing enzyme, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67150"
FT                   /db_xref="GOA:E1QXN6"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023592"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXN6"
FT                   /protein_id="ADK67150.1"
FT                   /translation="MKITSVKIYEVKPRWIFCKVSTDEGIVGWGEMISGTKTRTVVEGT
FT                   KELADRIVGRDPFEIERLWQELHRSFFRGGPINGTIVSGLEMALWDIKGKAFDVPVWQL
FT                   LGGRARDRIRVYSWVGGDRPSDVANEAMDRLSRGFRAIKMNAVEELHYVDTYDKVKSAV
FT                   DRIASIRDVCGDDIEVGIDFHGRVHRPMAKVLANALVPYHPMFIEEPVLPENWESFASL
FT                   AAEVPIPIATGERLYTRWEYKRLLVQGAVDIVQPDVSMCGGILEARKIIGMAEAFDVAA
FT                   APHAPYGPIALAATLQVDVCSPNVFIQEQSLGIHYNQGFDLLDFIQNKDVFEFTDGYIR
FT                   VPTEPGLGLVMDEEKIQAVSAEGLIWRNPSWRNYDGTIAEW"
FT   gene            20346..21254
FT                   /locus_tag="Olsu_0016"
FT   CDS_pept        20346..21254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0016"
FT                   /product="aryldialkylphosphatase"
FT                   /note="COGs: COG1735 metal-dependent hydrolase with the
FT                   TIM-barrel fold; InterPro IPR001559:IPR017947; KEGG:
FT                   aryldialkylphosphatase; PFAM: aryldialkylphosphatase; SPTR:
FT                   C2JT11 Possible aryldialkylphosphatase; PFAM:
FT                   Phosphotriesterase family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67151"
FT                   /db_xref="GOA:E1QXN7"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR017947"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXN7"
FT                   /protein_id="ADK67151.1"
FT                   /translation="MVNTVLGTIETSKLGKTLIHEHLYVAPDELHRNYAYTLDVLQKSV
FT                   EEARLFGLAGGETIVELTPLGYGRNTEALREISRRSGVNIICVTGFHKDLWLPRWFDQL
FT                   TDNEIEAELRREIVDGIGYSGVHPGAAKLGTSFGEVTSREHRAFSIVAPLAREYHLPII
FT                   THCDKGTMGHEQLDLLEKYSFDAKHVCLSHTDLTMDFGYIRSLCERGAYLSFDHVGRDL
FT                   EGHDHERVEMIANLVETGCGDKICLAGDMGKKDYFVSYGGRPGLAYILTALRSYLLESI
FT                   SEAEYTKMIVDNPRHVLAWDE"
FT   gene            21303..22543
FT                   /pseudo
FT                   /locus_tag="Olsu_0017"
FT   gene            22585..23049
FT                   /locus_tag="Olsu_0018"
FT   CDS_pept        22585..23049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: apv:Apar_0015 hypothetical protein; SPTR:
FT                   B9CLT3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67152"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXN8"
FT                   /protein_id="ADK67152.1"
FT                   /translation="MAYANEDAYRADGITPQLDALSSQLMGDAFDLLAEGRPVNVLLVI
FT                   SDAQGNVASYEFAADGVEACLDGAHDKVRQLVRAGGDQKSGLASPVRYALAYEGAVADE
FT                   SGAYQDALLLEFGEEGHKAFSAYSYVDGRGEGDGFRWTDPAPAGEVEPLI"
FT   gene            23199..25037
FT                   /locus_tag="Olsu_0019"
FT   CDS_pept        23199..25037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0019"
FT                   /product="GTP-binding protein TypA"
FT                   /note="COGs: COG1217 membrane GTPase involved in stress
FT                   response;
FT                   InterProIPR009000:IPR009022:IPR005225:IPR006298:IPR
FT                   000640:IPR000795:IPR004161; KEGG: apv:Apar_0016 GTP-binding
FT                   protein TypA; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; elongation factor G
FT                   domain protein; SPTR: B9CLT4 GTP-binding protein TypA/BipA;
FT                   TIGRFAM: GTP-binding protein TypA; small GTP-binding
FT                   protein; PFAM: Elongation factor Tu domain 2; Elongation
FT                   factor G C-terminus; Elongation factor Tu GTP binding
FT                   domain; TIGRFAM: GTP-binding protein TypA/BipA; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67153"
FT                   /db_xref="GOA:E1QXN9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXN9"
FT                   /protein_id="ADK67153.1"
FT                   /translation="MLQEHIRNIAIIAHVDHGKTTLVDQMLKATHAFRDNQQVEERVLD
FT                   SNDQERERGITILAKNISIEYNGVKINVIDTPGHADFGGEVERVLKMADGAVLLVDAAE
FT                   GPMPQTRFVLSHAIAAGLSIMVCINKIDRGGADPEKALNDCLDLMMDLGADDAQLEFSM
FT                   EHVVYASAVNGFARLDPEDGNGDMLPLMDMIVDSLPAPDVDLDGPLAMQCVTIDHSDYV
FT                   GRVGIGRIYSGSIHTGDRILVVKNDGSRAMSQVKQLFTFDYLGRRECGEAQAGDIAAVV
FT                   GVDSTDIGDVYTDPDNPVELEPIEIDPPTLSIVFEPSTSPLVGREGDIVGGRQLKERLE
FT                   AERENNVTMRIEELPDKTGTEVSGRGILHLSVLMEQMRREGFEFQVGRPRVLFKKDEHG
FT                   NTVEPVEQAVVECPGEFSGKVIEVFGNSGGAMVSMDAGTTQTHLEFKIPTRGIMGLKNR
FT                   ILNVTHGEAVFYHTFLEYGPYAGELGVRQNGAMISMSTEKAVAYALGTLQERGTLFVEP
FT                   GTECYEGMLVGERSKPGDMVVNIARTKSLGNQRSSTADIAVQLTPPKTFSLEEALEYIM
FT                   DDELVEITPRNVRMRKRILNETDRRKWRVRHGMVDK"
FT   gene            complement(25114..25950)
FT                   /locus_tag="Olsu_0020"
FT   CDS_pept        complement(25114..25950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0020"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="COGs: COG2860 membrane protein; InterPro IPR005115;
FT                   KEGG: apv:Apar_0017 protein of unknown function UPF0126;
FT                   PFAM: protein of unknown function UPF0126; SPTR: B9CLT5
FT                   Membrane protein; PFAM: UPF0126 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67154"
FT                   /db_xref="GOA:E1QXP0"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXP0"
FT                   /protein_id="ADK67154.1"
FT                   /translation="MPRHYHGRARTRPTPSVPWEKNVISELISSASPDTAAVAIPAWLD
FT                   ITAVVVGAISGILVARERRLDLIGYIALAMFGGLGGGLVRDVVMQRGSVYMLSSPYAIL
FT                   ATVSAGVVGFLFPGMFGSFPGLLEWVDIISVGLFAAAGTDKAMVFSLNPLACVLMGTIT
FT                   GVGGGMLRDVCLGDVPRIFRRSNFYAICAIGGSMSYYLPVTLIHLQRLWATVLCVLITV
FT                   LLRRWSLRFNVMSPADIDLTPRVMDRARTVVTYAKNEGVARSRRVIRRPHRGAGDL"
FT   gene            26030..26120
FT                   /locus_tag="Olsu_R0003"
FT   tRNA            26030..26120
FT                   /locus_tag="Olsu_R0003"
FT                   /product="tRNA-Ser"
FT   gene            26168..26257
FT                   /locus_tag="Olsu_R0004"
FT   tRNA            26168..26257
FT                   /locus_tag="Olsu_R0004"
FT                   /product="tRNA-Ser"
FT   gene            26493..27623
FT                   /locus_tag="Olsu_0021"
FT   CDS_pept        26493..27623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: apv:Apar_0018 hypothetical protein; SPTR:
FT                   C8W8L9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67155"
FT                   /db_xref="GOA:E1QXP1"
FT                   /db_xref="InterPro:IPR025098"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXP1"
FT                   /protein_id="ADK67155.1"
FT                   /translation="MAGETNYYGRSWRLLTRDKGWIKVLLVMAIATVVPIAGPLGVLGY
FT                   ALEWARLTAWGVDAAPKQKGVGVGACIKSGWRGFVVMLGWNLALMLVFALLRSLFHYSS
FT                   VLEILILVVTVFSEVLFFVAALRAAIYQDFKAGYQANRLYDMLKRDFGGVAHVTGVTCL
FT                   MSLVVGIIMAVLFSVLLMPLIMQLATFVATSSSGYYGSYYYGYPSTDAMALRMMADTVG
FT                   SMVPGIVVAIYLGNVLASFYSLITVTMVALWMRQFNVPAWGASGDPLPEVGPVGLPATP
FT                   PSPASQQASPTEVPAQPAPPASAEAATSAQPTAEVPTESAAAPATTVVQEAEAAPQPAV
FT                   EQTQDPAEAAEVTPASEPGPEPASAPSAETADGTAE"
FT   gene            27888..28181
FT                   /locus_tag="Olsu_0022"
FT   CDS_pept        27888..28181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0022"
FT                   /product="SSU ribosomal protein S6P"
FT                   /note="COGs: COG0360 Ribosomal protein S6; InterPro
FT                   IPR000529:IPR014717:IPR020814; KEGG: apv:Apar_0019
FT                   ribosomal protein S6; PFAM: Ribosomal protein S6,
FT                   bacterial-like; SPTR: C8W8M0 Ribosomal protein S6; TIGRFAM:
FT                   ribosomal protein S6; PFAM: Ribosomal protein S6; TIGRFAM:
FT                   ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67156"
FT                   /db_xref="GOA:E1QXP2"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXP2"
FT                   /protein_id="ADK67156.1"
FT                   /translation="MKAYELLYFVDPACTEEVRAGVMKRIDVAVTENGGTIDNVEDWGK
FT                   RKLAFEIDKLNEGDYTLIDFHADPADIAELDRVLRINDAVKRHMVVRRTDRD"
FT   gene            28220..28690
FT                   /locus_tag="Olsu_0023"
FT   CDS_pept        28220..28690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0023"
FT                   /product="single-strand binding protein"
FT                   /note="COGs: COG0629 Single-stranded DNA-binding protein;
FT                   InterPro IPR016027:IPR011344:IPR000424:IPR012340; KEGG:
FT                   apv:Apar_0020 single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; SPTR: A4EBT9 Single-stranded DNA-binding
FT                   protein; TIGRFAM: single-strand binding protein; PFAM:
FT                   Single-strand binding protein family; TIGRFAM: single
FT                   stranded DNA-binding protein (ssb)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67157"
FT                   /db_xref="GOA:E1QXP3"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXP3"
FT                   /protein_id="ADK67157.1"
FT                   /translation="MSYVSINRVNISGNLTRDPELRATGSGTQVLTFGVAVNDRRRNPQ
FT                   SGDWEDVPNFVDCVVFGNRAEPLSRFLSKGQKVAIEGKLRWSQWERDGQRRSKLEVIVD
FT                   EVEFLSQRGAGQQGGDGYPSYATPAPTPAPQAPRPPVSTPPAADVYDEDIPF"
FT   gene            28734..29006
FT                   /locus_tag="Olsu_0024"
FT   CDS_pept        28734..29006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0024"
FT                   /product="SSU ribosomal protein S18P"
FT                   /note="COGs: COG0238 Ribosomal protein S18; InterPro
FT                   IPR001648:IPR018275; KEGG: apv:Apar_0021 ribosomal protein
FT                   S18; PFAM: ribosomal protein S18; SPTR: C8W8M2 Ribosomal
FT                   protein S18; TIGRFAM: ribosomal protein S18; PFAM:
FT                   Ribosomal protein S18; TIGRFAM: ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67158"
FT                   /db_xref="GOA:E1QXP4"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXP4"
FT                   /protein_id="ADK67158.1"
FT                   /translation="MAKQRQVEQRQPRRKYCQFCKEDVEFIDYKDTQLLRKYMTDRGKI
FT                   KPRRVTGACTQHQHDIAVAIKRAREMALLPYTVSVVSSRGGRGRG"
FT   gene            29195..30070
FT                   /locus_tag="Olsu_0025"
FT   CDS_pept        29195..30070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0025"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR006162; KEGG: apv:Apar_0022 hypothetical
FT                   protein; SPTR: C8W8M3 Putative uncharacterized protein;
FT                   PFAM: Predicted membrane protein (DUF2232)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67159"
FT                   /db_xref="GOA:E1QXP5"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXP5"
FT                   /protein_id="ADK67159.1"
FT                   /translation="MLSPVVSCALIAYGVTVASARDGQGARLSAFAVAAVSAVLAGLVV
FT                   GVGYVPSALVACCISLGYVVATSGRGRSLGPECLVMAGGSLAAIGVDSMAALQSGTTLP
FT                   AYLEHLADGYLGMLGGSVEMSRRMELASALQLYKAFWPMAYLLQSALSALLARLGTRAA
FT                   QKACGLPRTSLRLTEMRLPLWMGLAFVLGAVATVLGVQSPYQPDLIQLVGRNVFTAARA
FT                   ALAVQGIAVQMWAIGRAGNSRLTSFLWVIVAVWLETAFFVSSALGLVDLVADFRGLGGG
FT                   GAEHESKKSA"
FT   sig_peptide     29195..29254
FT                   /locus_tag="Olsu_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            30095..30616
FT                   /locus_tag="Olsu_0026"
FT   CDS_pept        30095..30616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0026"
FT                   /product="LSU ribosomal protein L9P"
FT                   /note="COGs: COG0359 Ribosomal protein L9; InterPro
FT                   IPR020069:IPR009027:IPR020594:IPR020070; KEGG:
FT                   apv:Apar_0023 ribosomal protein L9; PFAM: Ribosomal protein
FT                   L9-like; SPTR: C2D9L7 Possible ribosomal protein L9;
FT                   TIGRFAM: ribosomal protein L9; PFAM: Ribosomal protein L9,
FT                   N-terminal domain; Ribosomal protein L9, C-terminal domain;
FT                   TIGRFAM: ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67160"
FT                   /db_xref="GOA:E1QXP6"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXP6"
FT                   /protein_id="ADK67160.1"
FT                   /translation="MKVILLGELRGKGGEGDIVEVAQGYAENYLFPNKIAQPATPGNVK
FT                   QLEERRHNIEKREEKRISDANATKELLNGKSVTVDAKVGENDQLFGSVTTNQIVDAIKA
FT                   ELGVEVDRKRVARGATIKTAGRHEVEINLYRDINAIITVLVGIDEEAPEAGTTETSEPK
FT                   AEERPEDVTE"
FT   gene            31063..32457
FT                   /locus_tag="Olsu_0027"
FT   CDS_pept        31063..32457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0027"
FT                   /product="primary replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="COGs: COG0305 Replicative DNA helicase;
FT                   InterProIPR007693:IPR007692:IPR007694:IPR003593:IPR 016136;
FT                   KEGG: apv:Apar_0024 replicative DNA helicase; PFAM: DnaB
FT                   domain protein helicase domain protein; SMART: AAA ATPase;
FT                   SPTR: C2D9L8 Possible replicative DNA helicase DnaB;
FT                   TIGRFAM: replicative DNA helicase; PFAM: DnaB-like helicase
FT                   N terminal domain; DnaB-like helicase C terminal domain;
FT                   TIGRFAM: replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67161"
FT                   /db_xref="GOA:E1QXP7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXP7"
FT                   /protein_id="ADK67161.1"
FT                   /translation="MSDDYGSHGGISDGALPGGGSMPQDLAAEKSILSAMLLSQDVLQE
FT                   CLVHLEETDFYLHSHRTVFNAMKEMFDRGRPVDPISLSDHLRSAGSLERIGGMAFLLEL
FT                   NNNSFSLASWEHHVEILHRDATLRAIIEASAKITALAFDAPEDTKEVVDSAENLLLGVT
FT                   NREIGDSYSDLSEVMGDLYTELGEACMDPAEFMGVQTGYPGIDSRLQGLRPGQMIVVGA
FT                   RPGVGKTSFALNLATNAAAHGASVAFFSLEMSKVEIAQRLLSAYAHIPLSAIRGARIQD
FT                   NQWPTILDATRDLSRLDIMIDDTPGTTVTEIRAKARRMLNGKERGIVLVDYLQLLSPPS
FT                   GRQRMDSRATEVSEMSRGIKIMAKDLEVPVVALSQLNRQVTDRKGQRPQLSDLRESGSI
FT                   EQDADIVILLDRSMTEEESERPDRPDMNVTEFIIAKNRSGPLDIVPLMFLPGSTKFVEV
FT                   DRTHSE"
FT   gene            32530..33810
FT                   /locus_tag="Olsu_0028"
FT   CDS_pept        32530..33810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0028"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="COGs: COG0104 Adenylosuccinate synthase; InterPro
FT                   IPR001114:IPR018220; KEGG: apv:Apar_0025 adenylosuccinate
FT                   synthetase; PFAM: adenylosuccinate synthetase; PRIAM:
FT                   Adenylosuccinate synthase; SMART: adenylosuccinate
FT                   synthetase; SPTR: B9CLU4 Adenylosuccinate synthetase;
FT                   TIGRFAM: adenylosuccinate synthetase; PFAM:
FT                   Adenylosuccinate synthetase; TIGRFAM: adenylosuccinate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67162"
FT                   /db_xref="GOA:E1QXP8"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXP8"
FT                   /protein_id="ADK67162.1"
FT                   /translation="MPASVLVGTQWGDEGKGKVTDLISGDFDVVCRYAGGANAGHTVIA
FT                   NGHKLALHQVPSGVMYDGTYPVIGNGCIVDPEVLLGEIDMLEAQGISCDELRISGNAHI
FT                   VMPYHKDLDGAHEKRLGKNLIGTTKRGVGPTYMDKMNRTGLRVQDMLDEKIFREKLEAA
FT                   LAYTNPILEKVYEMPTYTVNQVCETYLPYAERIRPYIVESSLFLNEQLEAGRSILFEGA
FT                   QATMLDIDHGTYPFVTSSNCTAGGAVTGSGVGPTNIGRVLGIAKAYLTRVGSGPFPTEL
FT                   EGEIGDRLGEVGHEYGVTTGRKRRCGWYDSVVVNYAARVNGLTDLAITKLDVLGCLDEI
FT                   KVCVAYECDGKTYRTVPEHQSVFYHAKPVYETLPGWGCDISGVRDFYRLPREAKDYIDF
FT                   LEQLAGVRVSIITVGPDRDQTIDRYWK"
FT   gene            33813..34757
FT                   /locus_tag="Olsu_0029"
FT   CDS_pept        33813..34757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0029"
FT                   /product="degV family protein"
FT                   /note="COGs: COG1307 conserved hypothetical protein;
FT                   InterPro IPR003797; KEGG: apv:Apar_0026
FT                   phosphoribosylamine/glycine ligase; PFAM: DegV family
FT                   protein; SPTR: C2D9M0 Putative uncharacterized protein;
FT                   TIGRFAM: degV family protein; PFAM: Uncharacterised
FT                   protein, DegV family COG1307; TIGRFAM: EDD domain protein,
FT                   DegV family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67163"
FT                   /db_xref="GOA:E1QXP9"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXP9"
FT                   /protein_id="ADK67163.1"
FT                   /translation="MSTLSSVARSKFAIVCDSGCDLSLSSLERAKVSLVPLVVRMGGTR
FT                   YRDCVELDPTDFFVRYSSTRGQVGVSAPSRGEFERCYHELVGQGVVDIVSLHTSSALSD
FT                   AYDLALDAASSVEGAVIRVLDSRCYSGQLAIVLARMVADRDAGLSADAAVIRAQELASA
FT                   TRALFVPASESSPLPHGTTRQSGILGRADRLRTRALGLRRVFSVNQDGTPTELFSSNDL
FT                   SRLAGNMARAMSAYARKVGPLTYVEVTAGVPRQLAVVEKPLVTNEFEATRSAILSTNPS
FT                   TTARLGIGAVGLSYAPSSLIKPDEATSLMRPVD"
FT   gene            34773..36068
FT                   /locus_tag="Olsu_0030"
FT   CDS_pept        34773..36068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0030"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="COGs: COG0151 Phosphoribosylamine-glycine ligase;
FT                   InterProIPR011054:IPR016185:IPR000115:IPR011761:IPR
FT                   013817:IPR013815:IPR013816:IPR020560:IPR020559:IPR020562:I
FT                   PR020561; KEGG: apv:Apar_0026 phosphoribosylamine/glycine
FT                   ligase; PFAM: Phosphoribosylglycinamide synthetase,
FT                   ATP-grasp (A) domain; Phosphoribosylglycinamide synthetase,
FT                   N-domain; Phosphoribosylglycinamide synthetase, C-domain;
FT                   PRIAM: Phosphoribosylamine--glycine ligase; SPTR: C8W8M7
FT                   Phosphoribosylamine/glycine ligase; TIGRFAM:
FT                   phosphoribosylamine/glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, N domain;
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, C domain; TIGRFAM:
FT                   phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67164"
FT                   /db_xref="GOA:E1QXQ0"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXQ0"
FT                   /protein_id="ADK67164.1"
FT                   /translation="MAAAEKIDILLLGSGGREHALLVKLAASPRAGRLWVAPGNGGMRD
FT                   LAQVADVNQESPRDVAGFARREGIGLVVIGPEAPLVAGVADTVRAEGIPVFGPSAAAAQ
FT                   MEGSKKFAKEVMSRAGVPTAAYQSFTDERACADYVRGLGGPCVVKADGLAAGKGVIVAQ
FT                   TTEEALVGVHECFTDFGAAGSTVMVEEMLDGPECSLLALTDGTTVVPLATSQDHKRALD
FT                   GDRGPNTGGMGVYSPVPILLPDELEQMVRIERQVVGQLRADGIIYQGCLYGGFMLTKDG
FT                   PKVLEFNARFGDPETQVVLPRMKADLVECFLACDDGSLDEAMVRWEDDWAVSVVLASKG
FT                   YPGHYEKGKPISGIADANAMEGVFVYHAGTTLDDEGNVLTNGGRVLDVTAIAPSFEEAR
FT                   NKAYQACDRISFEGKTYRHDIGIKAIKGRANL"
FT   gene            36078..36797
FT                   /locus_tag="Olsu_0031"
FT   CDS_pept        36078..36797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0031"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR015797:IPR000086:IPR020084; KEGG:
FT                   apv:Apar_0027 NUDIX hydrolase; PFAM: NUDIX hydrolase; SPTR:
FT                   B9CLU6 Nudix hydrolase; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67165"
FT                   /db_xref="GOA:E1QXQ1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXQ1"
FT                   /protein_id="ADK67165.1"
FT                   /translation="MSGKGDGDPLGEAIDAMAGSARAFTFDGDLPAADHESGAPESRRL
FT                   VLGEEDPRDSGLAEHVVSEDVAWTGRIFNVDRLRVRMPDGREALRDVVRHPGAVAVVAL
FT                   TDDGRICLVRQYRTALGRVTVELPAGKLDPGEDPLDCAVRELAEETGVRAERMAFLTTI
FT                   ATSAGFADELIHIYMATGLRVTRSSPDDDEFINVDLVPLSELVDAVLDGRIEDAKTVVG
FT                   ALVCDAVARRLAPTSEE"
FT   gene            36927..37952
FT                   /locus_tag="Olsu_0032"
FT   CDS_pept        36927..37952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: apv:Apar_0029 hypothetical protein; SPTR:
FT                   C2D9M2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67166"
FT                   /db_xref="GOA:E1QXQ2"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXQ2"
FT                   /protein_id="ADK67166.1"
FT                   /translation="MAKKREAARIQKGALSAEQAEELFTTVDETGHTNEETAKRQRRRR
FT                   REVGQGVDVDPLSEADPSGSNVEKVITATAVGFVVVFLLIIVISQVATGLARRAGTADL
FT                   SDDVTVTTVATALDKGVEWGNGFTQFPDRFSVQEADENTHRIEVTVVDTSSKDVLEAFA
FT                   GSQIQAAALSVNALLNPNIDTITYHVNVYVNDEGEFQNAKFFGLVQPEGNMKTLMTFVW
FT                   TKTTTEEGVRFNCAITGVDSATQEQLRKAITSSFTPSSIISSLLGDSDDAATATVDSGE
FT                   PSPGVTGSSTGGPSATGASTSNAVSPDGAATTSAEASASPSAVDASSGDASASTTSTSG
FT                   S"
FT   gene            complement(38008..38877)
FT                   /locus_tag="Olsu_0033"
FT   CDS_pept        complement(38008..38877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0033"
FT                   /product="Phosphomethylpyrimidine kinase type-1"
FT                   /note="COGs: COG2240 Pyridoxal/pyridoxine/pyridoxamine
FT                   kinase; InterPro IPR013749; KEGG: apv:Apar_0030
FT                   phosphomethylpyrimidine kinase type-1; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1; SPTR: B9CLU9
FT                   Pyridoxamine kinase; PFAM: Phosphomethylpyrimidine kinase;
FT                   TIGRFAM: pyridoxal kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67167"
FT                   /db_xref="GOA:E1QXQ3"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXQ3"
FT                   /protein_id="ADK67167.1"
FT                   /translation="MTNARELFLYRREGAYIPRIAAVHDLCGYGKCSLGVAIPVLSAAG
FT                   CDVCPVPTSLFSAHTKFPTFYMHDTTSMLDGYLDAWSEVGIGLDAVYSGFLGSAGQVGA
FT                   IQRIYADHPQALRIVDPVMGDGGAKYPTYTDEMCAAMAALVDGADLLTPNLTEASILTG
FT                   VDYQGQDVTDEFVRENMRRLLDMGAKNVVIKGISRGDGKIRNYLAGSDVAFEEVAAEQL
FT                   PYMLHGTGDLYASALLAAVMAGKSLYESVAFAGRLVRDAMVITRDQPDFELRGVSFESV
FT                   LGEVTGLV"
FT   gene            39134..39595
FT                   /locus_tag="Olsu_0034"
FT   CDS_pept        39134..39595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0034"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="COGs: COG0041 Phosphoribosylcarboxyaminoimidazole
FT                   (NCAIR) mutase; InterPro IPR000031; KEGG: apv:Apar_0031
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; PRIAM: Phosphoribosylaminoimidazole
FT                   carboxylase; SPTR: B9CLV0 Phosphoribosylaminoimidazole
FT                   carboxylase, catalytic subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM: AIR carboxylase; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, PurE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67168"
FT                   /db_xref="GOA:E1QXQ4"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXQ4"
FT                   /protein_id="ADK67168.1"
FT                   /translation="MADAPLVGIIMGSKSDLPAMEACIKQLEEFGVPYELVVASAHRAP
FT                   TKVREWSSTAAERGIRVIIAAAGKAAHLGGVVAAYTPLPIVGVPMKTSDLGGMDSLLSM
FT                   VQMPAGVPVACVAIGGSRNAAIYATQILGTALPAYATKVAEFKRQMAEA"
FT   gene            39604..40467
FT                   /locus_tag="Olsu_0035"
FT   CDS_pept        39604..40467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0035"
FT                   /product="sortase, SrtB family"
FT                   /note="COGs: COG4509 conserved hypothetical protein;
FT                   InterPro IPR009835:IPR005754; KEGG: apv:Apar_0032 sortase,
FT                   SrtB family; PFAM: peptidase C60 sortase A and B; SPTR:
FT                   C8W8N3 Sortase, SrtB family; TIGRFAM: sortase, SrtB family;
FT                   PFAM: Sortase family; Alphaherpesvirus glycoprotein E;
FT                   TIGRFAM: sortase, SrtB family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67169"
FT                   /db_xref="GOA:E1QXQ5"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR009835"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXQ5"
FT                   /protein_id="ADK67169.1"
FT                   /translation="MAKHSAPHHAGNVTPPLSAVPSAARRPPAPRRPSASRVVSNVLIA
FT                   LGIILLLVAAGLWGFAQWRYHEQDVQNQKLAAYVQLPTEEQSSEAPVVDWAGLKAINGD
FT                   VVGWLYVPGTTINYPVYQGDDNEYYLRHSAEGDWIIAGQLFMDYENSTPGMVDNQSIIY
FT                   GHHLKNGTMFEQVAAMDDQSRFDEITTVWYVTETGSFELEPLMLYYTDPDDQNVRQFTF
FT                   ESTDAFHSYLGALLSKAVTRRGDAEQVIQGAEHVLTMSTCNYYDGYGRTILVCVPKSEA
FT                   NASASS"
FT   sig_peptide     39604..39708
FT                   /locus_tag="Olsu_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            40478..42028
FT                   /locus_tag="Olsu_0036"
FT   CDS_pept        40478..42028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0036"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="COGs: COG0034 Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase; InterPro
FT                   IPR005854:IPR017932:IPR000583:IPR000836; KEGG:
FT                   apv:Apar_0033 amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; SPTR: B6GDX9 Putative
FT                   uncharacterized protein; TIGRFAM:
FT                   amidophosphoribosyltransferase; PFAM: Phosphoribosyl
FT                   transferase domain; Glutamine amidotransferases class-II;
FT                   TIGRFAM: amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67170"
FT                   /db_xref="GOA:E1QXQ6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXQ6"
FT                   /protein_id="ADK67170.1"
FT                   /translation="MRDPSDLPRSVFADEDGDALHEECGVFGVWAPGRDVARLTYFALR
FT                   ALQHRGQESAGIAVGNGHTVLVRKDLGLVSTVFSDNDLAAMPGKVAVGHVRYGTSGARS
FT                   WEAAQPHFSTINDVIIALAHNGTLVNSDMLRGELVRLGVPFRSNTDSEVAAKLIGYYTE
FT                   QTSHLRDGIRHTMSLIEGGYAMALVRENALYAFRDPNGIRPLVLGHIPAHQASDAVCDD
FT                   GGLGDVPLGEGWVVASETCALDIVGARYVRDVRPGELIRISDDGLMSEEGTVPRACASC
FT                   IFEEVYFSRPDSIVGGHSVYSMRYAMGRQLAREAPVEADLIIGVPDSGLPPAEGFAHEL
FT                   GVPFGEGLIKNRYVARTFIQPTQELRRLGVRLKLNALRDNVAGKRIVMVDDSIVRGTTS
FT                   KQIVRMLKDAGATEVHVRINCPEVKWPCFYGIDTDVQEQLISATRGVEEVREFIEADSL
FT                   AFLSLAGLHCCVPHGGRCTACYDGHYPVPIPASFSAGKFLPGFAPVFGGVVAPGCGGA"
FT   gene            42098..43171
FT                   /locus_tag="Olsu_0037"
FT   CDS_pept        42098..43171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0037"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="COGs: COG0150 Phosphoribosylaminoimidazole (AIR)
FT                   synthetase; InterPro
FT                   IPR016188:IPR010918:IPR004733:IPR000728; KEGG:
FT                   apv:Apar_0034 phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein; PRIAM:
FT                   Phosphoribosylformylglycinamidine cyclo-ligase; SPTR:
FT                   B9CLV3 Phosphoribosylformylglycinamidine cyclo-ligase;
FT                   TIGRFAM: phosphoribosylformylglycinamidine cyclo-ligase;
FT                   PFAM: AIR synthase related protein, N-terminal domain; AIR
FT                   synthase related protein, C-terminal domain; TIGRFAM:
FT                   phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67171"
FT                   /db_xref="GOA:E1QXQ7"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXQ7"
FT                   /protein_id="ADK67171.1"
FT                   /translation="MESSQAKHVTYADAGVDVDEGARAVDAIRDAVRATSRPEVIGGLG
FT                   GFGSCFSMKSFKGMEDPVLVSGTDGVGTKLAVAQLLGRHDTVGQDLVAMCVDDVVPIGA
FT                   EPLFFLDYIAIGKLRAEQVEEIVRGIAEGCRLSGCALVGGEMAEHPGVMDPDDYDLAGF
FT                   VVGVVDRPKMIGPDKVRVGDAILGLPSSGIHSNGYSLVRKVAIEGRTLDELNAPLDELG
FT                   GESLADAVLRPTTIYAGKLMRVLRDGAPIHAMAHITGGGITENLNRALPTGVDAAVDRG
FT                   GEDGPAWDVPPIIDYCVRAAGLTPDEAYRTFNMGVGMSLIVAPADVDRIRDMLALEGLD
FT                   SFVMGSCVPGAGKVIYR"
FT   gene            43168..43806
FT                   /locus_tag="Olsu_0038"
FT   CDS_pept        43168..43806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0038"
FT                   /product="formyltetrahydrofolate-dependent
FT                   phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="COGs: COG0299 Folate-dependent
FT                   phosphoribosylglycinamide formyltransferase PurN; InterPro
FT                   IPR002376:IPR004607:IPR001555; KEGG: apv:Apar_0035
FT                   phosphoribosylglycinamide formyltransferase; PFAM: formyl
FT                   transferase domain protein; SPTR: A4EBR3 Putative
FT                   uncharacterized protein; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: Formyl transferase; TIGRFAM:
FT                   phosphoribosylglycinamide formyltransferase,
FT                   formyltetrahydrofolate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67172"
FT                   /db_xref="GOA:E1QXQ8"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXQ8"
FT                   /protein_id="ADK67172.1"
FT                   /translation="MSAQGAGARRPIKLGVLISGSGTNLQAIIDRIAAGALDATIEMVI
FT                   SSRPSAYGLKRAEDAGIQTMTLSKEIYADPIQADEVIATALRARGVDYVIMAGYMRMVH
FT                   APILRAFENHVVNLHPALLPSFKGAHAIQDAFDRGVKVTGVTVHFADDRYDCGPIIAQR
FT                   ALSVGEDWSVAELEEHIHTLEHELYPDVIQLLSEGRVHVGADGRVSVDE"
FT   sig_peptide     43168..43248
FT                   /locus_tag="Olsu_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            43991..45511
FT                   /locus_tag="Olsu_0039"
FT   CDS_pept        43991..45511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0039"
FT                   /product="putative collagen-binding protein"
FT                   /note="KEGG: ccu:Ccur_13770 putative collagen-binding
FT                   protein; SPTR: C7MLA5 Putative collagen-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67173"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXQ9"
FT                   /protein_id="ADK67173.1"
FT                   /translation="MRVAKSFVAGLLAAAAFVAVMLPGMHVAYADDTTGLAFDSVTIEE
FT                   AESHTQVADLMAGEVPALKAGVTYALDVSYKVPSGRQFSPTYLNVRLGDGIYVTGLPGA
FT                   TFTEGDISNTSFSKLLKTPTGTGTSPYGYPEAGSEKSRNGDLKYMTKNGLVRVDTKSEI
FT                   RFRIDDAYENQDASQVISDAIKVSLSTDETSEVDAHSYAINPADELKYGFWVDQATEVI
FT                   SKGGTTGTIEASNSGSGASLTEVGSKTTVQLIYPKDVELVGLEETALYKTNGTVVSTVE
FT                   DGDNKVVTIEWDEPGSYSGGLTFKPHLKVASDSARPNGSSFDVTLKNFKKTIWNDVPNA
FT                   DRTSGTQSATMKVTVIDGAVPEKITTHALVDYAPNWALKKYDTYNTRLGAYLIKNELAS
FT                   PTLPKTLEMTIDEGNTAIVRGVTIPYKEGMAYGAISWTASDGTSGTADPSILKKSDVSA
FT                   LITNTALGLDINTSITSIKVDLGPIPGGYDGIRPMQDILTPGIPPTSM"
FT   sig_peptide     43991..44080
FT                   /locus_tag="Olsu_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            45508..47739
FT                   /locus_tag="Olsu_0040"
FT   CDS_pept        45508..47739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0040"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="InterPro IPR008970:IPR019931; KEGG: ccu:Ccur_13770
FT                   putative collagen-binding protein; SPTR: C7MLA5 Putative
FT                   collagen-binding protein; TIGRFAM: LPXTG-motif cell wall
FT                   anchor domain protein; TIGRFAM: LPXTG-motif cell wall
FT                   anchor domain; conserved repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67174"
FT                   /db_xref="GOA:E1QXR0"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="InterPro:IPR038174"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXR0"
FT                   /protein_id="ADK67174.1"
FT                   /translation="MTDEYYGWSYISNGVYGSWKQGTDADVKTTVKLYTVGDEPGDGEA
FT                   IVGKSSAPEVLNGQGSISKTQINGGDSFTIQGVINDANWDWNPLQEPVLYAIMPEGFSY
FT                   SDLNVTEGTLGDPEFVGSFDRNGTEVKVWKYPIDIGDGTRGQYQPDFSIKSMKLSMTVS
FT                   TNKLAAKGVYHINDFVGFTTKDFKDIGAVIKSEKWDRSNWNTDKYTALFGDKVNSGETM
FT                   VSLSEGRGITVDQASEIAAASTFSVKDGQTGDVTDFAYDPANKPATTAVLQKGDTATVR
FT                   IAVRNNAGVEASSTSLFVPLLSKATNLGDSFTPEGSTELPLKLASVSASSNYAVKYLKL
FT                   SAGKTYDVNHAPRPGDYTEVDDPSEADMLLLESTRPLEANEGGYVAVSYAVNDTVGSAC
FT                   NDKRDVFNTVLDYDIEGNHSTLTLATNAATFAGTDVLLTKVWNDGNDAGKLRPTPDAFA
FT                   AALTLTSDKGIDLSAFAPQVKDKGDGTYEVSYRGLPKYKGNAGNIVAYTLTEGDIAHYT
FT                   TDSASIQGSGTTVEGTITNTYAPRPTTHDPAVEKKIEGPKPSSPDTFSFVLKRTDASFP
FT                   MPAGSDGDTKTITVEGAGSPEFGDIAFTLPGTYTYTITETKGGAACTYDGSSYALTYEV
FT                   ADDGQGKLRVKRSMTKTVDGTTTVVDLGAQGDAIGAVFTNVYPTPDIPTPTPNNPTSPD
FT                   RPKATKVRKTVGTQALPQTGDGTSSPVGLLALSALVLASGSVVRWHKGQ"
FT   gene            complement(47835..48602)
FT                   /locus_tag="Olsu_0041"
FT   CDS_pept        complement(47835..48602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0041"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="InterPro IPR000073; KEGG: shi:Shel_05300
FT                   hypothetical protein; PFAM: alpha/beta hydrolase fold;
FT                   SPTR: B9CLW3 Hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67175"
FT                   /db_xref="GOA:E1QXR1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXR1"
FT                   /protein_id="ADK67175.1"
FT                   /translation="MTIHEFGEENEGTIVLFHPLGVRWDVFNFVIPILREDYHLVIPAI
FT                   PGFDPDAPEADFTSVEQVADEVAAWLVGHGFGHVTCLYGCSMGGAIVARMLAVGKAGAD
FT                   CAVMDGGMTPYRLWRPLTYLIGARDFAMMEIGKHMSVQALRGVFDPGKYTEDDLGYIKE
FT                   AMHGMSAKTIWRSFYSCNNYPMPRPVPPVGCRVAYWYGSDERRARRWDIAYVREAFPCA
FT                   RIVENEGMGHAEFFTLHPEEFCERLTAWMRLPA"
FT   gene            complement(48599..49849)
FT                   /locus_tag="Olsu_0042"
FT   CDS_pept        complement(48599..49849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0042"
FT                   /product="23S rRNA m(5)U-1939 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG2265 SAM-dependent methyltransferase
FT                   related to tRNA (uracil-5-)-methyltransferase; InterPro
FT                   IPR001566:IPR010280; KEGG: apv:Apar_0053 RNA
FT                   methyltransferase, TrmA family; PFAM:
FT                   (Uracil-5)-methyltransferase; SPTR: B9CLW5 23S rRNA
FT                   (Uracil-5-)-methyltransferase RumA; TIGRFAM: RNA
FT                   methyltransferase, TrmA family; PFAM: tRNA
FT                   (Uracil-5-)-methyltransferase; TIGRFAM: 23S rRNA
FT                   (uracil-5-)-methyltransferase RumA"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67176"
FT                   /db_xref="GOA:E1QXR2"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXR2"
FT                   /protein_id="ADK67176.1"
FT                   /translation="MSFRTYTCPISRHCGGCEWLAVPYPIQLRRKQSMMEELLGPVAGR
FT                   DGARLGRIHGMEEPVSFRHKAATPFSPTRGGAIRSGFYAAGTHRIVDCDACLVEDPRAR
FT                   PILNDVACICAQVGIHAYQEDRGRGILRHAVVRCGYATDDILLTLVTNGQQLPRSNELV
FT                   EGIVRSHPEVTSIVQNVNQRRTNAILGRECRTLFGPGVMHDKLLGCTFEIGPTSFYQTN
FT                   PRQTEVLYALAVEAAGLRGGERVLDAYCGTGTIGICAAAATRRRGAEVQDVRVIGVEQV
FT                   GDAVACARRNATANGLGGSCSFVREDATAFMRKAAGCGEGRFDVVFMDPPRAGSTPAFI
FT                   HGVAGLAPHRVVYISCNPTTQARDLKEFQQLGYAVSTVELVDMFPHTKHVETIALMTRN
FT                   GGEWTRGQGPCGECEEE"
FT   gene            50060..51007
FT                   /locus_tag="Olsu_0043"
FT   CDS_pept        50060..51007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0043"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /note="COGs: COG0039 Malate/lactate dehydrogenase; InterPro
FT                   IPR015955:IPR016040:IPR001557:IPR001236; KEGG:
FT                   apv:Apar_0054 lactate/malate dehydrogenase; PFAM:
FT                   Lactate/malate dehydrogenase; SPTR: C8W8Q2 Lactate/malate
FT                   dehydrogenase; PFAM: lactate/malate dehydrogenase,
FT                   alpha/beta C-terminal domain; lactate/malate dehydrogenase,
FT                   NAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67177"
FT                   /db_xref="GOA:E1QXR3"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXR3"
FT                   /protein_id="ADK67177.1"
FT                   /translation="MGMVTKIGIIGMGHVGAHVANAILYQGLASEIYCVDSIESKVACE
FT                   VNDLQDAMPFYPRQARVYNCHENYDELLACDVVVNAAGHVAQSAGNRDGELFCTAEETK
FT                   KWAPHFQGYEGVVVTVSNPCDVIATMIWKLAGLDPRRVIGSGTALDSARLRHALWAETG
FT                   CNPNSITSWMMGEHGASQFAAWSHVSFGATPLAELEKSDPERFSLDKDAVEEAARRGGY
FT                   VTYAGKGCTEYSIANAATELVKAVVQDSKLITPCGTLLEDVYGGSGHFTSIPCVVGKDG
FT                   VERTFPLALSEVEQASFHASCAHIQENVEKIRCW"
FT   gene            51209..52681
FT                   /locus_tag="Olsu_0044"
FT   CDS_pept        51209..52681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0044"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG0535 Fe-S oxidoreductase; InterPro
FT                   IPR006638:IPR007197; KEGG: ere:EUBREC_0240 coenzyme PQQ
FT                   biosynthesis protein E; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB; SPTR: B9CLV6 Radical
FT                   SAM domain protein; PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67178"
FT                   /db_xref="GOA:E1QXR4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXR4"
FT                   /protein_id="ADK67178.1"
FT                   /translation="MQSKIAHAAERKAFGMVLDQIIKSASGDDREKNIGHLVDMAGKLL
FT                   KDTSPGATRGIKKGLYPGSKWEKYLFRIIDETNPHVLKTAILNGGYEAAFRGLRTTTAN
FT                   AEREQCNVPWIILFDPTSACNKHCVGCWAADYGNRLNLTFDEMDRLVSQAKDLGTHLFM
FT                   LTGGEPLVRKGDVLKLAEKHHDCLFNIFTNASLVDDAFCRDVQRLGNIVFSVSLESYEP
FT                   SVNDGRRGDGSFEEVMNAFDLMHKYGLLYGTSTAYTRDNTERVSSDEFFDLIISKGCRF
FT                   AWYFHYMPVGEGANADLMPTVEQREYMFRRIREIRGIEGGKPIFAMDFQNDGEFVGGCI
FT                   AGGRVYCHVNARGDVEPCVFIHYSNVNIKTADSWLDCLKQPLFQAYRAHYPWNKNMLQP
FT                   CPMLENPAILPRLVNESGAATSEYVAPESAEDLCGRTSPYARKWAPKAKELWNEMYPTG
FT                   EKVYADEMSSKDVSYKAKVIAAEDAAEEAVVD"
FT   gene            52867..54942
FT                   /locus_tag="Olsu_0045"
FT   CDS_pept        52867..54942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0045"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="COGs: COG0480 Translation elongation factors
FT                   (GTPase);
FT                   InterProIPR020568:IPR009022:IPR009000:IPR005225:IPR
FT                   014721:IPR000640:IPR000795:IPR004161:IPR005517; KEGG:
FT                   apv:Apar_0059 small GTP-binding protein; PFAM: elongation
FT                   factor G domain IV; protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; elongation factor G
FT                   domain protein; SPTR: C8W8Q7 Small GTP-binding protein;
FT                   TIGRFAM: small GTP-binding protein; PFAM: Elongation factor
FT                   Tu domain 2; Elongation factor G C-terminus; Elongation
FT                   factor Tu GTP binding domain; Elongation factor G, domain
FT                   IV; TIGRFAM: translation elongation factor EF-G; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67179"
FT                   /db_xref="GOA:E1QXR5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXR5"
FT                   /protein_id="ADK67179.1"
FT                   /translation="MATCTEKVKNLALVGQGGVGKTMLAEAMLHLTGRTSRLGGHAGTK
FT                   PTLDYDSEEGARGFSISTTIAPVTWGGCRINVLDAPCYPDFVGDAYGALAAAETALFVV
FT                   DAASGPGTITTRLWYAAEDLDIARALFINRLDRPDADWDTALLTAQERYGSRLVPVTMP
FT                   MGSGAEFGGIIDVVHMTARHLEDGKPVEEEIPPAFRDVAETVRAQLIELVVEADDDAMM
FT                   EYLDGGTIGQEQLEDLLGKALVGRIFVPVFAGSCVHEEGVISLLSAVAGWFPTMADYGR
FT                   VPLVNGEELDISPDDDRPVAFVFKSLQDAQNGKLSFVKVLAGTVAPGAELINARTRKTE
FT                   RLGHLYLMTGHDMVDVKSVASGDVCVVPKLDAMTGDTLSVTGKVEAAEFRFPNSLYRVA
FT                   IEPDQRGSEGKVFAFLEKAADADPTLSVGRDEDTGQTIVSAIGEAQVSVLLDRLEDRAG
FT                   VTAHTVKLRIPYRETIRRVASAQGRHKKQTGGAGQYGDCWLRVEPNPGAGYEFVDEVVG
FT                   GHVPRNFIPAIDKGVQETMREGVLAGYPLIDVRCAVYDGSYHPVDSNEMAFKTAARIGF
FT                   QKAVAQAEPVLLEPMAHLRITVPDSYAGSIMGDVSASRGRVEGMAAASGAVEAGLTTIE
FT                   ATVPYAEVTDYATRLRSLSRGTGEFEMELSGYEQVPHDVQQRLAEEYAERRAAGDK"
FT   gene            55657..56991
FT                   /locus_tag="Olsu_0046"
FT   CDS_pept        55657..56991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0046"
FT                   /product="protein of unknown function DUF21"
FT                   /note="COGs: COG1253 Hemolysins and related protein
FT                   containing CBS domains; InterPro
FT                   IPR000644:IPR002550:IPR005170; KEGG: apv:Apar_0064 protein
FT                   of unknown function DUF21; PFAM: protein of unknown
FT                   function DUF21; CBS domain containing protein;
FT                   transporter-associated region; SMART: CBS domain containing
FT                   protein; SPTR: C8W8R2 Putative uncharacterized protein;
FT                   PFAM: CBS domain; Domain of unknown function DUF21;
FT                   Transporter associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67180"
FT                   /db_xref="GOA:E1QXR6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXR6"
FT                   /protein_id="ADK67180.1"
FT                   /translation="MDVVISVTVTILLTIVNGYFSMSEMALSTAKRVMLEHDRDEGDAK
FT                   ASQAVSVMENDTTFLAAIQVAITLVGFFSSAFAATSLSEPLGGVLASLGLDAAVAGGMA
FT                   TVLITLVVSYFSIVVGELVPKRIAMADAERVAKQVAGPISGFSALARPLVWLTSASADG
FT                   LSRLLGIKSTDDRQDVSEDEIRYMVTDSDDLSDEEKSMIHEIFDLGDAIAREVMVPRVD
FT                   MTALEDSSTLTEVLDVMRRTGYSRIPIYHDDVDRIVGIAHIKDLIGPVVDDHAGPSRIS
FT                   AHLRSADFVPDTKDIIPLLSEMQTSHDQMVIVVDEYGGTAGVITIEDIIEEVVGEIEDE
FT                   FDPDNKYLTQLSDREWLVDGRFPIDDAIELGWPIEDNEEYETCAGFVLDLADGLPRPGD
FT                   VFAVDGYTFRVQSMRGRRVAMLRVSAPDPATNGEDAADEKGVGSD"
FT   gene            57178..58323
FT                   /locus_tag="Olsu_0047"
FT   CDS_pept        57178..58323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apv:Apar_0065 hypothetical protein; SPTR:
FT                   C2D8K9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67181"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXR7"
FT                   /protein_id="ADK67181.1"
FT                   /translation="MAQLIDIQRVEVGLENLTARVRLSDDAPLMTSEDLHGTTRVYNLM
FT                   PHIIEHACLGDAGKTFKAAMGNTELAHLLEHVTVELLAQTNLAGDVTSGRTYPIDGDER
FT                   LYDVQISCADDVLTAGALSSACWIMGWAFSGGGDPAPDVEAIVRGLCGLVDSLGDEPGK
FT                   RYEHEVEGRVAAEVEDERRRLLAEREAEIASAREVAYAAAERAARERAAAHAAERAARV
FT                   AAEEERRQEADRRAAARLEAERVLAQREEELRRLEAERQRLEAERLEAERLLAEVYAAA
FT                   ECDEGRTTDGMAATDVAPGAAGASAEDPHQAPRAQEDEPIPDFLVDATAGTVDPESPSE
FT                   PELPADPAPQAEPDAYAAPWEDVSSTDDRRHDDMPPTQGVR"
FT   gene            58398..58841
FT                   /locus_tag="Olsu_0048"
FT   CDS_pept        58398..58841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: apv:Apar_0066 hypothetical protein; SPTR:
FT                   B9CLY9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67182"
FT                   /db_xref="GOA:E1QXR8"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXR8"
FT                   /protein_id="ADK67182.1"
FT                   /translation="MNARGAIGFVLGSIMGAVAGVTAGVLLAPRPGAESRAMAADAMND
FT                   AWDTAVDSYERGARVVNEKINSVRPGVDATTDELRAKVDLARERMDQLRDSLSDAVTAT
FT                   STQVQDAVTAVADKVNAAADDATAAGETAAESVRIEVVDGDTE"
FT   sig_peptide     58398..58514
FT                   /locus_tag="Olsu_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            58846..59874
FT                   /locus_tag="Olsu_0049"
FT   CDS_pept        58846..59874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0049"
FT                   /product="PRC-barrel domain protein"
FT                   /note="InterPro IPR007903; KEGG: apv:Apar_0067 hypothetical
FT                   protein; PFAM: PRC-barrel domain protein; SPTR: B9CLZ0
FT                   Putative uncharacterized protein; PFAM: PRC-barrel domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67183"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXR9"
FT                   /protein_id="ADK67183.1"
FT                   /translation="MPKVSDLVGRKVFRPKPSRRAQDARSRLGKVHMAVFSPGGSRLVG
FT                   FTVKQPDVAGMVRRPDLFVALDSWRPTEGGLLVTNGKDSYDERARSRLGIDWDRCIMWT
FT                   GMDARTVSGRTLGYVSDVEFDSQTGSVSSFLVGDGSVAQSLVGSIAVPSAMVRGHEDGF
FT                   MVVDNAAAQLRPTGGAAAAAGEASAKARVQGAKAARGAGKAASSAVDRGSHALGRALGK
FT                   AKRALEDASADEGEVQGQLPATAAQNVNVGEPQASGRLHRSSEERAGESPRTYRPAGSA
FT                   TRGGSAPAEKPATKAKKAPARKVAPQSGGQGLDAARVVGRQLGRTKGMFGSFMDEYKKA
FT                   SK"
FT   gene            complement(59944..61182)
FT                   /locus_tag="Olsu_0050"
FT   CDS_pept        complement(59944..61182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0050"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="COGs: COG1914 Mn2+ and Fe2+ transporter of the NRAMP
FT                   family; InterPro IPR001046; KEGG: apv:Apar_0068 natural
FT                   resistance-associated macrophage protein; PFAM: natural
FT                   resistance-associated macrophage protein; SPTR: C8W8R6
FT                   Natural resistance-associated macrophage protein; PFAM:
FT                   Natural resistance-associated macrophage protein; TIGRFAM:
FT                   NRAMP (natural resistance-associated macrophage protein)
FT                   metal ion transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67184"
FT                   /db_xref="GOA:E1QXS0"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXS0"
FT                   /protein_id="ADK67184.1"
FT                   /translation="MTRDTKKAGMLAILATMGPGILTAFAGNDAGGIATYSTTGAQYGL
FT                   GMLWTVPLMCLLLVVVQETAARMGCATGKGFASLIREQFGVRISAVAMLSLIVSNFAVT
FT                   LSEFAGIASGMLLFNVPIQVSVPVAAVATWLLTLSGSYRRIEKILLALSAVFLTYIVSG
FT                   IIAQPDWGTALHSTIVPQWSSDPGYVSLLVANIGTTISPYMMFMVSSNVVEKNLGERDI
FT                   AGQRADNVSGAIAAEIVTWFIILTTGTVLFPAGISVNDAADAAKALVPLAGGYASALFA
FT                   VGLVGASFLAACVLPGITANAVCEAFGWERGADRSWREAPVYRGMITAITVTSALIVLI
FT                   PNVDLFAIMMVAQVINGVLLPILLFCMVSIAGDRHVMGRHANGRMWNALMWFTIVTVTI
FT                   LTVVMFVLQALGY"
FT   sig_peptide     complement(61087..61182)
FT                   /locus_tag="Olsu_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(61184..63025)
FT                   /locus_tag="Olsu_0051"
FT   CDS_pept        complement(61184..63025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0051"
FT                   /product="magnesium transporter"
FT                   /note="COGs: COG2239 Mg/Co/Ni transporter MgtE (contains
FT                   CBS domain);
FT                   InterProIPR011002:IPR011033:IPR006669:IPR000644:IPR
FT                   007903:IPR006668; KEGG: apv:Apar_0069 MgtE intracellular
FT                   region; PFAM: MgtE intracellular region; PRC-barrel domain
FT                   protein; CBS domain containing protein; SPTR: C2D9Q0 MgtE
FT                   intracellular domain protein; TIGRFAM: magnesium
FT                   transporter; PFAM: MgtE intracellular N domain; CBS domain;
FT                   PRC-barrel domain; TIGRFAM: Mg2+ transporter (mgtE)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67185"
FT                   /db_xref="GOA:E1QXS1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXS1"
FT                   /protein_id="ADK67185.1"
FT                   /translation="MIYLSQILGNPVFDLDGERIGRVNDLGIATGEVFPRVTALAVEGP
FT                   GKTPFMISWRKYVDSFDENELRLKVVKTDIRFSYLQPTEVLIARDLLNKQIVDTRGMRV
FT                   VRVNDLKLSDTSSSQLRLLGAEVGVRGILRTLSPAFERAVLRAAKALGKPLPEKIIAWN
FT                   YMDLLDRDLSDVKLSVSHKTLDELHPADIADILERLDPRLRGQVFAQLDDEQAAEAMAE
FT                   FDDDAMAARIVGDMAEGDASRMLSEMDPDDAAELVSELDYDKAEKLLRLMGVQERKAIR
FT                   QLLGYREDTAGRIMTSEALSLPEGGTAADAVDALRNLDEDFETVHYVYLKDEEGRLSGI
FT                   VTLNSLLLAEPTARLASIAIDEEIITAGPDDDQEDVAKDIAKYNLLAMPVVDDNRRLLG
FT                   IVTVDDALDVLEEEHEEDLQIAGAGHSDGGEGGRSHDVAWLIRNEAWFFVWMAGTVAVA
FT                   LLLGTRIGLIGVALLALALPVAVIAGNDAASYSINSFIAYDPDDEDAPSMVGFAFKGLG
FT                   LGLLFAGLVALVAGGVIGSLFGMDSDLGRLALGGVGAAAAGAFFSFAMAPATLRTLRWR
FT                   DERNLETSGTTLALCQMVAAVAVFVVVASSVLGGWGI"
FT   gene            63375..64055
FT                   /locus_tag="Olsu_0052"
FT   CDS_pept        63375..64055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0052"
FT                   /product="Transaldolase"
FT                   /note="COGs: COG0176 Transaldolase; InterPro
FT                   IPR013785:IPR018225:IPR001585; KEGG: apv:Apar_0092
FT                   transaldolase; PFAM: Transaldolase; SPTR: B9CM84
FT                   Fructose-6-phosphate aldolase 1; PFAM: Transaldolase;
FT                   TIGRFAM: transaldolase, putative, TalC family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67186"
FT                   /db_xref="GOA:E1QXS2"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXS2"
FT                   /protein_id="ADK67186.1"
FT                   /translation="MDKFELILDTADVEGIKQCLDILDVQGVTTNPTIITKSGKQPERA
FT                   IQDIIDVLDEDQKLFVQVVATGYDDIMEEARHIASLRGGKNVYAKVPVTHAGLKAIKRC
FT                   HVEGIKTLATAIYSADAAFMAAHNGADYLAPYVNRMCNYGDGVEQVCDLIDMLAVQGST
FT                   TKVLAASFKNADQVHRLVLNGIQAVTIPVDVALGMVGHPGTAIAVDEFSANWKAAYGRD
FT                   TLLA"
FT   gene            complement(64083..65036)
FT                   /locus_tag="Olsu_0053"
FT   CDS_pept        complement(64083..65036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0053"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="COGs: COG1349 Transcriptional regulators of sugar
FT                   metabolism; InterPro IPR001034:IPR014036; KEGG: cac:CAC0113
FT                   sugar metabolism transcriptional regulator; PFAM:
FT                   regulatory protein DeoR; SMART: regulatory protein DeoR;
FT                   SPTR: C2D9E1 DeoR family transcriptional regulator; PFAM:
FT                   Bacterial regulatory proteins, deoR family; DeoR-like
FT                   helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67187"
FT                   /db_xref="GOA:E1QXS3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXS3"
FT                   /protein_id="ADK67187.1"
FT                   /translation="MFRRERRDKILGMLELEGRVDTDDLATRFGVSVDSIRKDLQALAK
FT                   EGKCTRVYGGATRLEGPLRREVRGRELIPSLTGRLELEGLIGSAGLGGAPSAASLGGQG
FT                   RPGTGELIGSAPKPSPPRDALGGTSVTGDDDEGDGGRRAVARRAYLEINDGDSVFLDVS
FT                   RTNSMLADLIATGEKRLIVTTNMIEVLRKLTGVRNVTALGTGGYLNVQLNGFVGSATVS
FT                   LLEPLLFSKAFIGASGIDLTSWAVTSNDIDSGSVKERVIHNASYKFLLADEGKFGHVGS
FT                   FRFASLTDFSAIITDTNDPDTLLQLQRIGVPTLRSL"
FT   gene            65320..65772
FT                   /locus_tag="Olsu_0054"
FT   CDS_pept        65320..65772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0054"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="COGs: COG1762 Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type); InterPro
FT                   IPR016152:IPR002178; KEGG: pay:PAU_02591 putative
FT                   phosphotransferase enzyme II, a component sgca; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2; SPTR: C2D9D9 PTS family porter component
FT                   IIA; PFAM: Phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67188"
FT                   /db_xref="GOA:E1QXS4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXS4"
FT                   /protein_id="ADK67188.1"
FT                   /translation="MATMADMLKRENVQVVETCGGWEDAIAVAVQPLVDGGYVTPAYVE
FT                   GIIENTHKFGPYFVLAPDLALLHARPEQGVISQQLAVTVLREGVEFKEGEPVRVLVTLA
FT                   AENPDSHIDVMRVLATMFSDPKNIEKVATASTADDIFGFFVSGGAE"
FT   gene            65862..67334
FT                   /locus_tag="Olsu_0055"
FT   CDS_pept        65862..67334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0055"
FT                   /product="putative sugar-specific permease SgaT/UlaA"
FT                   /note="COGs: COG3037 conserved hypothetical protein;
FT                   InterPro IPR007333; KEGG: apv:Apar_0170 putative
FT                   sugar-specific permease SgaT/UlaA; PFAM: putative
FT                   sugar-specific permease SgaT/UlaA; SPTR: C2D9D8 PTS system
FT                   porter IIC component; PFAM: PTS system sugar-specific
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67189"
FT                   /db_xref="GOA:E1QXS5"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXS5"
FT                   /protein_id="ADK67189.1"
FT                   /translation="MAVLDFIVNILSTPAILVGLLALIGLALQGKPVEDVTKGTIKTIV
FT                   GFLVLSAGAAFLQSGSLLAFGELFNYAFNMQGVVPNNEAVVADALQNFGTSSAIIMALG
FT                   MAFNIVLARFSRMPYIFLTGHHTLYMACMLAVILGGAGHLEGGALYLAGGCLLGLIMVL
FT                   SPAYCQVTFRKVTGSDGVALGHFGGIGYWFAGVVGRLFANDPKRRSTEEISFPKRLVFL
FT                   RDTTVSISITMMVFFLVVVGVAVAKGVLGIVPAGTDPASASALLEPYGLTVANVGALLN
FT                   IGTETTTNWIVWSLTAGMSFAGGVYIILSGVRLIIGEIVPAFKGIADKLVPGAKPALDC
FT                   PVAFTYAPNAVIIGFLSSFVGGIMGLLVLNGINAAIPVALILPGVVPHFFCGATAGVFG
FT                   NAEGGLKGCIAGAFAHGLLITFLPMICMPVFNALGYVGTTFSDADFSWMGIVFGNVVNF
FT                   AQGALLVAICVIVYILPIAYNFVAPKKEQATE"
FT   sig_peptide     65862..65966
FT                   /locus_tag="Olsu_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            67778..68059
FT                   /locus_tag="Olsu_0056"
FT   CDS_pept        67778..68059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0056"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="COGs: COG3414 Phosphotransferase system
FT                   galactitol-specific IIB component; InterPro
FT                   IPR013011:IPR003501; KEGG: apv:Apar_0171 phosphotransferase
FT                   system lactose/cellobiose-specific IIB subunit; PFAM:
FT                   phosphotransferase system lactose/cellobiose-specific IIB
FT                   subunit; SPTR: C2D9D6 Protein-N(Pi)-phosphohistidine--sugar
FT                   phosphotransferase; PFAM: PTS system, Lactose/Cellobiose
FT                   specific IIB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67190"
FT                   /db_xref="GOA:E1QXS6"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXS6"
FT                   /protein_id="ADK67190.1"
FT                   /translation="MAIRKIMCACGSGLGSSLIVHMNTEEVVKKLGHPEIEVDHTTISD
FT                   VNPTAADLFVVGADLGDFISNIPDEQKVVLTNILDKNELERKIAAHLS"
FT   gene            68154..69008
FT                   /locus_tag="Olsu_0057"
FT   CDS_pept        68154..69008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0057"
FT                   /product="transketolase subunit A"
FT                   /EC_number="2.2.1.1"
FT                   /note="COGs: COG3959 Transketolase N-terminal subunit;
FT                   InterPro IPR005474; KEGG: lrh:LGG_00405 transketolase,
FT                   N-terminal subunit; PFAM: Transketolase domain protein;
FT                   SPTR: C2D9D5 Transketolase; PFAM: Transketolase, thiamine
FT                   diphosphate binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67191"
FT                   /db_xref="GOA:E1QXS7"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXS7"
FT                   /protein_id="ADK67191.1"
FT                   /translation="MEEKELRGVKLLAAKVRRDVLAMLQHRGYGHVGGSLSLVEAYAVL
FT                   YGKQLRYDAANPHWEGRDRVVLSKGHAGPVMYSTLAECGFFPTEWLMTLNDGGTRLPSH
FT                   TDRLKTPGVDATTGSLGQGTSEAAGIAQALAMRGSTSYTYLFVGDGELNEGQCWEAFQF
FT                   IAAKRLSRCIVLIDDNKKQLDGTTDEVMYNFDLAKKMEAFGFSTQVVDGQDIRAIDAAI
FT                   DAAKRNTETVNCIVLDTTKGAGVPYFEQAVSNHSMKWNNDEINQATAEAIARLNDEIER
FT                   GEA"
FT   gene            69008..69967
FT                   /locus_tag="Olsu_0058"
FT   CDS_pept        69008..69967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0058"
FT                   /product="transketolase subunit B"
FT                   /EC_number="2.2.1.1"
FT                   /note="COGs: COG3958 Transketolase C-terminal subunit;
FT                   InterPro IPR009014:IPR015941:IPR005475:IPR005476; KEGG:
FT                   lrh:LGG_00406 1-deoxyxylulose-5-phosphate
FT                   synthase(transketolase, C-terminal subunit); PFAM:
FT                   Transketolase domain protein; Transketolase central region;
FT                   SPTR: C2D9D4 Transketolase; PFAM: Transketolase, C-terminal
FT                   domain; Transketolase, pyrimidine binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67192"
FT                   /db_xref="GOA:E1QXS8"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXS8"
FT                   /protein_id="ADK67192.1"
FT                   /translation="MFKLAEDWGAAGRPYRDAVVDTLIDMMTGDASIVMLEADLGGASG
FT                   TLKIQKALPSQFIECGISEANMMGVAAGMSSEGFIPFVHTFGPFATRRAFDQVYLSGAY
FT                   AHNTLNIWGSDPGFTVGANGGTHTTWEDVALMRTIPDAVVVDGADPVQTEWVVREFSKS
FT                   RGIHYLRCGRKASYKVYEEGSTFELGKGNVIRRGTDVLIVTAGQLVKDALDSADGLEGQ
FT                   GISAEVIDMFCIKPLDVDLLVSESAGKRAVVTFENHGVIGGLGDACASALMEAGVAVPF
FT                   KRHGVVESFGQVGTADWLQATFKLTAADLEETVKSLLD"
FT   gene            70052..70693
FT                   /locus_tag="Olsu_0059"
FT   CDS_pept        70052..70693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0059"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="COGs: COG0274 Deoxyribose-phosphate aldolase;
FT                   InterPro IPR011343:IPR013785:IPR002915; KEGG: apv:Apar_0134
FT                   deoxyribose-phosphate aldolase; PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase;
FT                   PRIAM: Deoxyribose-phosphate aldolase; SPTR: B9CM19
FT                   Deoxyribose-phosphate aldolase; TIGRFAM:
FT                   deoxyribose-phosphate aldolase; PFAM: DeoC/LacD family
FT                   aldolase; TIGRFAM: deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67193"
FT                   /db_xref="GOA:E1QXS9"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXS9"
FT                   /protein_id="ADK67193.1"
FT                   /translation="MRLNQYMDHTLLKQDATKSQLDRLCDEAAEHGFKTVSINSCWTRH
FT                   CAERLAGTGVGITSCISFPLGACSTAAKAAEARQAVADGTTEIDMVLNVGRLVSGDDDY
FT                   CTEDIRGVVEAADGRPVKVILEVCLLDDEQIVRACKCAVAAGAAFVKTSTGFSTGGATI
FT                   HAVKLMRQTVGDACQIKAAGGIHTKEEALAMIEAGADRIGASASIAICEG"
FT   gene            70785..73895
FT                   /locus_tag="Olsu_0060"
FT   CDS_pept        70785..73895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0060"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="COGs: COG1472 Beta-glucosidase-related glycosidase;
FT                   InterPro IPR017853:IPR002772:IPR001764; KEGG:
FT                   sss:SSUSC84_1947 putative beta-glucosidase; PFAM: glycoside
FT                   hydrolase family 3 domain protein; SPTR: A6NRN0 Putative
FT                   uncharacterized protein; PFAM: Glycosyl hydrolase family 3
FT                   C terminal domain; Glycosyl hydrolase family 3 N terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67194"
FT                   /db_xref="GOA:E1QXT0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXT0"
FT                   /protein_id="ADK67194.1"
FT                   /translation="MPLRACGEGCPLHVGVDKRRVLKVAGWAAGSVLLVAVVAANVAAV
FT                   MFGETLESFLSTDKIDVTDTERQAQLARDAALAGEVEGGGLVLLQNRNAILPLAKDVTK
FT                   VNVFGWGSTQWVTSGSGSGGVAGESAGILDALTSRGIQYNEGLAQMYRDFQADRPWRDA
FT                   GTLNSRATEFCRLYDPDISDEGYYSQQLLDSARDYSDTAIVVLSRMAGESIDCPREQLR
FT                   VRTKGASPECAMGRSYLEPSPEEERLVRYVAANYQNVIVLVNSTNAMELGIVEDVEGVD
FT                   ACLLCGATGTDSAGAVVDALWGDVNPSGRTTDTYAYDFSTNASYANAGAEGEGCYVGSR
FT                   GLYPADGTPDTNEGVAATYDTVRFVDYVEGVYLGYRWYETADAEGYWDDVSNRHGMGYA
FT                   AVVQYPFGYGLSYTAFDWKIVSRRPRRGSNLADDDTVTTTVRVTNVGPVAGKDVVELYA
FT                   TPPYIAGGIEKPSTELVAFAKTDLLQPGESQDVVLSFTTRDLASYDCYDANHNGFAGYE
FT                   VERGDYQVELKRDAHTLDDCAHASATYHVDHDICYETDATTGAAVTNRFTGDVAEAGIS
FT                   IDGVTTGAGIRYLTRADFKGSFPQTRDVDRPMSNAVQIFNRYDAGLATAQDAAASRGAS
FT                   VGSEASGPDDVTREGDASPTADADEAAPAASGLASAYALTSNGALTPLGRELGEDYNDP
FT                   RWSPLLDRLGQSEMERFVLHGYSNSGALEGVSKPRTKDLDGSSQAASFNQLRYGTGFPS
FT                   PTVLAQTWDTQLARRYGRAVGMECAMLGIDGWYAPACNLHRSPVGGRNYEYYSEDPLVS
FT                   GEMAAQTILGSKETGTFCYLKHMVLNEQDSYRDSLYTWLTEQSLRELYLEPFRIAVEEG
FT                   GATGMMSSYNRIGAIWTGGSRALLTEVLRGEWGFRGSVITDYSDHHSYMNADEMLRAGG
FT                   SLYMDGVFRDGSFRFGTDSPNFRACLRRATKDVIYAWLNARAANLAYNDAALQAGTATI
FT                   DRPLKHRGVSPVLVGISVVDAVAALCVAVKAHRVLRRRARKKGHAGE"
FT   gene            complement(73949..74500)
FT                   /locus_tag="Olsu_0061"
FT   CDS_pept        complement(73949..74500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0061"
FT                   /product="LemA family protein"
FT                   /note="COGs: COG1704 conserved hypothetical protein;
FT                   InterPro IPR007156; KEGG: apv:Apar_0070 LemA family
FT                   protein; PFAM: LemA family protein; SPTR: C2D9D2 Membrane
FT                   protein LemA; PFAM: LemA family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67195"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXT1"
FT                   /protein_id="ADK67195.1"
FT                   /translation="MALVILVIALVVVLGVWFVSIYNGIVAKDNRCDNAWQTIDAQLQR
FT                   RNDLIPNLVETVKGYAAHESQTLEAVTSARAAVNAATTPEAKMAASNQLSQTLGHLFAV
FT                   AEAYPDLKANAGFQQLQGDLTDTEDKISYARQSFNDCVLGYNNAIETFPGNIVAGSKFT
FT                   VRRGFEIEDAAARQAPQVKF"
FT   sig_peptide     complement(74414..74500)
FT                   /locus_tag="Olsu_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(74639..74729)
FT                   /locus_tag="Olsu_R0005"
FT   tRNA            complement(74639..74729)
FT                   /locus_tag="Olsu_R0005"
FT                   /product="tRNA-Ser"
FT   gene            74790..75281
FT                   /locus_tag="Olsu_0062"
FT   CDS_pept        74790..75281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0062"
FT                   /product="tRNA-adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /note="COGs: COG0590 Cytosine/adenosine deaminase; InterPro
FT                   IPR016193:IPR016192:IPR002125; KEGG: apv:Apar_0071 CMP/dCMP
FT                   deaminase zinc-binding; PFAM: CMP/dCMP deaminase
FT                   zinc-binding; SPTR: B6GAD7 Putative uncharacterized
FT                   protein; PFAM: Cytidine and deoxycytidylate deaminase
FT                   zinc-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67196"
FT                   /db_xref="GOA:E1QXT2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXT2"
FT                   /protein_id="ADK67196.1"
FT                   /translation="MDERDDTPTVEDERFMGLALEEACIAATEDEVPIGAVVVCGGEVI
FT                   ARAHNRRETDGDPSAHAEFSAMVQAARALGRWRLTGCTVYVTLEPCLMCAGLMVNARVD
FT                   RCVYGAADPKGGAVGTLYDVSDDARLNHSFPVTAGVLEDECAQILRDFFRVRRKAREAR
FT                   "
FT   gene            75482..76327
FT                   /locus_tag="Olsu_0063"
FT   CDS_pept        75482..76327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0063"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /EC_number="4.1.2.40"
FT                   /note="COGs: COG0191 Fructose/tagatose bisphosphate
FT                   aldolase; InterPro IPR000771:IPR013785; KEGG:
FT                   lrl:LC705_00390 fructose/tagatose/ketose bisphosphate
FT                   aldolase, class II; PFAM: ketose-bisphosphate aldolase
FT                   class-II; PRIAM: Tagatose-bisphosphate aldolase; SPTR:
FT                   C2D7V1 Tagatose-bisphosphate aldolase; TIGRFAM:
FT                   ketose-bisphosphate aldolase; PFAM: Fructose-bisphosphate
FT                   aldolase class-II; TIGRFAM: ketose-bisphosphate aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67197"
FT                   /db_xref="GOA:E1QXT3"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXT3"
FT                   /protein_id="ADK67197.1"
FT                   /translation="MYTTLQNVLAEADQLNMAVGAFNTHNLEMVQAIAKAAGNQKTPVI
FT                   IQTSEGTAKYVGMRTLVAVVKSLAEALGVDMVLHLDHAKSWDNIREAVDAGYTSVMFDG
FT                   SALPFKDNILGTRRVVEYAHAAGASVEAELGTVGGTEDGLVVNPDAAKLTDPDDAVEFI
FT                   ERTGIDALAVAIGTNHGQYKSKTSINLDVLESIHQVATKPLVIHGGTGVSDADVHKVID
FT                   RGIRKFNVGTELLVQWNRKSKELYEAHKENVSNRDNVVPALEVVQGIVERKISLFKNIR
FT                   "
FT   sig_peptide     75482..75589
FT                   /locus_tag="Olsu_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            76368..77303
FT                   /locus_tag="Olsu_0064"
FT   CDS_pept        76368..77303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0064"
FT                   /product="PfkB domain protein"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR002173:IPR011611; KEGG: kpn:KPN_00350 putative
FT                   kinase; PFAM: PfkB domain protein; SPTR: B0P584 Putative
FT                   uncharacterized protein; PFAM: pfkB family carbohydrate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67198"
FT                   /db_xref="GOA:E1QXT4"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXT4"
FT                   /protein_id="ADK67198.1"
FT                   /translation="MSICCIGQSAYDITGRVDGDLRPDTKYRMEHHTESPGGPALNGAC
FT                   VCGLWGADVSLVSRIGKDAYGARITESLGRYGVKTELMIVDPEARTSLSLIVTNGATGG
FT                   RTIFNFPSPHGPVARMALPDDAPSVMLHDGHEPEASLEYMHAFPGALNVIDAGTCREST
FT                   LLVARLADYLIASQSFATQYLGHGLTLENDARLAAELVELREINGRRVAVTLGELGSVY
FT                   LGEDGLVRMPAFKTRVCDSTAAGDIFHGAFTFGVHAGLSMRDSMVLATMASSVSVSRSG
FT                   SQTSIPSLPEVREQLLSKGIAIGLGRGGES"
FT   gene            77300..78064
FT                   /locus_tag="Olsu_0065"
FT   CDS_pept        77300..78064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0065"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011991:IPR011663; KEGG: esi:Exig_0480 GntR
FT                   family transcriptional regulator; PFAM: UbiC transcription
FT                   regulator-associated domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH; SPTR: C2D7U4
FT                   GntR family transcriptional regulator; PFAM: Bacterial
FT                   regulatory proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67199"
FT                   /db_xref="GOA:E1QXT5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXT5"
FT                   /protein_id="ADK67199.1"
FT                   /translation="MTRHVSNGTEDTPLPNNLSREQLYYQLYNIVFQDITNGVYEVGDL
FT                   IPSETEYMQKFSVSRATVRKAMEMLVNNGLIVRRRGCGSEVVSAKPATALRSVESCIKR
FT                   LTSDHVIPIKCVVSAEMTTAGKDVADALNVRTGSSVYRLERVRCAGETAYYRETIFLAD
FT                   DYAPAILEHDFSRESLRAYYSNVLHVSWARANQQVFAVPADGDTARLLGIEPGVPVLLL
FT                   RRTSFDESGIPREYLVASYRTDHYYLDMTLEA"
FT   gene            78122..78586
FT                   /locus_tag="Olsu_0066"
FT   CDS_pept        78122..78586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0066"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="COGs: COG1762 Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type); InterPro
FT                   IPR016152:IPR002178; KEGG: yen:YE1330 phosphotransferase
FT                   enzyme II, A component; PFAM: phosphoenolpyruvate-dependent
FT                   sugar phosphotransferase system EIIA 2; SPTR: C2D7U9 PTS
FT                   family porter component IIA; PFAM:
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67200"
FT                   /db_xref="GOA:E1QXT6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXT6"
FT                   /protein_id="ADK67200.1"
FT                   /translation="MAEEASVTDLLRPENIQVVDSVANWEDAIRISLKPLIEGGYAEPR
FT                   YADNIIADTRELGPYYVLTEDVALIHARPEEGAIKKQMAVTLVHRPVTFPEGSFPVRLL
FT                   FALSAEDSHSHIEVIKMLASICMEESRVEDLATCETPEEIYRLLTAVAGG"
FT   gene            78647..78946
FT                   /locus_tag="Olsu_0067"
FT   CDS_pept        78647..78946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0067"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="COGs: COG3414 Phosphotransferase system
FT                   galactitol-specific IIB component; InterPro IPR003501;
FT                   KEGG: bcl:ABC3503 PTS system, mannitol-specific enzyme II,
FT                   B component; PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; SPTR: C2D7U8 PTS
FT                   family porter component IIB; PFAM: PTS system,
FT                   Lactose/Cellobiose specific IIB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67201"
FT                   /db_xref="GOA:E1QXT7"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXT7"
FT                   /protein_id="ADK67201.1"
FT                   /translation="MIKITAVCGAGLGSSLACQMAIDAACKAMGVEAKVNHTDTTSIGA
FT                   LASTTDVVCAGANFKKLIEKKSLPCPVIYLDRLVDKKEITAKLTPVLQEMGVLE"
FT   sig_peptide     78647..78718
FT                   /locus_tag="Olsu_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            79001..80311
FT                   /locus_tag="Olsu_0068"
FT   CDS_pept        79001..80311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0068"
FT                   /product="putative sugar-specific permease SgaT/UlaA"
FT                   /note="COGs: COG3037 conserved hypothetical protein;
FT                   InterPro IPR007333; KEGG: lrl:LC705_00388 PTS system,
FT                   ascorbate-specific IIC component; PFAM: putative
FT                   sugar-specific permease SgaT/UlaA; SPTR: C2D7U7 PTS family
FT                   porter component IIC; PFAM: PTS system sugar-specific
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67202"
FT                   /db_xref="GOA:E1QXT8"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXT8"
FT                   /protein_id="ADK67202.1"
FT                   /translation="MVVLQWIIDNILTQAAIIIALIAFLGLALQKKPAGEVFSGTLKTM
FT                   FGFMILSAGSSILQGSLKYFGALFNSAFNLGSSGGAVVASIEGINGQAMTDLGLGSEIA
FT                   IVLAGIFVVNILLARLTKFKYIFLTGQALLWESTLAVVFSWFLGLRGLPLILLASVVGG
FT                   CFATLMPAIAQPVVRKITGSDDIALGHFCTIGYMVAAGVSKLVGKEEDSAEDLEIPESL
FT                   DFLNDTYVSVFLVMIVFYLVTAIVAGPDKSAAVCEALDMSADVNYLVQAFLQCSTFVIG
FT                   LYVLMMGVRQLLDNIVPAFQGISQRLVPGAKPALDCPVLFPYAPNSVIMGFIFTTVGSL
FT                   IGMLITPVTGYLVIPGVMSNFFAGGTSGIFANAVGGRRGLIIGCIVHGIFIMIVPALLT
FT                   PMLAQIGFVNLTCTDVDTVFTGFLLYGVKLLFGGLIG"
FT   sig_peptide     79001..79060
FT                   /locus_tag="Olsu_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            80431..80820
FT                   /locus_tag="Olsu_0069"
FT   CDS_pept        80431..80820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lrl:LC705_00389 hypothetical protein; SPTR:
FT                   B0MET4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67203"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXT9"
FT                   /protein_id="ADK67203.1"
FT                   /translation="MFSPFKRKARKTAPEKSEQETRTSNEGLIAQAEALQEEIDSADGV
FT                   ERSDLLDQQGGLYQRAGATDRAIASFEASIETTRRMGMAYRGLTTLYSRKRSEAAAAGD
FT                   DATMRESFDKLQALMQSSKDMLRGK"
FT   gene            80851..81477
FT                   /locus_tag="Olsu_0070"
FT   CDS_pept        80851..81477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0070"
FT                   /product="kinase"
FT                   /note="KEGG: lrl:LC705_00391 kinase; SPTR: C2D7U5 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67204"
FT                   /db_xref="GOA:E1QXU0"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXU0"
FT                   /protein_id="ADK67204.1"
FT                   /translation="MGKTLVLLAGYPATGKSTFCAHLLKRHPGIPVVAPDDVKEELWDE
FT                   VGFDTAAEKDRLELRVWEIYYARMEQHMRLGGPIVTDYPFSGKQRPTLSSLVERYGYHA
FT                   ITVRFVGDIDRIYERSLKRDLSQARHLGHLMSHYHKGDYLADRTKADALVTPRTLRDRC
FT                   IGKGYGLFQMGDLIEVDATDISAIDDQKVIDEIERLADADACRKA"
FT   gene            81561..82541
FT                   /locus_tag="Olsu_0071"
FT   CDS_pept        81561..82541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0071"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="COGs: COG1171 Threonine dehydratase; InterPro
FT                   IPR001926; KEGG: aoe:Clos_0846
FT                   pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; SPTR: A8MER6 Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit; PFAM: Pyridoxal-phosphate dependent
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67205"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXU1"
FT                   /protein_id="ADK67205.1"
FT                   /translation="MGRWFTAADIREARERIRGHVRVTPLEESIYLNDDEHHYYFKLES
FT                   QQRGKSFKIRGALNTMAQLTPADCEFGVGTISTGNHGVAVSMAAHELGIDECIVVVPLG
FT                   TPRAKTDRIRYFGARTMSLGKDYDEALTLGINYIDRTGMFYVDPFEHDARVYCGQGTIG
FT                   LEILEQNPDIDTIVAPIGGGGLVSGIAVAAKSIKPDVRIVGVQTAACPAMVDSLHDGIC
FT                   YNRYPTEGDTVCEAIVGGIGQIAFETLPGLIDDIVVVSEKSIRAAFKFMIEREQCSVEA
FT                   GSAMVVAAAREFPERVGGQDVALVISGGNLDVGILSSVLEEDFEA"
FT   gene            complement(82559..83860)
FT                   /locus_tag="Olsu_0072"
FT   CDS_pept        complement(82559..83860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0072"
FT                   /product="SAM-dependent methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG1092 SAM-dependent methyltransferase;
FT                   InterPro IPR002478:IPR000241; KEGG: apv:Apar_0072
FT                   SAM-dependent methyltransferase; PFAM: putative RNA
FT                   methylase; SMART: PUA domain containing protein; SPTR:
FT                   C8W8S0 SAM-dependent methyltransferase; PFAM:
FT                   S-adenosylmethionine-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67206"
FT                   /db_xref="GOA:E1QXU2"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXU2"
FT                   /protein_id="ADK67206.1"
FT                   /translation="MRQTRPYPRMIVTKKAARSLRTGHPWVFAGEVIRMEPSGTDGRTA
FT                   ANGDVVDVFEENGTWQGAGLLSLGSKIRARIVSHNANDRLDQAFWARRAQWAWGLRKTT
FT                   MGGRSLPGCEPDTNCCRMIFSEADGFPGLIVDRYEDVLVAQVGTVGMERLKPTIYPLLV
FT                   QTLLADGQEVRGIYERNDSPVRAKDGLGLEKGWYDLSGSMVALPTPDSTRIRAHENGMA
FT                   FDLDIENSQKTGFFLDQKYNRRAVRGIAAGRRVLDCFCHVGAFGLNAAAGGAAGVRCVD
FT                   VSEAALDLAATNSRLNGLGERMSFTCADVLEYLPRLIRDKRLLSAEGGPFDLIVLDPPA
FT                   FTKSRSTVRHAAKGYLEINQAAMRLLPRGGYLATCSCSHFMTRDLLARAVAEAAHSANV
FT                   QLKQVQELQQAPDHPILWGVPETHYLDFFIFQVV"
FT   sig_peptide     complement(83774..83860)
FT                   /locus_tag="Olsu_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            84112..85974
FT                   /locus_tag="Olsu_0073"
FT   CDS_pept        84112..85974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0073"
FT                   /product="carbon starvation protein CstA"
FT                   /note="COGs: COG1966 Carbon starvation protein predicted
FT                   membrane protein; InterPro IPR003706; KEGG:
FT                   eel:EUBELI_01881 carbon starvation protein; PFAM: carbon
FT                   starvation protein CstA; SPTR: B6G9X1 Putative
FT                   uncharacterized protein; PFAM: Carbon starvation protein
FT                   CstA"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67207"
FT                   /db_xref="GOA:E1QXU3"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXU3"
FT                   /protein_id="ADK67207.1"
FT                   /translation="MNGLAVIVVAAVVLVIGYIGYGRWLAKSWGVDSGALTPATRMEDG
FT                   QSFVPASRFTVFAHQFSSICGAGPVTGTIVAMMFGWLPVLLWVLVGGIFFGAVHDFGAL
FT                   YASVKNNGKSLAQLIEKYIGRTGRRLFLLFSWLFCAIVIAAFTSMVAGTFKMTVTDAGV
FT                   DFAKSYAAGAAGTISVLFTFVAIAFGYACRRFRLDGRREFVLAVLLIAAMFLVGMRFPI
FT                   YLDTNGWVAVVMVYLVFASAMPIQTLKQPRDYLTTIMMVAMIACAVAGVFVLAIHGQAT
FT                   MAAPMVASADAMGALAAKGSYLFPVLFVSVACGALSGFHSLVSSGTSSKQVSNESDMLP
FT                   VGYGAMVLECLVAVIAIVTAAIMYGDMNTAGTGALNNGVASTPFQIFAAGLAKGMTTIG
FT                   LDSTFATVFMTMNVSALALTSLDAVARIGRSSFQEFFFKTNDARQLGEQRGALRVVTNV
FT                   WFATIVTLALGLSLTFGGYLNIWPLFGASNQLLGGMTMITLAVFCKATGRKGWMLYAPV
FT                   AFLLACTFTSLAMSAYGCACALAAGMTPDVVATKGLQLILAVLLMVLGAIVAYNCLREL
FT                   FSTKVGSKPDEEPEWTELGRQRVAEATSAVVLKTPAGEGASARA"
FT   gene            complement(86508..88172)
FT                   /locus_tag="Olsu_0074"
FT   CDS_pept        complement(86508..88172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0074"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="COGs: COG0513 Superfamily II DNA and RNA helicase;
FT                   InterProIPR014021:IPR001650:IPR014014:IPR014001:IPR
FT                   000629:IPR011545; KEGG: apv:Apar_0074 DEAD/DEAH box
FT                   helicase domain protein; PFAM: DEAD/DEAH box helicase
FT                   domain protein; helicase domain protein; SMART: DEAD-like
FT                   helicase ; helicase domain protein; SPTR: C8W8S2 DEAD/DEAH
FT                   box helicase domain protein; PFAM: Helicase conserved
FT                   C-terminal domain; DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67208"
FT                   /db_xref="GOA:E1QXU4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXU4"
FT                   /protein_id="ADK67208.1"
FT                   /translation="MTKKFAELGLNEHILAGVDALGFTRPTPVQAQAIPEILAGRDVLA
FT                   SAQTGTGKTAAFALPVLQLIEPLSRAARERDAAPGKEGDESEENAVEGGAVPSSPDVLA
FT                   DRSEGDPSLSAAVDADGNILTGATPSKPRRRRRHHRKVASAEIARQAADMCGSPDESAP
FT                   TKPKRKRHHGKAAAGSKSGRGCETHPSRQGGMRKPKANAHPFGPFALIVTPTRELAAQI
FT                   EGVVTTVCEQTGQRAVVVMGGAKFERQIRGLESGCDLLVATPGRLIDLMEHGHVSLKDV
FT                   HVLVLDEADRMLDMGFWPSVRRIVKECPDERQTLLFSATIPPSIKGTVDAMLKDPVVIE
FT                   VAHVGETADTVEEHLCPVTQGQKTQLLEALLSAGGAAGVQPERVLVFCRTKHRADDLDK
FT                   RLKSAGISADVMHADRPQRARERALEKFRAGTCQVLVATDVMSRGIDVSGIDAVVNYDV
FT                   PMDPEDYVHRIGRTGRAGATGHAYTFVAPDEISPLREIEYFTKKLVPVWDLAGFTYDDA
FT                   RIVPNPTRSASKPTRSLFSGSRGRGRSMGGGRYGRHY"
FT   gene            88709..89680
FT                   /locus_tag="Olsu_0075"
FT   CDS_pept        88709..89680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0075"
FT                   /product="homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /note="COGs: COG1897 Homoserine trans-succinylase; InterPro
FT                   IPR005697; KEGG: apv:Apar_0075 homoserine
FT                   O-succinyltransferase; PFAM: homoserine
FT                   O-succinyltransferase; PRIAM: Homoserine
FT                   O-succinyltransferase; SPTR: B9CLZ8 Homoserine
FT                   O-succinyltransferase; TIGRFAM: homoserine
FT                   O-succinyltransferase; PFAM: Homoserine
FT                   O-succinyltransferase; TIGRFAM: homoserine
FT                   O-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67209"
FT                   /db_xref="GOA:E1QXU5"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXU5"
FT                   /protein_id="ADK67209.1"
FT                   /translation="MPINIPDGLPAKRILREERIFALEEEVASRQEIRPLKVVILNLMP
FT                   TKVETETQILRLISKSPLQVDCDFMRVSSHESTHVSADHLVKFYDTFESFRDKDYDGMI
FT                   ITGAPVEHLAFGDVDYWDELCQIMDWSQEHVFSTMYLCWGAMAALWHLYQIPKRQMGSK
FT                   LFGVFRQRLCDEYSFLTNGFDEVHNMPHSRHAAIESSELAHHPELRVLSEGLDSGPALI
FT                   ATRDFHEVYVTGHFEYGRDTLASEFWRDFHKGLPIRVPENYFPDDDPERQPPFTWRAHA
FT                   NLLYRNWLNWIYQMTPYDLDEIPRAIASLRADSDGMVDKFDA"
FT   gene            complement(89750..90322)
FT                   /locus_tag="Olsu_0076"
FT   CDS_pept        complement(89750..90322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0076"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="COGs: COG0622 phosphoesterase; InterPro
FT                   IPR000979:IPR004843; KEGG: apv:Apar_0076 phosphodiesterase,
FT                   MJ0936 family; PFAM: metallophosphoesterase; SPTR: B9CM08
FT                   Phosphodiesterase YfcE; TIGRFAM: phosphodiesterase, MJ0936
FT                   family; PFAM: Calcineurin-like phosphoesterase; TIGRFAM:
FT                   phosphoesterase, MJ0936 family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67210"
FT                   /db_xref="GOA:E1QXU6"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXU6"
FT                   /protein_id="ADK67210.1"
FT                   /translation="MRLLIASDIHGAASWCKRLMDAMDEIRPDRVVLLGDLLYHGPRND
FT                   LPDDYAPKDVVEMLNGIGERIIAVRGNCEAEVDQMVLSFPCMADYNVLWDPDATNPVTG
FT                   GRGRELFLTHGHVYGPGIHNSIDRWPQLPAGSVLVYGHTHKKVREQSESHPGITVFNPG
FT                   SVGIPKDGTHGFGVWEDGELRHVALGA"
FT   gene            91402..93294
FT                   /locus_tag="Olsu_0077"
FT   CDS_pept        91402..93294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0077"
FT                   /product="chaperone protein DnaK"
FT                   /note="COGs: COG0443 Molecular chaperone; InterPro
FT                   IPR012725:IPR001023:IPR018181:IPR013126; KEGG:
FT                   apv:Apar_0094 chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; SPTR: C2D8D8 Chaperone DnaK; TIGRFAM: chaperone
FT                   protein DnaK; PFAM: Hsp70 protein; TIGRFAM: chaperone
FT                   protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67211"
FT                   /db_xref="GOA:E1QXU7"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXU7"
FT                   /protein_id="ADK67211.1"
FT                   /translation="MGKILGIDLGTTNSAMAVLEGGEPTIIVNAEGERTTPSVIGFRAD
FT                   GDRIVGKAAKNQAVTNPKNTVFSIKRFMGRRYNEVSSELKTVPYTVKAGTGDRAVVEIE
FT                   GEDFTPEQISAMTLAKMKADAEKYLGESVTDAVITVPAYFNDAQRQATKDAGKIAGLNV
FT                   QRIVNEPTAAALAYGLDKKDIDQKVLVFDLGGGTFDVSLLDLADGVVEVLATNGDNHLG
FT                   GDDWDQKVIDWMADKFQSENGIDLRRDPMTLQRLKEAAENAKKELSSAQQTEINLPFIA
FT                   MDANGPKNLMYTLTRAEFERITRDLLDRCKGPVTKALRDAGLQISDVNEVILVGGSSRM
FT                   PAVQDLVKTMTGKQPNMSVNPDEVVADGAAIQGGVLTGDVLGILLLDVTPLSLGVETMG
FT                   GVMTKMIDRNTTIPTSKTEIYSTAADNQTSVEINVLQGEREMAADNKSLGKFNLTGIPS
FT                   ARRGVPQIEVTFDIDANGIVKVTAKDKGTGKQQQITISGSTALSDDEVDRMVKDAESHA
FT                   EEDKKHKDEIEVRNQTDSLCYSTEQTLKDLGDKVPADMKKQVEDAVTDAKKALDGTDID
FT                   AIKSAGEKLQEVGHKLAEIVYSDTAAQASGDQATGGADDVVDADYEVVDDKDER"
FT   sig_peptide     91402..91491
FT                   /locus_tag="Olsu_0077"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            93307..94170
FT                   /locus_tag="Olsu_0078"
FT   CDS_pept        93307..94170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0078"
FT                   /product="GrpE protein"
FT                   /note="COGs: COG0576 Molecular chaperone GrpE (heat shock
FT                   protein); InterPro IPR009012:IPR013805:IPR000740; KEGG:
FT                   apv:Apar_0095 GrpE protein; PFAM: GrpE protein; SPTR:
FT                   B9CM92 Protein grpE; PFAM: GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67212"
FT                   /db_xref="GOA:E1QXU8"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXU8"
FT                   /protein_id="ADK67212.1"
FT                   /translation="MSVADEKREGTAPSAVPQGSPEEGDVRVPIDAGGDTKAATADDGA
FT                   GVVEAEPADVDDERARVEAAIRAGEQAAEDDFKADADKVRAERDELQRQLDSVADDIAA
FT                   AKKQAADSAERLVRLQADWDNYRRRTAAERLAERERAAEKLVLNLLPILDDMERASEHA
FT                   VQNNADDANLMQFVEGVNAVHDKMLGVLGKEGVEVIDPAGEAFDPLVHQAVGRVEDGEA
FT                   YDESIAQVYQKGYAMGGKVIRNAMVTVTYGGPKRPAPEPAEESPEGSVASGTDEASDPG
FT                   TTEDEE"
FT   gene            94237..95208
FT                   /locus_tag="Olsu_0079"
FT   CDS_pept        94237..95208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0079"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="COGs: COG0484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain; InterPro
FT                   IPR001623:IPR008971:IPR003095:IPR002939; KEGG:
FT                   apv:Apar_0096 chaperone DnaJ domain protein; PFAM:
FT                   chaperone DnaJ domain protein; heat shock protein DnaJ
FT                   domain protein; SMART: heat shock protein DnaJ domain
FT                   protein; SPTR: B9CM93 Chaperone protein DnaJ; PFAM: DnaJ C
FT                   terminal region; DnaJ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67213"
FT                   /db_xref="GOA:E1QXU9"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXU9"
FT                   /protein_id="ADK67213.1"
FT                   /translation="MAGKNYYDVLGVKRDATADDIKKSFRKLAAKYHPDAGGDEKRFKE
FT                   VSEAYTTLSDPQKRKEYDQMLMFGGIPGADFGGSGGRNRGGYTYTTNVGGADWSEIFDN
FT                   IRAGDGAFGGFDFSSIFGGQGATRQASGRPVKGGDLTMTIEISADEAFAGAQRKVSYTV
FT                   PSTGEQQSLNVKVPAGAVDGGKLRYRGRGEYGMNGGARGDLVVTTRVAEHPVFKRDGAD
FT                   VRMELPISVFEAALGANVDVPTPGGTEVRLKVPAGTQDGKTFRFRDLGAPDVKRKGSRG
FT                   ALYVTVKVQVPTRLSVKEREALEALRDGDGREYRRDVERYGA"
FT   gene            95198..95632
FT                   /locus_tag="Olsu_0080"
FT   CDS_pept        95198..95632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0080"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="COGs: COG0789 transcriptional regulator protein;
FT                   InterPro IPR009061:IPR000551; KEGG: apv:Apar_0097
FT                   transcriptional regulator, MerR family; PFAM: regulatory
FT                   protein MerR; SMART: regulatory protein MerR; SPTR: C2D8E1
FT                   Possible glutamine synthetase transcriptional repressor;
FT                   PFAM: MerR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67214"
FT                   /db_xref="GOA:E1QXV0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXV0"
FT                   /protein_id="ADK67214.1"
FT                   /translation="MARSEADGKDKPLYMISVAAELTGMHPQTLRVYEQKGLVNPGRSR
FT                   GNTRLYSARDIERLNLISKLTDEGINLAGVVRILDMRERALERDEEIDRLRVRIRELED
FT                   DIHELRMRERITALARYDGAGPEQVMRGLLSIPRDEGVDA"
FT   gene            95795..96802
FT                   /locus_tag="Olsu_0081"
FT   CDS_pept        95795..96802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0081"
FT                   /product="band 7 protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR001107; KEGG:
FT                   apv:Apar_0055 band 7 protein; PFAM: band 7 protein; SMART:
FT                   band 7 protein; SPTR: C8W8Q3 Band 7 protein; PFAM: SPFH
FT                   domain / Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67215"
FT                   /db_xref="GOA:E1QXV1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXV1"
FT                   /protein_id="ADK67215.1"
FT                   /translation="MIVEKKAHAASGWTMLFVNVVAYLAAVVLMVRGIEALAVADDLGP
FT                   ATPPASALPELLGGVALLVVAIIVSNGFFALQPGQARVCVLFGKYVGTVRDEGLRWANP
FT                   FYSKNLGMSSDEDPTASILTGGAKLGGHKHVSTISTRARTLNGDRLKVNDKMGNPIEIA
FT                   TVVVWRVSDTAKAVFDVDDYESFVSMQTETALRHVASVYAYDHMEDDDSTNSSITLRSN
FT                   IEEVSDSLKEELDRRLASAGVSVEDARLTHLAYAPEIAQAMLRRQQAEAIIAARKKIVE
FT                   GAVSMVDMALKQLSREGVVDFDEDRKAVMASNLMVVLCGESEAQPVLNTGSLYQ"
FT   gene            96813..97007
FT                   /locus_tag="Olsu_0082"
FT   CDS_pept        96813..97007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4877 conserved hypothetical protein; KEGG:
FT                   apv:Apar_0056 hypothetical protein; SPTR: C4F7V2 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67216"
FT                   /db_xref="GOA:E1QXV2"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXV2"
FT                   /protein_id="ADK67216.1"
FT                   /translation="MAARKQYPLRIDPVVWEAVERWAKDEMRSANGQVEWMLRDALRRA
FT                   GRLPGASGTHAGTEGRRQG"
FT   gene            97271..99922
FT                   /locus_tag="Olsu_0083"
FT   CDS_pept        97271..99922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0083"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="COGs: COG0542 ATPase with chaperone activity
FT                   ATP-binding subunit;
FT                   InterProIPR017730:IPR003593:IPR001270:IPR018368:IPR
FT                   004176:IPR003959:IPR013093:IPR019489; KEGG: apv:Apar_0100
FT                   ATP-dependent chaperone ClpB; PFAM: ATPase AAA-2 domain
FT                   protein; AAA ATPase central domain protein; Clp domain
FT                   protein; Clp ATPase-like; SMART: AAA ATPase; SPTR: B9CM96
FT                   ATP-dependent chaperone ClpB; TIGRFAM: ATP-dependent
FT                   chaperone ClpB; PFAM: AAA domain (Cdc48 subfamily);
FT                   C-terminal, D2-small domain, of ClpB protein; Clp amino
FT                   terminal domain; ATPase family associated with various
FT                   cellular activities (AAA); TIGRFAM: ATP-dependent chaperone
FT                   ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67217"
FT                   /db_xref="GOA:E1QXV3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXV3"
FT                   /protein_id="ADK67217.1"
FT                   /translation="MRFDKWAVTAQEALQSSLTIAADAEAGQVKPIHLLKALLSSDERN
FT                   LRAIIERVGADPAQVETQVDQAIAGQPRVTGDMSQMGISTELTRVGDAAEKLAGKMGDS
FT                   YVTSEHLLCALADERGEAGNALRASGVTSKRVQEAYDDLRGDERVTSQDQKAQFEALEQ
FT                   YGRNVTDLARQGKLDPVIGRVEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIVEGLAER
FT                   IVAGDVPSTIRDKDIVELDMSALVAGAKYRGEFEDRLKSVLKEVEKSAGRIILFIDELH
FT                   TIVGAGATEGSMDAGNILKPALARGELHAIGATTLDEYRKYIEKDQALARRFQTVLVSE
FT                   PTVEDTISILRGLKEKYEQHHRVRITDAALVSAADLSNRYISERFLPDKAIDLVDEAAS
FT                   RLRMELDSMPSEIDAVDRQLTQMQIEEQALMKEEDAASRERLEVLRGEIATTREKLDSM
FT                   KADWQNEKGAVDRVQDLKSKIEEARSEVDRAIRDGNLAHASELRYGTIPQLQREYDEAE
FT                   AVLSAKQEAGGILKEEVTTEEIAEVVSSWTGVPVSKMMQGEMDKLKNLEAELHKRVIGQ
FT                   NEAVEAVAAAVRRSRAGLSDPNRPLGSFFFLGPTGVGKTELAKALAACLFDDEKALVRI
FT                   DMSEYMEKFSVQRLIGAPPGYVGYDEGGQLTEAVRRHPYCVILLDEMEKAHPDVFNILL
FT                   QVLDDGRLTDGQGRVVSFKNTIVIMTSNVGSQFIAGANASSDPATVQKQVNDALRATFK
FT                   PEFLNRIDDVVVFHALGLDDIEKIVDIQLADVRKRLAKERIRLELSDAAIQALSLDGLD
FT                   PVFGARPLKRLIQRQVVDNVAGLIIDGQLHEGDTVRVDVGAGDRLVAVRAVGPVPATQP
FT                   ADDAPVEPDALE"
FT   sig_peptide     97271..97348
FT                   /locus_tag="Olsu_0083"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            100155..101447
FT                   /locus_tag="Olsu_0084"
FT   CDS_pept        100155..101447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0084"
FT                   /product="PASTA domain containing protein"
FT                   /note="COGs: COG2815 conserved hypothetical protein;
FT                   InterPro IPR005543; KEGG: ele:Elen_1639 PASTA domain
FT                   containing protein; PFAM: PASTA domain containing protein;
FT                   SMART: PASTA domain containing protein; SPTR: C8WHL6 PASTA
FT                   domain containing protein; PFAM: PASTA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67218"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXV4"
FT                   /protein_id="ADK67218.1"
FT                   /translation="MAGEKNVRGGTAARPIAAAVLLAVMLLATAAFATYGAELWGGKSV
FT                   PKVVGTSQVAATQELESKGFSVVVANDAVDDGIGKALSTEPGAGERAPEGSTVTLHVGV
FT                   QRIIPQVVGLSEADATTALRDVGAQRISIEHQASTAQEGSVVAVDPGEGSAFVSRDTIT
FT                   LTVAQSYTVPYVIGRTEDEATKDIEAAGLVASVSYVKSDQKAGTVVSCDPGQGTRIGAG
FT                   GTVALQVVEVNPSDYHHLGEYFRYSPRRIDEWLTEQGFSLQASHEDANGMAQALFVSAD
FT                   KGTVRLDSNPFAHNFDASQGAGDDVLARGARFEGVRLELASSDVPATAANLSDEALRQI
FT                   VELCGFSGQTAKVTQDNIRLPQGASKGTASFACAYGVQNGYSWSVVIVSDAGQLRVAAS
FT                   CAPTSLYDQYDLTGFGGGVADMIAYIDAYTG"
FT   sig_peptide     100155..100253
FT                   /locus_tag="Olsu_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            101510..101731
FT                   /locus_tag="Olsu_0085"
FT   CDS_pept        101510..101731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apv:Apar_0101 hypothetical protein; SPTR:
FT                   B6GAI6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67219"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXV5"
FT                   /protein_id="ADK67219.1"
FT                   /translation="MDVGAGTGVGVTNTSDVTVGASDGACASVAASPVDSDGRTAFLRA
FT                   ENEDDDGYDPYSDRRPDPEPLFERDPWR"
FT   gene            complement(101796..102353)
FT                   /locus_tag="Olsu_0086"
FT   CDS_pept        complement(101796..102353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apv:Apar_0103 hypothetical protein; SPTR:
FT                   B9CM99 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67220"
FT                   /db_xref="GOA:E1QXV6"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXV6"
FT                   /protein_id="ADK67220.1"
FT                   /translation="MSDNAHVPDWMIEDLSDLDAKAGDAAPSVSGGEGADVHEAHVRGA
FT                   GAQDVDLEGGVPTSQGQRYVHVPARGHAPYVRQRAPHRTQEAINDVGTDDDSPAAGYQH
FT                   DSNVTIGHAFSGGSGQYRRARRNVSGLKGSRYGQYLEIPKGRRSIFRSQESIRKRRSVL
FT                   SLIVVVLVLALVAAFIWHLLNH"
FT   gene            102598..103035
FT                   /locus_tag="Olsu_0087"
FT   CDS_pept        102598..103035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0087"
FT                   /product="heat shock protein Hsp20"
FT                   /note="COGs: COG0071 Molecular chaperone (small heat shock
FT                   protein); InterPro IPR008978:IPR002068; KEGG: apv:Apar_0104
FT                   heat shock protein HSP20; PFAM: heat shock protein Hsp20;
FT                   SPTR: C2D8E4 Possible heat shock protein Hsp20; PFAM:
FT                   Hsp20/alpha crystallin family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67221"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXV7"
FT                   /protein_id="ADK67221.1"
FT                   /translation="MASMIPYGSNYDRALRRAFDPFGSFFSDPFGTLASVANDGAFKMN
FT                   VEDAGDAYVVTAELSGVKRDEIDVELNEGRLSISVDRKESEEEKGKNYLHKETSEWSAT
FT                   RGVYLKDAATSGLTARLDGGVLTVNVPKQDEKANVTKVSID"
FT   gene            complement(103237..104061)
FT                   /locus_tag="Olsu_0088"
FT   CDS_pept        complement(103237..104061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0088"
FT                   /product="beta-lactamase domain protein"
FT                   /note="COGs: COG1235 Metal-dependent hydrolase of the
FT                   beta-lactamase superfamily I; KEGG: apv:Apar_0105
FT                   beta-lactamase domain protein; SPTR: B9CMA1 Beta-lactamase
FT                   domain protein; PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67222"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXV8"
FT                   /protein_id="ADK67222.1"
FT                   /translation="MYPHIHLHVLASGSKGNAAVVEGPKGSILIDCGISRRELLRRAGD
FT                   LGVDMGRVSALLLTHEHSDHVAGIPVFAKHFGGTLVATAGTVSGSPRLAGLSFDLVGHS
FT                   DSFDVAGMHVQCFPTSHDVGDPMGFRFSVTGDDGQAEDALGWCTDSGLLTAEALGLLRD
FT                   VRILGIESNHDVDLLAHGPYPAFLRARVGSDTGHLSNAQCAEALPLLVGPDTETVIALH
FT                   LSEKNNRPGVCVRTLAAAVGAEVLADNAAEARSPDGTLTVRAASQTTPLSVW"
FT   gene            104453..104647
FT                   /pseudo
FT                   /locus_tag="Olsu_0089"
FT   gene            104635..105086
FT                   /pseudo
FT                   /locus_tag="Olsu_0090"
FT   gene            105274..106785
FT                   /locus_tag="Olsu_0091"
FT   CDS_pept        105274..106785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0091"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="COGs: COG0037 ATPase of the PP-loop superfamily
FT                   protein implicated in cell cycle control; InterPro
FT                   IPR012795:IPR012796:IPR014729:IPR011063; KEGG:
FT                   apv:Apar_0106 tRNA(Ile)-lysidine synthetase; PFAM: PP-loop
FT                   domain protein; SPTR: B9CMA2 tRNA(Ile)-lysidine synthase
FT                   (TRNA(Ile)-lysidinesynthetase) (TRNA(Ile)-2-lysyl-cytidine
FT                   synthase); TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   TilS substrate C-terminal domain; PP-loop family; TIGRFAM:
FT                   tRNA(Ile)-lysidine synthetase, C-terminal domain;
FT                   tRNA(Ile)-lysidine synthetase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67223"
FT                   /db_xref="GOA:E1QXV9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXV9"
FT                   /protein_id="ADK67223.1"
FT                   /translation="MPSVNRRYASATPLFERPSSVHGEETRAPVVLMVSGGADSSALLL
FT                   LAATSTLDIDDGRGVARIARERLHVLHVNHQLRGIDAEEDEEFVRELSSRYGIPCTVRR
FT                   VDVAALAREGSGSGANVENAGREARYAAAAELAGQLSREFGTPRAAARILTAHTADDRA
FT                   ETFFMNAIRGTGPQGLSSIPRRRNLIVRPLLGRTHEELCDLLRMSGIVWREDKTNADTR
FT                   YLRSYVRHEVMPVVRARNPRVTANLATTCDLLSDEDSYLGQVAWRSYRDLLRRQSDGMV
FT                   ALDAGRLGAAEVAIARRVVRQAILAVRPDARLEARHVDRVLGLVAAGGGSASIPLGCDA
FT                   RVEYGLLFVRDHDSGRGTVALWLDVPGQARLPDGRGVRARLTEVPTGSRADELARAHAV
FT                   EWAGESVLLDAASCGLDRASGGRLWVDVAVPGDVMCPLGMHGQSKKLSDLLNEARIPAA
FT                   DRRRVPVVRTSPTGNILWVAGVRPDERVRCVPATKLLLELSILSL"
FT   gene            106847..107398
FT                   /locus_tag="Olsu_0092"
FT   CDS_pept        106847..107398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0092"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="COGs: COG0634 Hypoxanthine-guanine
FT                   phosphoribosyltransferase; InterPro IPR005904:IPR000836;
FT                   KEGG: apv:Apar_0107 hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase; PRIAM: Hypoxanthine
FT                   phosphoribosyltransferase; SPTR: C2D8E6 Hypoxanthine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: Phosphoribosyl transferase
FT                   domain; TIGRFAM: hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67224"
FT                   /db_xref="GOA:E1QXW0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXW0"
FT                   /protein_id="ADK67224.1"
FT                   /translation="MADVHEDIESVILSEEDIEAIVKRMGGEISRDYDGKNPLIIAVLR
FT                   GAFVFTADLMRAITVPCAVDFMAVSSYGDGIKSSGVVRIVKDLDTKIEGRHVIIAEDIL
FT                   DSGLTLSYLIDLLQARKPASVHVATFAVKDIKGKVPAIDPRYVGTHVPDAFIVGYGLDY
FT                   AERYRNLPYVGVLKSEVYAG"
FT   gene            107459..109441
FT                   /locus_tag="Olsu_0093"
FT   CDS_pept        107459..109441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0093"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /EC_number="3.6.4.3"
FT                   /note="COGs: COG0465 ATP-dependent Zn protease;
FT                   InterProIPR005936:IPR003593:IPR003960:IPR011546:IPR
FT                   003959:IPR000642; KEGG: ccu:Ccur_02180 membrane protease
FT                   FtsH catalytic subunit; PFAM: AAA ATPase central domain
FT                   protein; peptidase M41 FtsH extracellular; peptidase M41;
FT                   PRIAM: Microtubule-severing ATPase; SMART: AAA ATPase;
FT                   SPTR: A4EB64 Putative uncharacterized protein; TIGRFAM:
FT                   ATP-dependent metalloprotease FtsH; PFAM: Peptidase family
FT                   M41; ATPase family associated with various cellular
FT                   activities (AAA); TIGRFAM: ATP-dependent metalloprotease
FT                   FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67225"
FT                   /db_xref="GOA:E1QXW1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXW1"
FT                   /protein_id="ADK67225.1"
FT                   /translation="MPDNNQMGPGGLGQGGRTQPPRGPVRRWQLYVYTLVLIAFVVYLS
FT                   YTAFGALAPKSAVDRLATNEFVTAVKENRVRSVTFKTSDGSLSGTYQRDSDDSPTVDFS
FT                   STYVGADSLQELMARHPDVSFRIDTSSDDLWQTVLVSVVPTVIVVVALYYFMSQMQGAN
FT                   GRAMNFGRADRARTHEETRPKVKFADVAGIDEAVEELEEVRDFLREPERYRKMGAKIPH
FT                   GVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFKQAKEVAP
FT                   SIVFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEDNSAVILIAATNRPDILD
FT                   PALLRPGRFDRQVTVDRPDVKGRKKILGVHAENKPMEKTVDLGRIAKLTPGFTGADLAN
FT                   LMNESALLAARRRRERISMGEVEEAMERVMAGPEKKGRVMTQAERMTIAYHESGHALVG
FT                   HVLENSDPVHKISIISRGRALGYTMQLPEEDRFLETRDGMLDQIAVLLGGRTAEELFCS
FT                   DITTGASNDLERATKLAREMVTRYGMSDELGAQVYGEAQHEVFLGRDYANHHDYSAETS
FT                   KRIDDEVERIMREAHLRACEVLEARRAQMDTIAHVLLERETVEGEVVSALLDDRWDAYL
FT                   AAHPGESAVGEGAADGRATGAGAGE"
FT   gene            109461..110237
FT                   /locus_tag="Olsu_0094"
FT   CDS_pept        109461..110237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0094"
FT                   /product="cinnamoyl ester hydrolase"
FT                   /note="COGs: COG1506 Dipeptidyl
FT                   aminopeptidase/acylaminoacyl-peptidase; KEGG: tde:TDE0358
FT                   cinnamoyl ester hydrolase; SPTR: C0EAD6 Putative
FT                   uncharacterized protein; PFAM: Prolyl oligopeptidase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67226"
FT                   /db_xref="GOA:E1QXW2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXW2"
FT                   /protein_id="ADK67226.1"
FT                   /translation="MWCGRTADDGTRLKIYGELHLPDGAQDAAFTHLRLPTVIMAHPFG
FT                   VDGRSMDVYAQLLCDAGMVVYNVDFCGGGPRARSDGDMLHMSVETEAADLWAVVGAMAE
FT                   EPFCDPGRLFLMGASQGAFVATLVACRNPHVVRALALMYPAYVLHDDARRRFGDGTELP
FT                   ESYDMMGCAVGRRYAADALACDPYVEMPRFSGDVLLMQGDADPIVPLAFAERAAGAFPH
FT                   ARLERFVGAGHGFSGDDLQRSFSCARDFFREVSVRA"
FT   gene            110258..111439
FT                   /locus_tag="Olsu_0095"
FT   CDS_pept        110258..111439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0095"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase;
FT                   InterProIPR015424:IPR015421:IPR015422:IPR001176:IPR
FT                   004838:IPR004839; KEGG: apv:Apar_0108 aminotransferase
FT                   class I and II; PFAM: aminotransferase class I and II;
FT                   SPTR: B9CMA4 Aspartate aminotransferase; PFAM:
FT                   Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67227"
FT                   /db_xref="GOA:E1QXW3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXW3"
FT                   /protein_id="ADK67227.1"
FT                   /translation="MAINRTSYDYGSAKSSIREIAAYGAARKAEIGAERVFDFSLGNPS
FT                   IPAPEAVRASIERNVRLPPTQLHSYTPAAGLPFVRQAVADSLNRRFSTSYQVGDLYLTC
FT                   GAAASLSITLHAIVNPGDEVIVMAPYFPEYRVWIEASGAHCVEVKADRDSFQIDTEAVA
FT                   AAITARTKAVLIDSPNNPVGAVYPAQNLVALADVLRGRCRDLGIRIYLVSDEPYREITY
FT                   GAEVPWVPALYERAIVCYSYSKSLSLPGERIGWVLVPDTNPDHDDLVPSVAGAGRKLGF
FT                   VCAPALFQRVLADCVDEPVNVDAYARNREALTRGLSALGYEYVEPQGAFYLWVRSLEPD
FT                   AEAFFQRAKALELLPVPSDSFGCTGWVRLGYCVSHDTIEGSMGAWGRLREQYL"
FT   gene            111439..112332
FT                   /locus_tag="Olsu_0096"
FT   CDS_pept        111439..112332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0096"
FT                   /product="PHP domain protein"
FT                   /note="COGs: COG1387 Histidinol phosphatase and related
FT                   hydrolase of the PHP family; InterPro
FT                   IPR016195:IPR003141:IPR004013; KEGG: apv:Apar_0109 PHP
FT                   domain protein; PFAM: PHP domain protein; SMART:
FT                   phosphoesterase PHP domain protein; SPTR: C4FC22 Putative
FT                   uncharacterized protein; PFAM: PHP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67228"
FT                   /db_xref="GOA:E1QXW4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXW4"
FT                   /protein_id="ADK67228.1"
FT                   /translation="MGTCTGRDGGACGGRDSRQTGCRPLHIACDVHTHTLFSRHAYSTI
FT                   EENVRAAAGRHIELLGSTDHFSSMLHREATGERASGYDLRDNQYFLNYAVWPRTWHGVR
FT                   LLHGCEADIVDLDGRLFGYDAPVAYEINGASLGCATTLKERVFRDCDYVIASVHNAEFA
FT                   HGASLARTTAMYVHALEDPKVLILGHTGRSAVPFDMDEVLAVAKDLGKLIEINEATLVS
FT                   HQEASGACRRIAERCAELGVMVSTGTDAHISCDIGRLDRVRSLLGEIGFPQRLVATRDA
FT                   ETFMGVLSRARGTLRA"
FT   gene            complement(112402..113145)
FT                   /locus_tag="Olsu_0097"
FT   CDS_pept        complement(112402..113145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0097"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="COGs: COG0846 NAD-dependent protein deacetylase SIR2
FT                   family; InterPro IPR003000; KEGG: cpf:CPF_0249
FT                   NAD-dependent deacetylase; PFAM: Silent information
FT                   regulator protein Sir2; SPTR: A4EBP4 Putative
FT                   uncharacterized protein; PFAM: Sir2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67229"
FT                   /db_xref="GOA:E1QXW5"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXW5"
FT                   /protein_id="ADK67229.1"
FT                   /translation="MGQVITDAHEAAQVLAGHVARASHTVFFGGAGVSTASGIPDFRSE
FT                   NGLYRQHFSSEYPPEELLSHHLWRERPELFYDFYRTMMCTPDARPNQAHLKLAQLEAED
FT                   GLDVVITQNIDGLHQKAGSKNVVELHGSTKRNHCMGCGALYDEAWMLATAGVPHCKRCG
FT                   GVVKPDVVLYEEPLGEGDVRAAVEAISASDLLIIGGTSLVVYPAAGLVRYFRGDAIIIV
FT                   NLQPTPQDAGADVVCACDIASAFDW"
FT   gene            113269..114168
FT                   /locus_tag="Olsu_0098"
FT   CDS_pept        113269..114168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0098"
FT                   /product="Patatin"
FT                   /note="COGs: COG4667 esterase of the alpha-beta hydrolase
FT                   superfamily; InterPro IPR016035:IPR002641; KEGG:
FT                   mlu:Mlut_15620 predicted esterase of the alpha-beta
FT                   hydrolase superfamily; PFAM: Patatin; SPTR: C5CBD1
FT                   Predicted esterase of the alpha-beta hydrolase superfamily;
FT                   PFAM: Patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67230"
FT                   /db_xref="GOA:E1QXW6"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXW6"
FT                   /protein_id="ADK67230.1"
FT                   /translation="MEDDLTNNITDCALVFEGGGYRAAYTAAIANALLREGLYFDFVCG
FT                   LSAGASHAVDYVSRDQHRVKEAFMGRDGNERIGGVRSLLRGKGYFNADYLYAGCIDDGR
FT                   LPFDFATFSRNPARVSIQAFERDTGRTVVFTKDDMPDVHQMIDRVRASSTLPMLMKPLP
FT                   IEGTTYLDGGLGEGAGIPVRMAEQAGFDRFVLVATRPAGYRKTEPTARERRMIVRFGKS
FT                   HPYVRNALLTRWERYNEELDRVERLEGEGRCLVVRPNTMPVKSTTLDSTQLEAAYQLGA
FT                   AQAQREIPRIKEFLFPSS"
FT   gene            114239..115030
FT                   /locus_tag="Olsu_0099"
FT   CDS_pept        114239..115030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0099"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="3.1.11.2"
FT                   /note="COGs: COG0708 Exonuclease III;
FT                   InterProIPR005135:IPR000097:IPR004808:IPR020847:IPR 020848;
FT                   KEGG: apv:Apar_0110 exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; PRIAM:
FT                   Exodeoxyribonuclease III; SPTR: B9CMA6 Exodeoxyribonuclease
FT                   III; TIGRFAM: exodeoxyribonuclease III Xth;
FT                   exodeoxyribonuclease III; PFAM:
FT                   Endonuclease/Exonuclease/phosphatase family; TIGRFAM:
FT                   exodeoxyribonuclease III; exodeoxyribonuclease III (xth)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67231"
FT                   /db_xref="GOA:E1QXW7"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXW7"
FT                   /protein_id="ADK67231.1"
FT                   /translation="MADTVAPDRALKLVSWNVNGLRAVMRKDPSFLQIFSQLDADVFAI
FT                   QETKLQEGQVELDLPGYFQTWNFAERKGYSGTAVFSREDPLRVIRQIGSDVADDEGRVC
FT                   ALEFPTFWFVDVYTPNSKQGLARIEERMGWDERFRLFLLELDAHKPIVTCGDFNVAHQE
FT                   IDLRNPSTNHENPGFSDAERDSFGRLLDAGFTDTFRSLNPDLEGAYSWWSYRMRARERN
FT                   VGWRIDYFLTSERVADRIEGASIHDEVFGSDHCPIELQIRL"
FT   gene            115109..115711
FT                   /locus_tag="Olsu_0100"
FT   CDS_pept        115109..115711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0100"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="COGs: COG0302 GTP cyclohydrolase I; InterPro
FT                   IPR001474:IPR018234:IPR020602; KEGG: ccu:Ccur_11630 GTP
FT                   cyclohydrolase I; PFAM: GTP cyclohydrolase I/Nitrile
FT                   oxidoreductase; PRIAM: GTP cyclohydrolase I; SPTR: C7MPL0
FT                   GTP cyclohydrolase I; TIGRFAM: GTP cyclohydrolase I; PFAM:
FT                   GTP cyclohydrolase I; TIGRFAM: GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67232"
FT                   /db_xref="GOA:E1QXW8"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXW8"
FT                   /protein_id="ADK67232.1"
FT                   /translation="MVEPTMHDGWRMDHDKIERGVRLMLAGMGEDPDREGLRETPARVA
FT                   RALEESCAGLCQDPALLFEKSFDVGCHEMVIVRDIPFYSLCEHHLLPFFGVAHVAYLPG
FT                   EDGRVCGISKLARVVDVFAKRPQVQEQLTRQVADAVMEGVGASGVLVVMEAEHLCMTMR
FT                   GVRKPGAKTTTSAVRGAFERHDATRAEAMSLIFNGTK"
FT   gene            115784..117223
FT                   /locus_tag="Olsu_0101"
FT   CDS_pept        115784..117223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0101"
FT                   /product="dihydropteroate synthase"
FT                   /note="COGs: COG0294 Dihydropteroate synthase; InterPro
FT                   IPR011005:IPR000550:IPR006390:IPR000489; KEGG:
FT                   apv:Apar_0111 dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase DHPS;
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK;
FT                   SPTR: B9CMA7 Dihydropteroate synthase 1; TIGRFAM:
FT                   dihydropteroate synthase;
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM: Pterin binding enzyme;
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK);
FT                   TIGRFAM: dihydropteroate synthase;
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67233"
FT                   /db_xref="GOA:E1QXW9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXW9"
FT                   /protein_id="ADK67233.1"
FT                   /translation="MLREDYATWRCGNHEISLARPRVMGILNVTPDSFSDGGENLDPQK
FT                   AVDRALQMLDEGADIIDVGGESTRPGHTPVSPDEEASRVVPVVRGILAAAPSAVVSIDT
FT                   RHAGVAKMCVRLGASVVNDVSGFTDSQMVQVAAESSCGCVVMHWNKLSGASSRRSVQLD
FT                   SARPVRTRAARPVPTSTRRFTLPEEAPIMREIMGFLGDQARTLMRAGVSHDRICVDPGP
FT                   GFDKSADQDVVIQRATSKLVSIGYPVLCAVSRKRFVGAVSGIATSDQRDAATVGVTLSA
FT                   VESGARILRVHDVAGTAQALDAYWSVAKADARQGFVSLGSNVGDRLGNLSRAVRLMSEI
FT                   PLTRVVQVSRAYETEPAYGIATPVANAVAEIRTELHPLVLVDALMGVERQLKRVRDSKQ
FT                   AGCGPRTIDCDLCWVEDEEHAGHKLTLPHPHLGERDYVLVPMEDLMHDPVRFLMHVGVP
FT                   VYAPEDRVGHVIGELGDLDWE"
FT   gene            117230..117865
FT                   /locus_tag="Olsu_0102"
FT   CDS_pept        117230..117865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: apv:Apar_0112 hypothetical protein; SPTR:
FT                   B9CMA8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67234"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXX0"
FT                   /protein_id="ADK67234.1"
FT                   /translation="MGDGAIAMARGDSGDGHQVNAERRDESAGPRSLSLVLRLDVPMQM
FT                   YACLPAVLALAAARMLRSDGVDARVLWPSGVSVAGTPVLLVYAHAGYDQGVFAKVELVP
FT                   QGIEGVGLLARGKGMLRDALREGARGWEVALQRARVVAGPLAPLLGDYFDLLEHAGGEV
FT                   EVIYPNGRPAARGVLAGVDVWGRANVRIASGRVLELSPEQASLHVARG"
FT   gene            complement(117954..118748)
FT                   /locus_tag="Olsu_0103"
FT   CDS_pept        complement(117954..118748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0103"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="COGs: COG1521 Putative transcriptional regulator
FT                   protein; InterPro IPR004619; KEGG: apv:Apar_0113 putative
FT                   transcriptional acitvator, Baf family; PFAM: Bvg accessory
FT                   factor; SPTR: C2D8F6 Pantothenate kinase; TIGRFAM:
FT                   transcriptional activator, Baf family; PFAM: Bordetella
FT                   pertussis Bvg accessory factor family; TIGRFAM:
FT                   pantothenate kinase, type III"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67235"
FT                   /db_xref="GOA:E1QXX1"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXX1"
FT                   /protein_id="ADK67235.1"
FT                   /translation="MLLTIDVGNTQTTLGLFSQGGVCQRQWRMATDRTDTADELHERLF
FT                   GYFLMFGLTLGSVTDVAISSVVPILTQEWQYMMANVLNAEDVLLVDASRDCGIVVDMPD
FT                   PHQVGADRIANAVAALETYGPSTIVVDFGTATNVDVVDARGAFRGGVIMPGLLLSANSL
FT                   FSRAAKLSSVPLVAPDHALGETTETAVQSGIVIGAAAAAEGLVARIREELGEPDATVVG
FT                   TGGFVREISHVTKVFDTIDPDLTLRGIYSIWCHRAAKRAARG"
FT   gene            119075..119512
FT                   /locus_tag="Olsu_0104"
FT   CDS_pept        119075..119512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0104"
FT                   /product="LSU ribosomal protein L31P"
FT                   /note="COGs: COG0254 Ribosomal protein L31; InterPro
FT                   IPR002150; KEGG: apv:Apar_0114 ribosomal protein L31; PFAM:
FT                   ribosomal protein L31; SPTR: C8W8W2 Ribosomal protein L31;
FT                   TIGRFAM: ribosomal protein L31; PFAM: Ribosomal protein
FT                   L31; TIGRFAM: ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67236"
FT                   /db_xref="GOA:E1QXX2"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXX2"
FT                   /protein_id="ADK67236.1"
FT                   /translation="MKQGIHPNYVECTVRCTCGNTFTTRATVSEMTIDLCDKCHPFYTG
FT                   QQKLVDTGGRVQRFSDKFGGAAQARLDAAKAEKAAKAAKAAEQEAARKATKEAKAAEKA
FT                   KRAAEYAKKAEAKAAKVAEKAAEAPAEPEATEAVAETPAAE"
FT   gene            119881..120606
FT                   /locus_tag="Olsu_0105"
FT   CDS_pept        119881..120606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0105"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011991:IPR011663; KEGG: apv:Apar_0129 UbiC
FT                   transcription regulator-associated domain protein; PFAM:
FT                   UbiC transcription regulator-associated domain protein;
FT                   regulatory protein GntR HTH; SMART: regulatory protein GntR
FT                   HTH; SPTR: C2D6W6 GntR family transcriptional regulator;
FT                   PFAM: Bacterial regulatory proteins, gntR family; UTRA
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67237"
FT                   /db_xref="GOA:E1QXX3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXX3"
FT                   /protein_id="ADK67237.1"
FT                   /translation="MTEALFTQLASILREKIYSHEWQSGSRIPSEHDLMREFRLSRGTV
FT                   RRAIGVLIEEGRLVQRRGKGTFVTGPGISHPAGVRPISFAESLRRQGKDFVTHVLVKQV
FT                   TSAPESVANELDIKVGDPVMYMRRVRTVEDTPVICQESWTNLNECEGIEDIDFTKVSLF
FT                   DAVEKTSKRKVKYSEMKYEALVAGSEHGALLGCDENTAVLHLEQVIHLEDDAKIEWSVT
FT                   WLTPGQSIVGTAYQPESYS"
FT   gene            120783..121493
FT                   /locus_tag="Olsu_0106"
FT   CDS_pept        120783..121493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0106"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="COGs: COG0149 Triosephosphate isomerase; InterPro
FT                   IPR000652:IPR013785; KEGG: lca:LSEI_2703 triosephosphate
FT                   isomerase; SPTR: B9CMD4 Triosephosphate isomerase; PFAM:
FT                   Triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67238"
FT                   /db_xref="GOA:E1QXX4"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXX4"
FT                   /protein_id="ADK67238.1"
FT                   /translation="MDKIVLRRPFFVVNPKSYLYGEKLRRLARKTDGLCERYGFQSLFT
FT                   AQLIDLAWVADNCPHLIPCAQAMESLRPGRGMGHVLPEALAAAGVRATFLNHAENPMTV
FT                   GELARTVARAREVGILTCVCADSVEEAKAIAELHPDIMTCEPNSLIGTGRIAGGDYIRA
FT                   STEAVKSVSPGTMVLQAAGISTGQDVYDAIHYGGDATGGTSGIVCAGDPEAKLEEMFEA
FT                   LGRVRADIQGEARP"
FT   gene            121490..122011
FT                   /locus_tag="Olsu_0107"
FT   CDS_pept        121490..122011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0107"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="COGs: COG0432 conserved hypothetical protein;
FT                   InterPro IPR001602; KEGG: sds:SDEG_0310 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0047; SPTR:
FT                   C2D6W8 Putative uncharacterized protein; PFAM:
FT                   Uncharacterised protein family UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67239"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXX5"
FT                   /protein_id="ADK67239.1"
FT                   /translation="MTVYKGLVRVETLAGKPTYVDVTNEVADIVSWSGIREGVVHCISC
FT                   HTTCAVYSQEFDHDMTPAGDTFMQADLSDGLDRVFPEQRDWKTYRYPGLRHFEEVEGWP
FT                   DAEAYLPGGDRTLLWNGDAHLRSVLVGGSQTFEVAGGRLEMNGLASIFFVDFDRTRERT
FT                   RKLRVVVMGE"
FT   gene            122074..122370
FT                   /locus_tag="Olsu_0108"
FT   CDS_pept        122074..122370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0108"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="KEGG: apv:Apar_0151 phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; SPTR: B9CMD6 PTS
FT                   system, IIb component; PFAM: PTS system, Lactose/Cellobiose
FT                   specific IIB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67240"
FT                   /db_xref="GOA:E1QXX6"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXX6"
FT                   /protein_id="ADK67240.1"
FT                   /translation="MAKMKHILLSCGSGIVTSTVARKKVEALLDSHGYKGQYEITQIPL
FT                   ASAPEKSRNYDFIVATSIAPTELHCPYVNGVPYLMGRGAEETDAQILKLMEED"
FT   sig_peptide     122074..122154
FT                   /locus_tag="Olsu_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            122499..123893
FT                   /locus_tag="Olsu_0109"
FT   CDS_pept        122499..123893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0109"
FT                   /product="PTS system Galactitol-specific IIC component"
FT                   /note="COGs: COG3775 Phosphotransferase system
FT                   galactitol-specific IIC component; InterPro
FT                   IPR013014:IPR004703; KEGG: apv:Apar_0152 PTS system
FT                   galactitol-specific IIC component; PFAM: PTS system
FT                   Galactitol-specific IIC component; SPTR: B9CMD7 PTS system,
FT                   IIc component; PFAM: PTS system sugar-specific permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67241"
FT                   /db_xref="GOA:E1QXX7"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXX7"
FT                   /protein_id="ADK67241.1"
FT                   /translation="MNAFLGFFQFISGLGVSVMMPIVLTILGCCLGAGFGKSLRAGLTV
FT                   GVGFIGLNLVINSLLGTTLSPAVQTMVERFGLSLTVVDVGWPAAAAIAMGSTVGIIIIP
FT                   LGLAVNIVMLLTNTTQTVDVDIWDYWHFAFTGALVAIVTDSIVWGIIAAILNMIIIMVL
FT                   GDYTAPLVEESLNMPGVSLPHGFTAAYAPIAMLFNWIFDKIPGLRDIDINTDTLQKKFG
FT                   VFGEPILVGTMIGLVIGCLAYWDPSDIATSITQVLTLAVSLGAVLVLIPKMAALLMEGL
FT                   LPISDAASTFVEKRFKNRGKIYIGLDSAVGVGHPVTLAISFVLVPLCIFLAVILPGNKV
FT                   LPFADLAVIPWMFVLITPVVHNNGFRGIIIGIIVLTVGLYIATDLSPLITTAAANVQFD
FT                   MGTATAISSICDGANPLTWLIVRIGSFMNGIGMIVIAVLAIALAIWNRKRILKEAAELH
FT                   AAKSEE"
FT   gene            123993..124568
FT                   /locus_tag="Olsu_0110"
FT   CDS_pept        123993..124568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0110"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdl:CDR20291_0033 hypothetical protein; SPTR:
FT                   C2D6X2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67242"
FT                   /db_xref="GOA:E1QXX8"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXX8"
FT                   /protein_id="ADK67242.1"
FT                   /translation="MKKSFVYEPPFYKIEVTFTGVFCAVVCIACIAIAVLDAFIPRGLA
FT                   LIFGAVAFYQVWNTFVSLSNPERVEIDEEGDSISFSGLGRVDSYKLSELSTFLVRPFPS
FT                   SGKTYIRVQDHNIFKGRYWVPTKMFSDGGELFAYLVNLGNKVHPNSLLARAHDVNKDYL
FT                   EHADQIEAIRSRERSAQRSRRTTKAKKL"
FT   sig_peptide     123993..124064
FT                   /locus_tag="Olsu_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            124635..125315
FT                   /locus_tag="Olsu_0111"
FT   CDS_pept        124635..125315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0111"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="COGs: COG0235 Ribulose-5-phosphate 4-epimerase and
FT                   related epimerase and aldolase; InterPro IPR001303; KEGG:
FT                   cdf:CD0045 putative sugar-phosphate aldolase; PFAM: class
FT                   II aldolase/adducin family protein; SPTR: B9CMD8
FT                   L-ribulose-5-phosphate 4-epimerase; PFAM: Class II Aldolase
FT                   and Adducin N-terminal domain; TIGRFAM:
FT                   L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67243"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXX9"
FT                   /protein_id="ADK67243.1"
FT                   /translation="MFESEKKEMLECALKLDRYGLIALSGGNVSVRAGDDLFIVTPSGM
FT                   VYDEMVPEDMLVVDGKGNVVEGMRKASVDTAALLYIFHHMPKVNAVIHTHQPYATGLGL
FT                   VMDEIPCNLSTMANAVEGPCHVANYGNPGSLSMGAQAVESIGDQLAVVLKHHGVIAVGR
FT                   DLRQAMFSCVYLEEAAKTVSVALSTGRPMAEMTQVQIDEAVSVFHRYGQHTLDEQDAEE
FT                   AARN"
FT   gene            125351..126238
FT                   /locus_tag="Olsu_0112"
FT   CDS_pept        125351..126238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0112"
FT                   /product="ketose-bisphosphate aldolase class-II"
FT                   /note="COGs: COG0191 Fructose/tagatose bisphosphate
FT                   aldolase; InterPro IPR013785:IPR000771; KEGG: ele:Elen_1230
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II; SPTR: C2D6X3 Fructose-bisphosphate
FT                   aldolase; PFAM: Fructose-bisphosphate aldolase class-II;
FT                   TIGRFAM: ketose-bisphosphate aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67244"
FT                   /db_xref="GOA:E1QXY0"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXY0"
FT                   /protein_id="ADK67244.1"
FT                   /translation="MIINLRDICAVAEQNNMAIASFNVPSFEALRAAIDVAEETDHPVI
FT                   LSHAEGHEPLAPLDSIGPVMVALAERSSAMLCVHLDHCEHLSYMRRALEIGFTGAMYDG
FT                   SFEPYEVNLENSQRAAEMCSGFDCGIECELGSMGSREAGQRDEGGTAEESGAVYTDPDQ
FT                   AADFIASTGTDILACSFGTVHGIYKGEPHLNFKVLTDIRDRVKIPLVMHGGSGVSDEDY
FT                   KKAIDSGIRKINYYTYGVKYAGEAACAEMEAKRSKSADAIVYWHDLTSAAYSRLVEDFD
FT                   HVVKVFANGAKQLA"
FT   gene            126272..126751
FT                   /locus_tag="Olsu_0113"
FT   CDS_pept        126272..126751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0113"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="COGs: COG1762 Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type); InterPro
FT                   IPR016152:IPR002178; KEGG: apv:Apar_0154 putative PTS
FT                   IIA-like nitrogen-regulatory protein PtsN; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2; SPTR: C2D6X4 PTS family fructose/mannitol
FT                   porter component IIA; PFAM: Phosphoenolpyruvate-dependent
FT                   sugar phosphotransferase system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67245"
FT                   /db_xref="GOA:E1QXY1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXY1"
FT                   /protein_id="ADK67245.1"
FT                   /translation="MAILDTSLFSPELVFFDATATTGTELFSWLREKLAPMGYLEDSWL
FT                   QAIITRENNYPTGLESDNISVAIPHVEPENIAKPYIAVVKPKKPVAFEPMAAMVDHPVQ
FT                   AELIINLGLKAHDEDQVAVLQKLMNVFMDASACENILSQTTGKGMVDTIVKHCKE"
FT   gene            complement(126826..127356)
FT                   /locus_tag="Olsu_0114"
FT   CDS_pept        complement(126826..127356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0114"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ele:Elen_1929 trigger factor; SPTR: C2ASN6
FT                   Trigger factor; PFAM: Bacterial trigger factor protein (TF)
FT                   C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67246"
FT                   /db_xref="GOA:E1QXY2"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXY2"
FT                   /protein_id="ADK67246.1"
FT                   /translation="MKDTLFQDIAQKVATTGQPMEAVLAQMGVRSDQLDAMLQAVATKE
FT                   VKHEAALDAYTSKKNIKVDETELPHLLQLSPTDAQALIARAKAVSQMDQLFEAARRTKA
FT                   LEAVVAECNCTYVQATEDEAKKRMEEVVEVMRHREEMMRAAAGSAARGAEGIHYREPRY
FT                   CWNDENAAWLDTG"
FT   gene            complement(127549..127713)
FT                   /locus_tag="Olsu_0115"
FT   CDS_pept        complement(127549..127713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0115"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to ADP-ribosyltransferase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67247"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXY3"
FT                   /protein_id="ADK67247.1"
FT                   /translation="MTIQKSEPLVIGNRAFYTLTSYGPVDVQVHVVHTTDEEVELAVRS
FT                   LVREAVGTE"
FT   gene            127919..129337
FT                   /locus_tag="Olsu_0116"
FT   CDS_pept        127919..129337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0116"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG2509 Uncharacterized FAD-dependent
FT                   dehydrogenase; InterPro IPR006076; KEGG: shi:Shel_07360
FT                   FAD-dependent dehydrogenase; PFAM: FAD dependent
FT                   oxidoreductase; SPTR: C7N4F8 FAD-dependent dehydrogenase;
FT                   PFAM: FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67248"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXY4"
FT                   /protein_id="ADK67248.1"
FT                   /translation="MADTTTTIHTDVAIVGAGPAGIFTALGLIGKGDTRSITIVEKGLP
FT                   VERRSCPKAKVGHCVHCQPCRITTGFSGAGAFSDGKLSLSREVGGDLPDLIGHQFAQDT
FT                   IDRVDQMYLDFGADPHVEGLGHADDVVEIRRRAISAGLKLVDCPIRHLGTEKAQQLYAR
FT                   IEKHLLDAGVNALFETECEEVVIEGGVCHGLVVRSRDGERRIVAGETIVATGRRGASWF
FT                   GTMCDEHGIGHVAGPVDVGVRVEVRNEVMERVNDVLYESKLIGYPNPYKNKVRTFCQNP
FT                   GGFVSQENYDGGLAVVNGHSFKDRKSPNTNVAVLCTLNFKSPFDKPILYAQRVSELVNM
FT                   LGAGHILVQRFGDILDGKRTWPKELSQSNVVPTLPDAEAGDITAAMPMRPMVEIIEFIK
FT                   AVDRVVPGFASYETLLYAPEVKFYSNRVQMDENFDTNVQHLHCLGDSSGWTRGLMMASV
FT                   MGLLMGEKLADRGK"
FT   gene            129522..129881
FT                   /locus_tag="Olsu_0117"
FT   CDS_pept        129522..129881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0117"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG1725 transcriptional regulator protein;
FT                   InterPro IPR000524:IPR011991; KEGG: nth:Nther_0732
FT                   transcriptional regulator, GntR family; PFAM: regulatory
FT                   protein GntR HTH; SMART: regulatory protein GntR HTH; SPTR:
FT                   C7GGD5 Transcriptional regulator, GntR family; PFAM:
FT                   Bacterial regulatory proteins, gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67249"
FT                   /db_xref="GOA:E1QXY5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXY5"
FT                   /protein_id="ADK67249.1"
FT                   /translation="MIQISYQDPRPIYEQVRDAYRQQILAGVLEPGVQLPSVRELSSRL
FT                   AVNPNTIQRAYRELEQEGCISSVRGKGSFVADVSGAAEARRRELFERFDQLVHELESLG
FT                   VTPAELGQRVGGGEG"
FT   gene            129978..130769
FT                   /locus_tag="Olsu_0118"
FT   CDS_pept        129978..130769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0118"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439; KEGG: gka:GK1621 ABC
FT                   transporter ATP-binding protein; PFAM: ABC transporter
FT                   related; SPTR: A6NQ67 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67250"
FT                   /db_xref="GOA:E1QXY6"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXY6"
FT                   /protein_id="ADK67250.1"
FT                   /translation="MGLWGQTVAASPRSSRTFVVSCAPPPATYVLGEKVFENLGIKARI
FT                   SCVPSEPYFIGSESADGMAGFYRAMFPAFDLARYFELEKRFEVDHTKPLRKLSRGMRAQ
FT                   AAIWLALSIHADVLLLDEPMDGIDPLARRRMWRLVLEEVAERGLTVLVTSHNLSELEGV
FT                   CDHLGIMAKGTMREEIDLSQPLESVAKVQVILPEGASLPAGFNVIKKSNEGRVLTLLVR
FT                   GSVGEVREALTALHPSYLEVLPLSLEKRFICELGGDDDGIM"
FT   sig_peptide     129978..130046
FT                   /locus_tag="Olsu_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            130835..132553
FT                   /locus_tag="Olsu_0119"
FT   CDS_pept        130835..132553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0119"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_1469 hypothetical protein; SPTR:
FT                   A6NQ68 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67251"
FT                   /db_xref="GOA:E1QXY7"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXY7"
FT                   /protein_id="ADK67251.1"
FT                   /translation="MHTWGVGYLIVWLFWLVGLALRIAGHTPPADPAQELAQSGVGVLV
FT                   LSVAVSFAAENGAFSWIFDRRAVQLYGMLPVRREAVFLAVALAGVIPLLVAVGISGFVF
FT                   AAILGFGQDAAAILPWMARHALLIVAFGGISALCLQLAGWPAFALLCYLLANLYAFAAQ
FT                   QIAESLYAMVAPMVVNASIGGIDWASPLVHLLRVAISWSSTCPFPDPGLDAALTQAVTV
FT                   YALVGLACVALAMLLFARRNLERAGDPFVSPVVRNVVNVLASAIVGFAIAGLVLARTSP
FT                   VRYGASPQLACSLPVVFSVLVYAATEAIMGHGLAVLRKRFPALVVMAGVALVASIACVA
FT                   PAAGAAAFIPKPADVKSAAISDISVPFEDEEGIGRVCQLHSELADIAAAGGEPMGSSVY
FT                   TVTLTYQMKDGRMVHAVESPLQDPITEEVLRGQVDKVLRSAGSSYVVVSYQECAPGFQG
FT                   DAPWRSEVVSSGDCVALREALDEDIAENGVICAMPAYQLTGSLYYSGYTYQGQASSGSL
FT                   LGVAVDTPYRASIGLYPTATLDENSSDTTIYLSEGATSHTVAWLRSRYGLEFAEW"
FT   sig_peptide     130835..130930
FT                   /locus_tag="Olsu_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            132699..133766
FT                   /locus_tag="Olsu_0120"
FT   CDS_pept        132699..133766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0120"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /note="COGs: COG0216 Protein chain release factor A;
FT                   InterPro IPR004373:IPR005139:IPR000352; KEGG: apv:Apar_1310
FT                   peptide chain release factor 1; PFAM: Class I peptide chain
FT                   release factor; PCRF domain protein; SPTR: C8W8E3 Peptide
FT                   chain release factor 1; TIGRFAM: peptide chain release
FT                   factor 1; PFAM: PCRF domain; RF-1 domain; TIGRFAM: peptide
FT                   chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67252"
FT                   /db_xref="GOA:E1QXY8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXY8"
FT                   /protein_id="ADK67252.1"
FT                   /translation="MRDKLEKLIAAYEELEKRMVDPTVVSDPKEYARIAKEHASQAELV
FT                   AKAREYVGALDDIEVAKEMQRETSDASEKEMLQEDIGANEAKLPALEDEIKVMLIPGDP
FT                   NDEKNTIVEIRAGVGGDEAAIFAGDLYNMYARFASTHKWKTEVLSSSPSEAGGFKTIEF
FT                   KVTGDKVFSVMKFESGVHRVQRIPKTESQGRIQTSTATVAVLPEADEIDIEIKDEDLRI
FT                   DTYCASGPGGQCVNTTYSAVRITHLPTNTVVQSQDQRSQIQNRAVCMEMLRARLYEVEL
FT                   EKQQAEQGAARLGQIGHGSRAEKIRTYNQPQDRVTDHRIGFNSTYNGVLLGDRLPEVID
FT                   ALAAAERAEKLARAV"
FT   gene            133769..135343
FT                   /locus_tag="Olsu_0121"
FT   CDS_pept        133769..135343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0121"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /note="COGs: COG2890 Methylase of polypeptide chain release
FT                   factors;
FT                   InterProIPR017945:IPR004556:IPR019874:IPR004388:IPR
FT                   006070:IPR002052:IPR007848; KEGG: apv:Apar_1309
FT                   modification methylase, HemK family; PFAM: SUA5/yciO/yrdC
FT                   domain; methyltransferase small; SPTR: C2D8G1 Putative
FT                   uncharacterized protein; TIGRFAM: protein-(glutamine-N5)
FT                   methyltransferase, release factor-specific; modification
FT                   methylase, HemK family; Sua5/YciO/YrdC/YwlC family protein;
FT                   PFAM: Methyltransferase small domain; yrdC domain; TIGRFAM:
FT                   HemK family putative methylases; Sua5/YciO/YrdC/YwlC family
FT                   protein; protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67253"
FT                   /db_xref="GOA:E1QXY9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXY9"
FT                   /protein_id="ADK67253.1"
FT                   /translation="MAMEPEAWTIRRMLDWTIGYLERRSDGRPRLSAEWMLSNVTGLSR
FT                   VQLYTSFDRPLSADELARMHDAVVRRGAGEPLQYVTGEMPFRHIVLHCEGGVLIPRPET
FT                   EVLVDAVLAHVDVAAAAGHDAQVLEVGTGTGCIACSIASERPGSHVVATDLSPAAAALA
FT                   MRNRDALGLARAVDVITCDLASGVDPALKGTFDVLVSNPPYIPSDVVPTLPREVVGFEP
FT                   HLALDGGADGLDVFRRLLEVAPDMLRPGGMLACELFETNAEVAAELCRRQGGWARVEVR
FT                   EDLTHRPRVLVAVREGDLAAGGVMVRPRKLLAVDQDRPERMVVRDVARVLLDGGVIVVP
FT                   TDSVYGIGCAATPGNPGHARTFQIKRRALSQTLPWLIADVQDLERFGHRVPKWAYALAR
FT                   EFWPGALTLVVRASPLVPAEYRRSDDGTIALRLPDSNLVREIAREVGAPLAITSANTHG
FT                   ASSATSGEGIEGRIAGEVDLVLDGGPSPLAAASTIVDCTGADPRVLREGAIPSVGIMRV
FT                   ADPDAWA"
FT   gene            135803..136282
FT                   /locus_tag="Olsu_0122"
FT   CDS_pept        135803..136282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0122"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="COGs: COG0698 Ribose 5-phosphate isomerase RpiB;
FT                   InterPro IPR003500:IPR004785; KEGG: apv:Apar_1307
FT                   sugar-phosphate isomerase, RpiB/LacA/LacB family; PFAM:
FT                   Ribose/galactose isomerase; SPTR: C2D8G2 Ribose-5-phosphate
FT                   isomerase; TIGRFAM: sugar-phosphate isomerase,
FT                   RpiB/LacA/LacB family; ribose 5-phosphate isomerase B;
FT                   PFAM: Ribose/Galactose Isomerase; TIGRFAM: ribose
FT                   5-phosphate isomerase B; sugar-phosphate isomerases,
FT                   RpiB/LacA/LacB family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67254"
FT                   /db_xref="GOA:E1QXZ0"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXZ0"
FT                   /protein_id="ADK67254.1"
FT                   /translation="MKIAMASDHAGFDQKPALVAYLAGLGHEVVDMGPASAERCDYPDY
FT                   ADKVARYVAAGGAERGILICGTGIGMAITADKVSGIRAAVIQTPQFAHLFREHNDGNVL
FT                   CISGRFTSLATNKEIVDEFLATEFGGGRHEGRVAKAMREDDPGFQGVGEDPIPVR"
FT   gene            136477..137118
FT                   /locus_tag="Olsu_0123"
FT   CDS_pept        136477..137118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0123"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="COGs: COG0035 Uracil phosphoribosyltransferase;
FT                   InterPro IPR005765:IPR000836; KEGG: apv:Apar_1306 uracil
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase;
FT                   PRIAM: Uracil phosphoribosyltransferase; SPTR: C2D8G3
FT                   Uracil phosphoribosyltransferase; TIGRFAM: uracil
FT                   phosphoribosyltransferase; PFAM: Phosphoribosyl transferase
FT                   domain; TIGRFAM: uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67255"
FT                   /db_xref="GOA:E1QXZ1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXZ1"
FT                   /protein_id="ADK67255.1"
FT                   /translation="MEFDEKRLTVIDHPLVQHKLHILRDKSTGTKQFRELVTELAIFEG
FT                   YEAMRDFPLEDVEVETPLERTVCKKISGKKVAIIPILRAGLGMVEGILELVPSARVGHV
FT                   GMYRDPTTHEPHQYYCKFPDDIENRICLIVDPMLATGGSLTAAIQFLREAGVKDVRALT
FT                   LVSAPEGVKTVLDFDSEVRLYTCALDRQLNESAYILPGLGDAGDRIYGTK"
FT   gene            137417..140053
FT                   /locus_tag="Olsu_0124"
FT   CDS_pept        137417..140053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0124"
FT                   /product="Formate C-acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="COGs: COG1882 Pyruvate-formate lyase; InterPro
FT                   IPR001150:IPR004184; KEGG: cbk:CLL_A1723
FT                   4-hydroxyphenylacetate decarboxylase, catalytic subunit;
FT                   PFAM: pyruvate formate-lyase PFL; formate
FT                   C-acetyltransferase glycine radical; PRIAM: Formate
FT                   C-acetyltransferase; SPTR: B1BA70 HpdB protein; PFAM:
FT                   Glycine radical; Pyruvate formate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67256"
FT                   /db_xref="GOA:E1QXZ2"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXZ2"
FT                   /protein_id="ADK67256.1"
FT                   /translation="MEESLVLEMLQTGKTATWPAKNQLQESGEVVDKEVKGTPSTDRTR
FT                   RMKERFMNAKCKMDMEAPIAYTKAWREHEGKPLYVRRGLAYKYMLEHLTPAIREDELIT
FT                   MSKTRYDRGATQVPQFATDFMISFLTQAEDQKEEAKLYSVEGKDEAHTVEEEGWTKVGQ
FT                   LFSIREEEVKPMLEVLEYWKTRCVENVSDDWMKTSFPYYQDYVNAKKVGLFPGSGLHAG
FT                   CDGRWIPAYDVALGGLNRVIEECREKIEKTVVTTKEVADKVFFWQGCIYACEGAIAWAH
FT                   NYAVEARRLAETAVEPRKTELLEMAERLDRVPAEAPRNFMEAVQALWTTQILVISDSLA
FT                   LGVSPGRWGKFLEPYYEKDLAEGRITKGQALEVMELLRIKFSTEEYITPSLWAAMASSN
FT                   SFMNLAVGGLDPKTGKCTDNEIEDLILEAGINMPTPQPTLSILLSDKTTDHLAIKAAEC
FT                   TKAGNGYPAWFNYDMMVQHNLAMYRDEGITLEDARNCALSGCVENGLAGTGHPIAHPAF
FT                   YNEGKTIELACNEGVDPRTGIKVMDGIVPIKTYEDLWDNFIKIREHFMHVYMQYWNEVV
FT                   ACQRDIHPKIMGSVLMHDCIESGRPVDNLGCRYNGSVTLLDSGTVNVVNGLAAIKKLVF
FT                   EDHKYTWDEFKEAMDNNFGFVLGAEKGNFSMLNQEIDPEKHMKYAHIHRDVLNAPKFGN
FT                   DDDFVDDIFVDLWHDYDRVTASETTYNGYRWITAALSISAHGPHGRVTGATPDGRLSGV
FT                   TLCDGILSASPGTDVNGPIALIRSGVKLDPTEFASVQLNMKFHPTAIRGDEGSRNFVDF
FT                   IHSYFQMGGYHVQFNIVDSKMLRDAQDHPQNYRDLMVRVAGFSAYWNELGKPIQDEVIA
FT                   RTEYDAL"
FT   gene            140234..141571
FT                   /locus_tag="Olsu_0125"
FT   CDS_pept        140234..141571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0125"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2223 Nitrate/nitrite transporter; InterPro
FT                   IPR016196:IPR011701; KEGG: dde:Dde_3053 sugar phosphate
FT                   permease-like; PFAM: major facilitator superfamily MFS_1;
FT                   SPTR: Q30WU9 Sugar phosphate permease-like; PFAM: Major
FT                   Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67257"
FT                   /db_xref="GOA:E1QXZ3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXZ3"
FT                   /protein_id="ADK67257.1"
FT                   /translation="MNTNSEHDAGTARFSGWSVTTAAVVIVLCHMMVRGSFATLIHGMV
FT                   ASTGWSTGVVSLGSSIFMVFYGLFAFLTGTYINKLGCKKTYLLHGCIMALGLFLCSFAQ
FT                   EPWQYWLFYGVIAGIGSGAFWAPVTSMVRQWFIDKLGIAMGLTTGAAGVAMCLGPIVSM
FT                   NLIAGQSWQTMMRVFAIILIVGIGVASQFTVMRPEEVGQKPLGYDAFMERQARKAAGGD
FT                   DKKADEFYVPFKWAVRHKAFWLLSLLWFCSNFAEFIVFSHAINYTTTDLGYDKVQATYI
FT                   YCLIGLVFIFSAIGIGGFTDKLTKRLGDPLKARKRVLTVSYIGCAAMALWLNYGVRLTA
FT                   GGGETIWAFIVYALVFGFFYGMYIPSVAGVVGVVFGRKEMPQCWGLISLVGMAGGAGLG
FT                   PYIAGALRDATGSYFVAIWLAVVFYLLACLFMNVVRQPSREEVWGR"
FT   sig_peptide     140234..140347
FT                   /locus_tag="Olsu_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            141718..142665
FT                   /locus_tag="Olsu_0126"
FT   CDS_pept        141718..142665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0126"
FT                   /product="glycyl-radical enzyme activating protein family"
FT                   /EC_number="1.97.1.4"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterProIPR012839:IPR017896:IPR011352:IPR017900:IPR
FT                   001989:IPR007197:IPR001450; KEGG: cno:NT01CX_0497 pyruvate
FT                   formate-lyase; PFAM: Radical SAM domain protein; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; PRIAM:
FT                   [Formate-C-acetyltransferase]-activating enzyme; SPTR:
FT                   B1BA71 Pyruvate formate-lyase-activating enzyme; TIGRFAM:
FT                   glycyl-radical enzyme activating protein family; PFAM:
FT                   Radical SAM superfamily; TIGRFAM: glycyl-radical enzyme
FT                   activating protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67258"
FT                   /db_xref="GOA:E1QXZ4"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXZ4"
FT                   /protein_id="ADK67258.1"
FT                   /translation="MDGKGKELRAVIFDVQSFSTHDGPGIRTNIFFKGCALRCPWCANP
FT                   ESQKFSPQLLYTKMKCIGCMCCARACPHGAVTAYTAPEDIERYGHVRYDRGKCDKCTTH
FT                   ECVDACFQEALAVSGKEMTVDDVMDKIRRDSPVFRGKGGVTVSGGDPLLYPEFLAELLG
FT                   RCRDEGYSVALESELCVPTRNLETVMPFVSYYLTDCKIIDSAEHRRITGVDNEIILRNL
FT                   RLIGDVCPERMCLRIPIIPGYTDSDENVGGIAAFAASCQFTKINILPYHKLGVPKHERL
FT                   GTVYQLPHVQPPDDGHMRHLADVIEAHGIECVIN"
FT   gene            142838..143575
FT                   /locus_tag="Olsu_0127"
FT   CDS_pept        142838..143575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0127"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterPro IPR016032:IPR000792:IPR011991; KEGG:
FT                   chl:Chy400_3486 two component transcriptional regulator,
FT                   LuxR family; PFAM: regulatory protein LuxR; SMART:
FT                   regulatory protein LuxR; SPTR: B9ASK7 Putative
FT                   uncharacterized protein; PFAM: Bacterial regulatory
FT                   proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67259"
FT                   /db_xref="GOA:E1QXZ5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXZ5"
FT                   /protein_id="ADK67259.1"
FT                   /translation="MSHLEENSSSAMAKLQRLQDELSQFFSISIRILSRDDLKSLTVES
FT                   NGHTRCLTNRGAHPDICERFILRVIDLDPGDVMVSMCPFGLLSAIVPLGKSMWAGLHEE
FT                   KARYFFLAVHNPAYEGAGGVEVEQKRTVTSIVSGMDLHDKIEFEEKVRLVASVFDLVFS
FT                   ILTEQEQQDLIATGAVGMAELRRLTKREREVMRLVCVGMSNQRVAEELFISEHTVKLHV
FT                   SSILKKLNLANRTQLAIYGAKVL"
FT   gene            143576..145549
FT                   /locus_tag="Olsu_0128"
FT   CDS_pept        143576..145549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0128"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR003594:IPR009082:IPR005467:IPR003661:IPR
FT                   004358:IPR003660; KEGG: cbt:CLH_1874 two component system
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; histidine
FT                   kinase HAMP region domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; SPTR: C5UV34 Sensor protein; PFAM: Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67260"
FT                   /db_xref="GOA:E1QXZ6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXZ6"
FT                   /protein_id="ADK67260.1"
FT                   /translation="MKQRKISTYFNTGITCILATIFILVIVIGVWLARDSTISSVVARL
FT                   DVCLQTAYDRLDLEDAIGRARLLEVIEYEGVASLIENSDVSQLSRVLERCKFDMGESYA
FT                   VAVDSNGTVIASNVHVAGSSWPLAYLLDSVKQEGETITTTEVIAADRLKDSRQSLRDGA
FT                   RVIIDRTTARSLNDAYVHITVCPIYSGETFVGAVVEGYLLNNNHEFPTDYTNAVPGTYL
FT                   SVGTTDGVRICSNISSNGFSYPAGTTQRRDFVDVINKGGIWRGQVSMVDGGEGVVVAGP
FT                   ITDYSGRVIGNIGVGSPIFMISGLSASHYVLFVLVAAAFFICAALLGRKLTAMITRPIS
FT                   DLQDISRTITKGELPSSDMLRSRSSVPSEIVSLADDMYVMARKLTDKNQRLEEKVSART
FT                   AQLANTVDELRAANRHKSQFLANISHELRTPLNSIIGFASLLQENVAGDLNATQTRYAE
FT                   IIIESGGHLLDLINDILQLVKLDTSVDKLKLSRVSVIEAIRNPVDLIRPLADERGQGLE
FT                   VIVADELDGYTAYWDEQKVHQILLNLLSNAVKFSPDGGRIRVKASLVEENFVFIHVIDN
FT                   GIGISNDMKERVFLAFEQADNSYTRIYKGAGLGLAITKDLVEMHSGRIWLEDAPGGGLD
FT                   ACVVLPLCSNRKPDKKDGQEAD"
FT   sig_peptide     143576..143695
FT                   /locus_tag="Olsu_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            145549..146460
FT                   /locus_tag="Olsu_0129"
FT   CDS_pept        145549..146460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0129"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG3437 Response regulator containing a
FT                   CheY-like receiver domain and an HD-GYP domain; InterPro
FT                   IPR011006:IPR001789; KEGG: hau:Haur_2699 response regulator
FT                   receiver modulated metal dependent phosphohydrolase; PFAM:
FT                   response regulator receiver; SMART: response regulator
FT                   receiver; SPTR: Q1Q2E4 Putative uncharacterized protein;
FT                   PFAM: Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67261"
FT                   /db_xref="GOA:E1QXZ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXZ7"
FT                   /protein_id="ADK67261.1"
FT                   /translation="MKKILVVEDDPASLTLITEILKGYDYTVVSALDGRSALDVSKREN
FT                   PDLIILDVMLPALNGYQVCERLRSMSQFRNTPIIMLTVLNEDSQRIRALEAGANGFLSK
FT                   PFKRVELLTRIKALLSAQVNSDEMVSLNTVISSMLTALELRCAGSTMSSRRCADLAERL
FT                   AVVMGIPSGNVRDLRRGLLLRDIGYVACNDASVAVENNFTAHSEHAIRSLQIVGAFGHE
FT                   IIDAVVRYHHCTLQSEDYPANLNTEVLACVKVAIVCTRLEGLLYGNEGLSVQAACATLT
FT                   NEVSAGLLPSEEVAFVTRLIST"
FT   gene            146519..147541
FT                   /locus_tag="Olsu_0130"
FT   CDS_pept        146519..147541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: C0FMA3 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67262"
FT                   /db_xref="InterPro:IPR025117"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXZ8"
FT                   /protein_id="ADK67262.1"
FT                   /translation="MVACFSDAPADAAWTAGADVDCDLGKAVGMELSERLWRELVAPQI
FT                   EREIPGVTSRVAVGRVGEGSECWGTDDVLSRDHDWGAGLCLWVSDDVVGASERERMGAH
FT                   VARLVAQAQKTCDYPVLPFAGPRLGIFETGEFYRRFIGLNHVPASMDEWLATPVYGLAV
FT                   AVNGRVFSDGPGRFTDFRNALTDECPQDIFLRRMSIDAFGAGQAGQYNLLRALKRGNVP
FT                   TAELMRSSFLVCALRLLFSLNGRHYPFNKWLYQKAGQLPGAHPLCLRIGQLAKVHLDGD
FT                   DALLRCADLVDEICEALLVAFECHGLPRANDGFLVSEAEGLHETIGDATVASLPYMMAR
FT                   "
FT   gene            147640..148272
FT                   /locus_tag="Olsu_0131"
FT   CDS_pept        147640..148272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: C4C605 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67263"
FT                   /db_xref="InterPro:IPR025191"
FT                   /db_xref="UniProtKB/TrEMBL:E1QXZ9"
FT                   /protein_id="ADK67263.1"
FT                   /translation="MRQTLIADIECMEWDMFSSVNNIGGKADCQNDRDQFSVMREASYA
FT                   TWTSEMLESYKGDLERAASQGVNLMSEKYARMMEVTMPGAIDMPPLPDARRALMDEAMG
FT                   IVMPWEEELYERYALLRHRARSLTQASEDGSAISGTAFDTYLYGELSIYSERTLRLYVE
FT                   HLRMQRAAGTNGSMAVYDRMARLQGWASFDAADKDFRKRMTEENHAG"
FT   gene            148566..149363
FT                   /locus_tag="Olsu_0132"
FT   CDS_pept        148566..149363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0132"
FT                   /product="ATP synthase F0 subcomplex A subunit"
FT                   /note="COGs: COG0356 F0F1-type ATP synthase subunit a;
FT                   InterPro IPR000568; KEGG: apv:Apar_1304 ATP synthase F0, A
FT                   subunit; PFAM: H+transporting two-sector ATPase A subunit;
FT                   SPTR: B9CLF2 ATP synthase subunit a; TIGRFAM: ATP synthase
FT                   F0, A subunit; PFAM: ATP synthase A chain; TIGRFAM: ATP
FT                   synthase subunit 6 (eukaryotes),also subunit A
FT                   (prokaryotes)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67264"
FT                   /db_xref="GOA:E1QY00"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY00"
FT                   /protein_id="ADK67264.1"
FT                   /translation="MNPLDKLSGEMDELLEGFMSHAIVGDTTVGLTNYIFWMCVALALL
FT                   LACVLMFKKRQARGLVPQGIFVNGMEYVVEFVRDDMCKSILGDTWKRHFPFLAAIFFFI
FT                   VCNSIVGVIPGCHPGTGTIGVTAALAFCSFTYFIVVGCKRMGILGYIKSLAPKGVSFPM
FT                   NVLVWAIELVSTFLRLITLAVRLFCNMFAGHVVMGTFAILASLFVEPLLQGFSAAALGQ
FT                   AGASVFWVVLLIIIYLVEILVGIIQAYVFTLLSAVYIQLVESE"
FT   gene            149458..149652
FT                   /locus_tag="Olsu_0133"
FT   CDS_pept        149458..149652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0133"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /note="InterPro IPR002379:IPR005953:IPR000454:IPR020537;
FT                   KEGG: ele:Elen_1040 H+transporting two-sector ATPase C
FT                   subunit; PFAM: H+transporting two-sector ATPase C subunit;
FT                   SPTR: B9CLF1 ATP synthase subunit c; TIGRFAM: ATP synthase
FT                   F0, C subunit; PFAM: ATP synthase subunit C; TIGRFAM: ATP
FT                   synthase, F0 subunit c"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67265"
FT                   /db_xref="GOA:E1QY01"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY01"
FT                   /protein_id="ADK67265.1"
FT                   /translation="MGVIGYGLGVIGAAIGIGLAAYGATTSMARQPEVQGRLFTTFILA
FT                   SAFVEALALIGFVVTLIAS"
FT   sig_peptide     149458..149544
FT                   /locus_tag="Olsu_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            149696..150301
FT                   /locus_tag="Olsu_0134"
FT   CDS_pept        149696..150301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0134"
FT                   /product="ATP synthase F0 subcomplex B subunit"
FT                   /note="COGs: COG0711 F0F1-type ATP synthase subunit b;
FT                   InterPro IPR005864:IPR002146; KEGG: apv:Apar_1302 ATP
FT                   synthase F0, B subunit; PFAM: H+transporting two-sector
FT                   ATPase B/B' subunit; SPTR: B9CLF0 ATP synthase subunit b;
FT                   TIGRFAM: ATP synthase F0, B subunit; PFAM: ATP synthase
FT                   B/B' CF(0); TIGRFAM: ATP synthase, F0 subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67266"
FT                   /db_xref="GOA:E1QY02"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY02"
FT                   /protein_id="ADK67266.1"
FT                   /translation="MNRKMKGMGVRGRVAASAAAAVLLAPTTALAEISGADILLPKPAE
FT                   FVPALLAFLVIWIVLAKFAWPSILGMMEERQQKIQDDLEAAEESRAQAAEEAKNYTAQI
FT                   TEAHREAEAIISKARKDATEERTQILAKAQREAADIISKAHGAVGSERKKAMIELSGQV
FT                   VDLSVEIAGKIIGNDLSEAEQRKLAEKYLAEVSAPHGR"
FT   sig_peptide     149696..149788
FT                   /locus_tag="Olsu_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            150291..150764
FT                   /locus_tag="Olsu_0135"
FT   CDS_pept        150291..150764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0135"
FT                   /product="ATP synthase F1 subcomplex delta subunit"
FT                   /note="COGs: COG0712 F0F1-type ATP synthase delta subunit
FT                   (mitochondrial oligomycin sensitivity protein); InterPro
FT                   IPR000711; KEGG: apv:Apar_1301 H+transporting two-sector
FT                   ATPase delta (OSCP) subunit; PFAM: H+transporting
FT                   two-sector ATPase delta (OSCP) subunit; SPTR: C2D8G8
FT                   Putative uncharacterized protein; PFAM: ATP synthase delta
FT                   (OSCP) subunit; TIGRFAM: ATP synthase, F1 delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67267"
FT                   /db_xref="GOA:E1QY03"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY03"
FT                   /protein_id="ADK67267.1"
FT                   /translation="MAGKHSDEAKVEAYARALIDAGRSEGRANADLVQWRHACKFSPEV
FT                   LETLTAMRGGDDISLVDAVSKKYKEILDSEDETVSVTVTTSVPMDDNLREKVRSKVAAD
FT                   MQVPIYLVERVDPSILGGIVIEAYGKRFDASVRAQLANIRKTLASTFVGSEEQ"
FT   gene            150761..152416
FT                   /locus_tag="Olsu_0136"
FT   CDS_pept        150761..152416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0136"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="COGs: COG0056 F0F1-type ATP synthase alpha subunit;
FT                   InterProIPR000793:IPR018118:IPR005294:IPR020003:IPR
FT                   004100:IPR000194; KEGG: apv:Apar_1300 ATP synthase F1,
FT                   alpha subunit; PFAM: H+transporting two-sector ATPase
FT                   alpha/beta subunit central region; H+transporting
FT                   two-sector ATPase alpha/beta subunit domain protein; PRIAM:
FT                   H(+)-transporting two-sector ATPase; SPTR: C2D8G9 ATP
FT                   synthase subunit alpha; TIGRFAM: ATP synthase F1, alpha
FT                   subunit; PFAM: ATP synthase alpha/beta family, beta-barrel
FT                   domain; ATP synthase alpha/beta chain, C terminal domain;
FT                   ATP synthase alpha/beta family, nucleotide-binding domain;
FT                   TIGRFAM: proton translocating ATP synthase, F1 alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67268"
FT                   /db_xref="GOA:E1QY04"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY04"
FT                   /protein_id="ADK67268.1"
FT                   /translation="MTDKISSSKIMSTLRERLAQVNATVDDQEASVVTEVGDGIAHVSG
FT                   LKTAMAGELLEFTSSGSGRSVFGLAQNLDVDEVGAVLFGEVDAVKEGDECRTTGRVMDI
FT                   PVGNAMLGRVVNPLGQPVDGLGAIDTDARRPIEFKAPGIMERQPVCEPVQTGLIAIDAM
FT                   VPIGRGQRELIIGDRKTGKTAIAIDAIVNQRDTDMICIYVAIGQKASTVAAIKETFARQ
FT                   GVLDKTIIVAATAADSAPMQYIAPMAGAAIGEYFMYNDESGNPADRDHPGRHVLVVYDD
FT                   LSKQAVAYRQMSLTLHRPPGREAYPGDIFYLHSRLLERACKMSDANGGGSLTALPIIET
FT                   QEGDVSAYIPTNVISITDGQIYLQSNLFFQGQRPAVDVGISVSRVGGAAQIKAMKQVAG
FT                   TLRLDLASYREKQAFAQFGSDLDATTQYQLNHGAHMMEMLKQGRYAALDVADQVISIYA
FT                   AKEDFIDDIDLDHVTLFRDGLARFMAERYPQVRVALLNGKIDDALGEKIKQGLSSYKSE
FT                   FLVEHPNRAKAVDVEEMAEGTVDRDAEISGKAQE"
FT   gene            152423..153337
FT                   /locus_tag="Olsu_0137"
FT   CDS_pept        152423..153337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0137"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /note="COGs: COG0224 F0F1-type ATP synthase gamma subunit;
FT                   InterPro IPR000131; KEGG: apv:Apar_1299 ATP synthase F1,
FT                   gamma subunit; PFAM: H+transporting two-sector ATPase gamma
FT                   subunit; SPTR: B9CLE7 ATP synthase gamma chain; TIGRFAM:
FT                   ATP synthase F1, gamma subunit; PFAM: ATP synthase;
FT                   TIGRFAM: ATP synthase, F1 gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67269"
FT                   /db_xref="GOA:E1QY05"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY05"
FT                   /protein_id="ADK67269.1"
FT                   /translation="MANLREISRRMGSIKSTMQITRTMEMISTARIQKALARAEAASPY
FT                   KDAITNMLANVAGCGFDSSQPLLARHGQERHVTFILVASDRGLAGGFNILQQRAVEHEM
FT                   RALAKSGIKSSVITCGRKPTEYFTYRKITPVLSFVGISSEPNMDEADRIASYVMDAYTS
FT                   GKTDRVMLLYWHAKNRVDQTQVTDQLLPITRERLMMPNRPRHLEAMSQVERTRAPEYSF
FT                   EPSAAEVMGYLMPAYFRTVIFHALLDSAAAEHGARRRAMQSATDNAKEVLDSLNRTYNR
FT                   ERQGAITTELNEIIGGASALEDN"
FT   sig_peptide     152423..152545
FT                   /locus_tag="Olsu_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            153337..154818
FT                   /locus_tag="Olsu_0138"
FT   CDS_pept        153337..154818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0138"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="COGs: COG0055 F0F1-type ATP synthase beta subunit;
FT                   InterProIPR000793:IPR018118:IPR005722:IPR003593:IPR
FT                   020003:IPR018073:IPR004100:IPR000194; KEGG: apv:Apar_1298
FT                   ATP synthase F1, beta subunit; PFAM: H+transporting
FT                   two-sector ATPase alpha/beta subunit central region;
FT                   H+transporting two-sector ATPase alpha/beta subunit domain
FT                   protein; PRIAM: H(+)-transporting two-sector ATPase; SMART:
FT                   AAA ATPase; SPTR: C8W8D2 ATP synthase F1, beta subunit;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM: ATP synthase
FT                   alpha/beta family, beta-barrel domain; ATP synthase
FT                   alpha/beta chain, C terminal domain; ATP synthase
FT                   alpha/beta family, nucleotide-binding domain; TIGRFAM: ATP
FT                   synthase, F1 beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67270"
FT                   /db_xref="GOA:E1QY06"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY06"
FT                   /protein_id="ADK67270.1"
FT                   /translation="MSETAEQMRTPLEEAAYNHMNRSVGTGTIVRVVGPVVDVKFDGQV
FT                   PSIYTALTVDDDTPVGRVRTVLEVESQLAGGVVRTVAMSSTDGLQRGLKVKDTGHPMMM
FT                   PVGPSTLGRVWNVMGQPVDGGETPTDVQFYPIHHPAPAFEELTTQTEIFETGIKAIDLL
FT                   EPYVRGGKTGLFGGAGVGKTVLIQELINNLAQEHGGTSVFTGVGERTREGTDLFLEMTE
FT                   SGVINKTCLVYGQMNEPPGARLRVGLAGLTTAEYFRDQGQDVLLFIDNIFRFSQAGSEV
FT                   SALLGRMPSAVGYQPTLATEMGDLQERITSTKEGSITSVQAVYVPADDLTDPAPATTFT
FT                   HLDATTVLSRSITELGIYPAVDPLASSSSALDPSVVGEEHYRVAMAVQETLQQYSDLQD
FT                   IIAILGMDELSEDQQLVVARARKIQQFLSQSFHVAEKFTGNPGVYCSVEDTVRSFAAIV
FT                   DGKCDDIPEQAFRYAGTIEDVRERAAKMSSEASAE"
FT   gene            154829..155254
FT                   /locus_tag="Olsu_0139"
FT   CDS_pept        154829..155254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0139"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /note="COGs: COG0355 F0F1-type ATP synthase epsilon subunit
FT                   (mitochondrial delta subunit); InterPro
FT                   IPR020546:IPR001469; KEGG: apv:Apar_1297 ATP synthase F1,
FT                   epsilon subunit; PFAM: ATPase, F1 complex, delta/epsilon
FT                   subunit-like; SPTR: B9CLE5 ATP synthase F1, epsilon
FT                   subunit; TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   ATP synthase, Delta/Epsilon chain, beta-sandwich domain;
FT                   TIGRFAM: ATP synthase, F1 epsilon subunit (delta in
FT                   mitochondria)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67271"
FT                   /db_xref="GOA:E1QY07"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY07"
FT                   /protein_id="ADK67271.1"
FT                   /translation="MAELTCQFVRPDRLLFEGPVASLVLVTISGELGVWPGHAAEICAL
FT                   GDGVVRLRQREKDGGGTIKVVISGGYAEINDKGVIILADHARRTDDIEADVVRDTREAA
FT                   FDARDQLPENDHRRAYYDSKIKWCNLLLKQVSSDSEA"
FT   gene            155280..156560
FT                   /locus_tag="Olsu_0140"
FT   CDS_pept        155280..156560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0140"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="COGs: COG0766 UDP-N-acetylglucosamine enolpyruvyl
FT                   transferase; InterPro IPR013792:IPR005750:IPR001986; KEGG:
FT                   apv:Apar_1296
FT                   UDP-N-acetylglucosamine1-carboxyvinyltransferase; PFAM:
FT                   EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase); SPTR: C2D8H3
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase; PFAM:
FT                   EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase); TIGRFAM:
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67272"
FT                   /db_xref="GOA:E1QY08"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY08"
FT                   /protein_id="ADK67272.1"
FT                   /translation="MEVIKVEGGHPIGGEVTVEGAKNSALKLMAATILAPGTTTLANVP
FT                   NISDVHVMGKVLKYLGAHIEVENEHTLKVDTSSVDKWETPYHLVAQMRASTAVLGPLLG
FT                   RFGKAIVAMPGGCNIGARKIDMHILGLEALGVRFEVDHGNIHATTPNGLTGGMVTLDFA
FT                   SVGATENLMMAAVRARGVTTIDNAAREPEIVDLANLLNEMGAKVRGAGSPVIEIEGVDE
FT                   LRPLETHAVVGDRIEAGTFIAMAGICGQPVTVKGFEPAHLGLVLKKYELMGLDVERGAH
FT                   KVTVARSRPIRSTDIQTLPFPGFPTDMQAQTMCLLALGDDSCIVTENVFENRFMFASEL
FT                   QRMGAEIRIEGHHAIVHGVRGFSGAEVKSPDLRGGASLVMAGLVADGVTTVSDIHHIDR
FT                   GYEGFVPKLKALGAHVERLEVPDAEEM"
FT   gene            156802..157224
FT                   /locus_tag="Olsu_0141"
FT   CDS_pept        156802..157224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0141"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="COGs: COG1321 Mn-dependent transcriptional regulator
FT                   protein; InterPro IPR001367:IPR011991; KEGG: apv:Apar_1294
FT                   iron (metal) dependent repressor, DtxR family; PFAM: iron
FT                   dependent repressor; SMART: iron dependent repressor; SPTR:
FT                   C2D8H4 Manganese (Mn2+) transporter transcriptional
FT                   regulator; PFAM: Iron dependent repressor, metal binding
FT                   and dimerisation domain; Iron dependent repressor,
FT                   N-terminal DNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67273"
FT                   /db_xref="GOA:E1QY09"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY09"
FT                   /protein_id="ADK67273.1"
FT                   /translation="MPRLAENMRHQLTMANEDYLESIYRITQSTGATDGIRSVDVAEQL
FT                   DVSKASVNKALSTLKEAGFVEQNRYGRVQLTPKGRDYASLVWRCHRALRLFLERDLGVS
FT                   HEVADEEACQMEHALSLDTQNRLIAYLDRQGITVEE"
FT   gene            157279..158187
FT                   /locus_tag="Olsu_0142"
FT   CDS_pept        157279..158187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0142"
FT                   /product="Nucleotidyl transferase"
FT                   /note="COGs: COG1210 UDP-glucose pyrophosphorylase;
FT                   InterPro IPR005835; KEGG: apv:Apar_1293 nucleotidyl
FT                   transferase; PFAM: Nucleotidyl transferase; SPTR: B9CLE0
FT                   Utp--glucose-1-phosphate uridylyltransferase; PFAM:
FT                   Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67274"
FT                   /db_xref="GOA:E1QY10"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY10"
FT                   /protein_id="ADK67274.1"
FT                   /translation="MKAIIPAAGLGTRFLPGTKCTPKELLPVLDKPVIQYVVEEALEPD
FT                   GVDGVVIVNSRLKPQIESYFSVDDALEEHLRAHGKDCLADKVRAAGELPVSFCYQDEAR
FT                   GLGHAVLCAADDAGDEPFFVLLGDYFVPDRKMCVRMAEVSAAHGGSSVIAVAPVPEDQV
FT                   SRYGIVAGERCGEVGGLSPADDEAEGAVWKVTGLVEKPAPEDAPSHLFIVGRYLLTPRV
FT                   MELLKTQGAGAGGEIQLTDAMERLLAEEEMYAVVVDPAEGCDTGTPAAWAATNARMALG
FT                   DAAQREAFLEALGERAAKQLA"
FT   gene            158190..159617
FT                   /locus_tag="Olsu_0143"
FT   CDS_pept        158190..159617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0143"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="COGs: COG1109 Phosphomannomutase;
FT                   InterProIPR016055:IPR005844:IPR005845:IPR005846:IPR 005843;
FT                   KEGG: apv:Apar_1292 phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase; SPTR:
FT                   B9CLD9 Phosphomannomutase; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67275"
FT                   /db_xref="GOA:E1QY11"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY11"
FT                   /protein_id="ADK67275.1"
FT                   /translation="MRIIHFGANGWYARFDEGFDETGVTRVAAAVGLLWGDTFPDGVVY
FT                   VSYDVRPRSERLASLAAAVLASYGLRTRVSSSAAPLPALEWAVAADEEAIGGVVISGSD
FT                   LSCDYGGFLLRGPDGGPVSADFALQVDRHISGRADERMGTAKSVDLVSPYVSALMQEVD
FT                   RSAIGARPLRVIVDPLCGSSRGLLADLLRSCGCAVAEIHDGRPDALGDLLSQPVGPWVG
FT                   DCGRAVAEQGADMGIAVDGDGCRIALIDELGHLVASHDLVALILEHLSVARGLRGRVVA
FT                   TTATSVRVARQAERLGCPLTIVPVGFQRVYEEMRERDVLLACEEYGGMCVPQHLMERDG
FT                   ILAALLAVEMLSTGAAGLTGATPAPKLSEMVRRLGQSLGHMDYARRDVRVDVATMQSFR
FT                   NVLPGLNPETVAGRRPCCVSHADGLRLGFDDGAWVMLRPSRTQTLVRIYAEAATTAERD
FT                   QLLSSACAIVRARGLEI"
FT   gene            159965..161467
FT                   /locus_tag="Olsu_R0006"
FT   rRNA            159965..161467
FT                   /locus_tag="Olsu_R0006"
FT                   /product="16S ribosomal RNA"
FT   gene            161714..164646
FT                   /locus_tag="Olsu_R0007"
FT   rRNA            161714..164646
FT                   /locus_tag="Olsu_R0007"
FT                   /product="23S ribosomal RNA"
FT   gene            164761..164875
FT                   /locus_tag="Olsu_R0008"
FT   rRNA            164761..164875
FT                   /locus_tag="Olsu_R0008"
FT                   /product="5S ribosomal RNA"
FT   gene            165224..168214
FT                   /locus_tag="Olsu_0144"
FT   CDS_pept        165224..168214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0144"
FT                   /product="response regulator receiver and SARP domain
FT                   protein"
FT                   /note="KEGG: apv:Apar_1291 transcriptional regulator, SARP
FT                   family; SPTR: B9CNF2 Putative uncharacterized protein;
FT                   PFAM: Bacterial transcriptional activator domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67276"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY12"
FT                   /protein_id="ADK67276.1"
FT                   /translation="MSGYEVPIDGRCEYIDSIDSDMSLPTNTFLVKSLGRKRDESSHLV
FT                   VLCAEPGVGKTHAMNALLQSERQRGAFTRVLDFSSAGEDETPARLSRSAREVHALRERY
FT                   ARVAVGIDGLTAGDESAVARETRAIRKMLDDGCTVILCIRSESAALVEQLRDRAVVAGC
FT                   FELTARGWYGNDPISRLTHGIPALYVAATSDARQGIQAFEDDSAYVRALREQIVLALRE
FT                   TLADEEVELRLALMLLGKGTQGDLAELLDRLDADELFLMESTVPLLGVTSHGGRFGVAG
FT                   LCEIEGLRATLSSIEPVAQNYTKLVVRSARVLAQRGEYRRSALVCGLCHDVPELYEMGC
FT                   ESGFQYVVAGAPSLVARSIGYLKERGHGRETYVLLAQQALDEVFARRSVLEKGREACVS
FT                   ARGLSNAEYDAQRMDMILSSCRDGLDAIGGDDRTVDASGRDIATALRLHAVAQAALFSG
FT                   RFSKAFNLLVDLPARRNPGTFAAALLSMDFSVAETLMGEVPVSQERVDRERAQSIMREL
FT                   GDSRIDVYRNALSATTAILMGRESDFPCAEVAIAKSEEYGDGLLTAVFLLAAAIADLRN
FT                   SAMARAHVRANRALGYATCRSADYLAHAARLVMSVIDIRLGGEITPEQEMACEGQLGDV
FT                   LRILASASRGETHVPVRLDHLSRFNCSRDVLWAVNLVLNDTGDLASEVHGLIPEGWRGL
FT                   VSTALAQFEDGAQAVEAHPQALSRSRGADGVKPSPAVRVSILGNFEVWVGKRRIPAERL
FT                   VRRHVREVIGMLALAVGHRVSRRDLIASIWGEIDYVSGLKRLYESICACRKALGSRELG
FT                   TNPIISNKIEGIVSLDPAIVSCDVDDLERSARDALAVEGNDRDMVRLGCRACTMYGGGV
FT                   DFHPMDATGLADARTDALRSLYVDVASATAAAALREGRPRLAARLAREAYDVQPAREDV
FT                   TVCLIEGLAAIGRLGEVVALYEDYRRRLPQLGLRRPAAGVAKAVEDALTRMEGRGEDMD
FT                   GPAAIEA"
FT   gene            168376..171126
FT                   /locus_tag="Olsu_0145"
FT   CDS_pept        168376..171126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0145"
FT                   /product="protein translocase subunit secA"
FT                   /note="COGs: COG0653 Preprotein translocase subunit SecA
FT                   (ATPase RNA helicase);
FT                   InterProIPR011116:IPR011130:IPR000185:IPR014018:IPR
FT                   011115:IPR004027; KEGG: apv:Apar_1290 preprotein
FT                   translocase, SecA subunit; PFAM: SecA DEAD domain protein;
FT                   SecA preprotein cross-linking region; SecA Wing and
FT                   Scaffold; SEC-C motif domain protein; SPTR: C2D8N2 Protein
FT                   translocase subunit secA; TIGRFAM: preprotein translocase,
FT                   SecA subunit; PFAM: SecA DEAD-like domain; SecA preprotein
FT                   cross-linking domain; SEC-C motif; SecA Wing and Scaffold
FT                   domain; TIGRFAM: preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67277"
FT                   /db_xref="GOA:E1QY13"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY13"
FT                   /protein_id="ADK67277.1"
FT                   /translation="MPNLFSRLLSRGADKQLKELEQIASQVSGYETAMRELSDEGLRAQ
FT                   TERLRARNADGETLDDLLPEAFATVREASSRVLGMRHFDVQIIGGIALHRGMIAEMKTG
FT                   EGKTLVSTLAGYLNAIPGDGVHIVTVNDYLAKRDSEWMGQIYRFLGMSVGLLQNGMKLS
FT                   LKRPAYAADVTYGTNSEFGFDYLRDNMVTRANMRVQRGHHFAIVDEVDSILIDEARTPL
FT                   IISGAGTKSASIYKDFARAVRGLTQDVDFEMDEAKHTIATTEVGLRKIESNLGVDDIYG
FT                   DMSGQLVNHLQQALKAQYMFHRDQQYVVVDGEVKIVDEFTGRIMEGRRYSEGLHQAIEA
FT                   KEGVFVREENQTLATITLQNYFRLYDKLSGMTGTAMTEDAEFREIYSLPVQAIPSNKPV
FT                   IREDHDDLVYQTIDAKFNAVADDVTKRHSQGQPCLVGTVSIESSERLSRILDKRGIEHE
FT                   VLNAKFHEREAQIVAQAGRENAVTIATNMAGRGTDILLGGNPDELAEELLREAGVDPEE
FT                   ADGDQRAVALEQAKATCATEREHVVAAGGLCVIGTERHESRRIDNQLRGRSGRQGDPGE
FT                   TQFYLSLDDDLMRLFGGDRMDRIAAMMTKYDMPPDMPIQAKMVTKAVESAQRKVEEINF
FT                   SMRKNVLDYDDVMNKQRQVIYEERNKILDGKDLVEHIADVTFETVQRRVAEFCSESVDV
FT                   DDWDLKGLRKWVAELTGRADLPPLPENGDQQEIVEVVGDYVGSCYKEKSDRLSSEIIQE
FT                   LSAQVMLRVIDTRWMAYLQEMDYLKTGIGLRGFGQRDPLVEYKTEAYAAFTELVNTMYE
FT                   DFLRTILRIELARTPEPTEDDGLRGAKFSGPAEVDGDQGGARAVARAPQGGMAVRGRDG
FT                   KSPAASKPSTYRKSDDPDPYVGIGRNDPCPCGSGKKFKNCHGRNR"
FT   gene            171130..172242
FT                   /locus_tag="Olsu_0146"
FT   CDS_pept        171130..172242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0146"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /note="COGs: COG1186 Protein chain release factor B;
FT                   InterPro IPR004374:IPR000352:IPR005139; KEGG: apv:Apar_1289
FT                   peptide chain release factor 2; PFAM: Class I peptide chain
FT                   release factor; PCRF domain protein; SPTR: C8W8C3 Peptide
FT                   chain release factor 2; TIGRFAM: peptide chain release
FT                   factor 2; PFAM: PCRF domain; RF-1 domain; TIGRFAM: peptide
FT                   chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67278"
FT                   /db_xref="GOA:E1QY14"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY14"
FT                   /protein_id="ADK67278.1"
FT                   /translation="MDVSKADIEALARRLDEVESYLHIDERRRVVAELEERSARPGFWD
FT                   DADAASRSMTELTRAKEDVQGIEDARTRLGDASAALELGLETGDGDLLDEAARICGALE
FT                   DELGELELSSWFADDLDHGDAIVTVTPGQGGLEAQDWCDMLFKMYLRYCDRRGWKVTVN
FT                   DAPAAEAIGIDRATFTVSGKNAYGMLRAEQGVHRLVRISPTDDKKRRQTTFAGVEVLPV
FT                   LPDDVEVDIDPGDLRIDVYHASGHGGQGVNTTDSAVRITHLPTGTVVTCQNERSQIQNK
FT                   AIAMGILRSRLYELELAKREAEIDELRGPKHEIGFGNQIRSYVLYPYQLVKDLRTGVET
FT                   GNVESVLDDGDLDKFIVGYHRWAVGGGGRR"
FT   gene            172239..173153
FT                   /locus_tag="Olsu_0147"
FT   CDS_pept        172239..173153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0147"
FT                   /product="Protein of unknown function DUF2179"
FT                   /note="COGs: COG1284 conserved hypothetical protein;
FT                   InterPro IPR003740:IPR019264; KEGG: apv:Apar_1288 protein
FT                   of unknown function DUF161; PFAM: Protein of unknown
FT                   function DUF2179; protein of unknown function DUF161; SPTR:
FT                   C2D8N4 Protein of hypothetical function DUF161; PFAM:
FT                   Uncharacterized BCR, YitT family COG1284; Uncharacterized
FT                   protein conserved in bacteria (DUF2179)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67279"
FT                   /db_xref="GOA:E1QY15"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY15"
FT                   /protein_id="ADK67279.1"
FT                   /translation="MTGDAPTRIAPPMRGGLPWRRLLREGFLIILGSFVYAVGIDCFEV
FT                   PNGLAAGGLTGLATIFSALASTVGVSLPIGIQTIVMNGLLLLYVVLTTHDRSYVARSIL
FT                   GIIVSGLLTDALAPILPVPAQGELLLSAIWGGIIVGAGIGIVFLSGGNTGGTDIVCQLV
FT                   AKRSGLPVGMLSIIVDGAIVLASIPVFSLRNALYAGIAMYIAGCVIDMVVDGPRTARMA
FT                   MIVSDRHAEIAQEIMYGLGRGCTELKGRGVWSGNDRPVLMCVLGRTETTRLKAIVADID
FT                   AEAIVIVSEVHEAFGEGFSRIGG"
FT   sig_peptide     172239..172349
FT                   /locus_tag="Olsu_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            173373..174053
FT                   /locus_tag="Olsu_0148"
FT   CDS_pept        173373..174053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0148"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="COGs: COG0176 Transaldolase; InterPro
FT                   IPR013785:IPR001585; KEGG: apv:Apar_0332 transaldolase;
FT                   PFAM: Transaldolase; PRIAM: Transaldolase; SPTR: C2D8N6
FT                   Transaldolase; PFAM: Transaldolase; TIGRFAM: transaldolase,
FT                   putative, TalC family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67280"
FT                   /db_xref="GOA:E1QY16"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY16"
FT                   /protein_id="ADK67280.1"
FT                   /translation="MKFFIDTADLDEIREAASWGVLSGVTTNPSLYARTGGRLADFEPH
FT                   VVRICEACEGLPVSAESTAETTEGMVAEGRRLAALAPNVVVKLPVCEESLPACHALAAE
FT                   GVRVNMTLVFSAPQALLAARAGARYVSPFVGRFDDVADDGLAQLETVVDAVRNYDYGWW
FT                   DEEGGPEIIAASVRTPNHVTQAALMGADIATVPLAALRRCVRHPLTSEGLAKFAADWKK
FT                   VTEG"
FT   gene            174208..175416
FT                   /locus_tag="Olsu_0149"
FT   CDS_pept        174208..175416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0149"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="COGs: COG2884 ATPase involved in cell division;
FT                   InterPro IPR005286:IPR003439:IPR003593:IPR017871; KEGG:
FT                   apv:Apar_1279 cell division ATP-binding protein FtsE; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase; SPTR: C2D8N7
FT                   Cell-division ATP-binding protein; TIGRFAM: cell division
FT                   ATP-binding protein FtsE; PFAM: ABC transporter; TIGRFAM:
FT                   cell division ATP-binding protein FtsE; Type II (General)
FT                   Secretory Pathway (IISP) Family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67281"
FT                   /db_xref="GOA:E1QY17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY17"
FT                   /protein_id="ADK67281.1"
FT                   /translation="MANHFRSSERQGDEDLEQQVPLTQQDGQEASADQSVVQAQPAGQS
FT                   SFDASQPESTYSGPAHSAHLSAASSADSTAASSDDVAPAMSGPASVGQPDSGDVSAPMS
FT                   QSVSYGQPSPQGQPDTTSQAPLQDAGIVVSEKAAQERDITSQQGFTSVFAPLQDDPAPV
FT                   VSRTGKPTISLRSVTLIYPAQPNKPALEDVSLDIYPGEFVFVVGHSGSGKSTFLRLLTR
FT                   ELRATSGKVNVAGQELTSLRNWKVPYLRRQIGTVYQDFKLLPDKTVYENVAFALECIGK
FT                   PRSVIKAQVPEVLRLVGLAEKMDNYPDQLSGGEQQRVSVARAMVNRPPLLVCDEPTGNL
FT                   DPAISLGIMKLLDRINRTGTTVVMATHDREMVDSMRKRVVALEGGHVVRDQERGGYGYY
FT                   GAL"
FT   gene            175403..176329
FT                   /locus_tag="Olsu_0150"
FT   CDS_pept        175403..176329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0150"
FT                   /product="cell division protein FtsX"
FT                   /note="COGs: COG2177 Cell division protein; InterPro
FT                   IPR003838; KEGG: apv:Apar_1278 cell division protein FtsX;
FT                   PFAM: protein of unknown function DUF214; SPTR: C2D8N8
FT                   Possible cell division protein FtsX; PFAM: Predicted
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67282"
FT                   /db_xref="GOA:E1QY18"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY18"
FT                   /protein_id="ADK67282.1"
FT                   /translation="MVLSNLGYSLREAGRHFRRNWSTVLGAIVTIFLSLFVIGLFVLGS
FT                   ALVGNMVGNVEDQVTIQAFLSDDASQGDVDALQAKIEGWGTVQSVTYKSKEEALEEYKQ
FT                   IMSNRNAADAVAALDGENPVPASLVINLTDPKDVESVAGDLIADKGFEKVADDADDPAS
FT                   SVQYGRETVERLFSVTYYLRIAAIALVVMLAFIAFVFINNTIRLAISARRREIAIMRLV
FT                   GASNGFIRGPFMMEGMLEALIGSALAVIVLSAGMSVVIPRLQNSLQFLSFDLPLSVLVL
FT                   THVALVVIGLLIGLFGSMIAMRRYLKV"
FT   sig_peptide     175403..175534
FT                   /locus_tag="Olsu_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            176431..178548
FT                   /locus_tag="Olsu_0151"
FT   CDS_pept        176431..178548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0151"
FT                   /product="RNAse R"
FT                   /EC_number="3.1.-.-"
FT                   /EC_number="3.1.13.1"
FT                   /note="COGs: COG0557 Exoribonuclease R;
FT                   InterProIPR016027:IPR004476:IPR003029:IPR012340:IPR 001900;
FT                   KEGG: apv:Apar_1274 VacB and RNase II family 3'-5'
FT                   exoribonuclease; PFAM: ribonuclease II; RNA binding S1
FT                   domain protein; PRIAM: Exoribonuclease II; SPTR: B9CNE4
FT                   Ribonuclease R; TIGRFAM: VacB and RNase II family 3'-5'
FT                   exoribonuclease; PFAM: RNB domain; S1 RNA binding domain;
FT                   TIGRFAM: ribonuclease R; VacB and RNase II family 3'-5'
FT                   exoribonucleases"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67283"
FT                   /db_xref="GOA:E1QY19"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY19"
FT                   /protein_id="ADK67283.1"
FT                   /translation="MVGVRYEGGIVSRKHARRNGRRRDALRRRQQGDVLTGTIHVSRPG
FT                   VATVETAEGVFAVGRGGIREAMSGDEVQVSLSSRRGRERLAYVQGVARRATATFLGTFR
FT                   RAEPLGVVVPLDARIRRDFFVLPTDDSAHALDVADGDVVAGRILEYPTRKSAGVVTIER
FT                   RVGSPVELDMGIEAVVASYGLVVELASAALEQAEKIAPNVAETLALDPGRRDLRQSCVI
FT                   TVDPSDARDFDDAIGARRRADGYELEVHIADVTNYVSWASPIDEEARRRTCSAYLVDRV
FT                   IPMLPERLCDDVCSLKPQEDRLCMSVIVRLDRRGEVLGAEVLRTAVRSKARLDYAAADR
FT                   LLAGEAAPDDLPCDSRWRRPVAESLAVLDELASLRRERRARRGSIDFVTREAKVILDAA
FT                   GHPKGVSVRERTRATSLVEEAMLLANESVAKLISDAGLPCAYRVHERPSPEELEATIPV
FT                   LRELGLVRGSQDRAVIAGDPRAIRAVLEAARGTTGEVLANSVLLRAQKRAVYLPHNDGH
FT                   YALAAPAYCHFTSPIRRYPDIIVHRALKLLLARGEAGRPGGERVALGCVQRETERILPQ
FT                   LCRTCSERERAADAAAHASQRVKMAELYAARVGEDFSGVVVGVERYGLFVMIEESRAEG
FT                   LLPTRSLGSERFIYDESLMALTGEESGACWRPGRRIAVRVASVDVMQGQIDFALAGDAS
FT                   ASGTPRRGRLH"
FT   gene            178590..179444
FT                   /locus_tag="Olsu_0152"
FT   CDS_pept        178590..179444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0152"
FT                   /product="tetratricopeptide domain protein"
FT                   /note="InterPro IPR013026:IPR011990; KEGG: apv:Apar_1273
FT                   tetratricopeptide domain protein; SPTR: B9CNE3
FT                   Tetratricopeptide repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67284"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY20"
FT                   /protein_id="ADK67284.1"
FT                   /translation="MNQTSMTDDLIEAESLLLQGQGELAQELLSRLAEDAEEYVDRNCP
FT                   TTDELQWFSFPTLFERLAYRRVESDPRELRDPGEPMDRLYADLALACVHVGDYGMAVEA
FT                   LRHAVRWNPMGCEHRLNLADLYYNEGDVREYLALSFSVFERASDVRHLARAFANFADYF
FT                   IVCEKPQAAAAALRAARRLDANDASLAAALDQAAGTDHDPDLVDDQECHDILAQEGLPD
FT                   GANAEIAVCLLLCATDAARSGQRDVATDLTVRARDLVGDDAAKMLLEAIRADDEEGSDG
FT                   NAR"
FT   gene            179428..179937
FT                   /locus_tag="Olsu_0153"
FT   CDS_pept        179428..179937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0153"
FT                   /product="SsrA-binding protein"
FT                   /note="COGs: COG0691 tmRNA-binding protein; InterPro
FT                   IPR000037:IPR020081; KEGG: apv:Apar_1272 SsrA-binding
FT                   protein; PFAM: SmpB protein; SPTR: C8W8A6 SsrA-binding
FT                   protein; TIGRFAM: SsrA-binding protein; PFAM: SmpB protein;
FT                   TIGRFAM: SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67285"
FT                   /db_xref="GOA:E1QY21"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY21"
FT                   /protein_id="ADK67285.1"
FT                   /translation="MATHASASKSGRGKGPERDKKTISRNRTARHDYEIGETWEAGIEL
FT                   TGTEVKSIRERPCQITDSFCIVRGGELFLVGVHIHPYSNGGVWNVDPDRRRRLLMHRRQ
FT                   IDLIDQRLRTKGSSLVPLELYFDERNRVKLRVGLGKGKKLYDKRADMARRDANREIQRA
FT                   LKERSR"
FT   gene            180130..180273
FT                   /locus_tag="Olsu_0154"
FT   CDS_pept        180130..180273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0154"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="InterPro IPR004039; KEGG: apv:Apar_1271
FT                   rubredoxin-type Fe(Cys)4 protein; PFAM: Rubredoxin-type
FT                   Fe(Cys)4 protein; SPTR: A4EAD6 Putative uncharacterized
FT                   protein; PFAM: Rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67286"
FT                   /db_xref="GOA:E1QY22"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY22"
FT                   /protein_id="ADK67286.1"
FT                   /translation="MAEEKKTYRFVCTVCGFEVEVDTPELPEDYVCPVCGVGPDMFELV
FT                   EE"
FT   gene            180508..181233
FT                   /locus_tag="Olsu_0155"
FT   CDS_pept        180508..181233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0155"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="COGs: COG3619 membrane protein; InterPro IPR010699;
FT                   KEGG: apv:Apar_1270 protein of unknown function DUF1275;
FT                   PFAM: protein of unknown function DUF1275; SPTR: B9CNE0
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1275)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67287"
FT                   /db_xref="GOA:E1QY23"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY23"
FT                   /protein_id="ADK67287.1"
FT                   /translation="MRRARQTSESLELCFLLALSGGLMDAYSYLARGKVFANAQTGNML
FT                   LFGVACADGDPERMLRYSLPVLFFGVGIAAAQLTRHFCHERHVHWRQVCTAVEVLLLVV
FT                   VALIPEDHNLVANGLTSLACGIQVQSFRAFHGRALATTMCIGNLRAGTQELVSYRLTRS
FT                   RDQLEGMAIHYGVIITFVAGAIIGSRMIALVGLQAILASPVLLAIALALMFWDREGAGN
FT                   SLTGVWAAGEAAAKRQRRD"
FT   gene            complement(181840..182028)
FT                   /locus_tag="Olsu_0156"
FT   CDS_pept        complement(181840..182028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0156"
FT                   /product="integrase family protein"
FT                   /note="InterPro IPR011010:IPR013762:IPR002104; KEGG:
FT                   bcr:BCAH187_A5304 site-specific recombinase, phage
FT                   integrase family; PFAM: integrase family protein; SPTR:
FT                   C5EDK9 Putative uncharacterized protein; PFAM: Phage
FT                   integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67288"
FT                   /db_xref="GOA:E1QY24"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY24"
FT                   /protein_id="ADK67288.1"
FT                   /translation="MPHVTVENCRHSFATSYLHAGGRVEDLSRILGHSDIITTYRRYVR
FT                   PDGSDTARGMAVVVPRV"
FT   gene            182363..182959
FT                   /locus_tag="Olsu_0157"
FT   CDS_pept        182363..182959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0157"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="InterPro IPR010982:IPR001387; KEGG: shi:Shel_25650
FT                   predicted transcriptional regulator; PFAM: helix-turn-helix
FT                   domain protein; SMART: helix-turn-helix domain protein;
FT                   SPTR: C7N2R4 Predicted transcriptional regulator; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67289"
FT                   /db_xref="GOA:E1QY25"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY25"
FT                   /protein_id="ADK67289.1"
FT                   /translation="MEIGQRMRALRQGAGLTQDELAERLYVSRQTISNWETGKSYPDVE
FT                   SVSLACDLFDVSADALLKGDIMEMGKRVSEEDRRRLREDGWLFAVLLVAGCVGLSFSLA
FT                   RLDWLFVVVSLMAFGAAIFLSTRLERDKEGHDVQTFREVLAFSRGEGVDEIRDARSKMG
FT                   KVASIVVRVLVGAAAGVVIGVVAGRVAGMFVSALP"
FT   gene            183097..183894
FT                   /locus_tag="Olsu_0158"
FT   CDS_pept        183097..183894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bad:BAD_0201 hypothetical protein; SPTR:
FT                   B9CLW1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67290"
FT                   /db_xref="InterPro:IPR025117"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY26"
FT                   /protein_id="ADK67290.1"
FT                   /translation="MYFDDLCSSLSRLPEVEAIALGGSRAGECYDETSDYDLYVYCAPI
FT                   PSEEARKALLGECCAYMELSNSFWELEDDCTLKDGVDIDILYRDLGAFARELSSVVDDC
FT                   VARNGYTTCMWHNLLNSRVIFDRAGDYGRLQERYSVRYPERLRRNIISRNMRLLTGNLP
FT                   SYDSQILKAVRRGDLVSVNHRTAALMESYFDVIFALNGMTHPGEKRLVAKALEGADVLP
FT                   DGFERDVKALYQDLFSSPAAVEGDVGRLVGNLSSCLLAAGYEV"
FT   gene            183986..184882
FT                   /locus_tag="Olsu_0159"
FT   CDS_pept        183986..184882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0159"
FT                   /product="Patatin"
FT                   /note="COGs: COG4667 esterase of the alpha-beta hydrolase
FT                   superfamily; InterPro IPR016035:IPR002641; KEGG:
FT                   apv:Apar_1253 patatin; PFAM: Patatin; SPTR: B9CMF2 Serine
FT                   protease; PFAM: Patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67291"
FT                   /db_xref="GOA:E1QY27"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY27"
FT                   /protein_id="ADK67291.1"
FT                   /translation="MTQGNALVLEGGGFRGMFTAGVLDVLQEQGMYDFASVWGVSAGAI
FT                   NAASFMSHQIGRTMRIMLAFRDDRRFMSLWSLATTGDLAGGEFMYEEIQNNLDPSDDAT
FT                   FNANETRMFAVVSDVVFGTPAYLPCRRFPEDVANVRASASMPLVSRMVDIDGHRYLDGG
FT                   TTDSIPFEVALGIGAPCEIEGHVPARRALVVLTQDRSYEKSGADEQLSVRSHRYDGYPY
FT                   YIDALLGRAESYNAKRERLFDLERADESPVLVIAPEKPVEVSTNGGDGGELLDLYLQGR
FT                   RQAADRLQEIASFLGEG"
FT   gene            185136..185576
FT                   /locus_tag="Olsu_0160"
FT   CDS_pept        185136..185576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0160"
FT                   /product="LSU ribosomal protein L13P"
FT                   /note="COGs: COG0102 Ribosomal protein L13; InterPro
FT                   IPR005822:IPR005823; KEGG: apv:Apar_1250 ribosomal protein
FT                   L13; PFAM: ribosomal protein L13; SPTR: C8W885 Ribosomal
FT                   protein L13; TIGRFAM: ribosomal protein L13; PFAM:
FT                   Ribosomal protein L13; TIGRFAM: ribosomal protein L13,
FT                   bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67292"
FT                   /db_xref="GOA:E1QY28"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY28"
FT                   /protein_id="ADK67292.1"
FT                   /translation="MTKSTHYAKPGEVERSWVLIDADGATLGRLATRAAMILRGKNKPQ
FT                   YTPNTDTGDFVVVINADKVQLTGVKADHKSYWRYSGWLGGLKTESFKEAMEKHPERVVE
FT                   HAIKGMLPKTTLGRKQGTKLKVYAGPEHPHAAQNPVKIDLEA"
FT   gene            185581..185976
FT                   /locus_tag="Olsu_0161"
FT   CDS_pept        185581..185976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0161"
FT                   /product="SSU ribosomal protein S9P"
FT                   /note="COGs: COG0103 Ribosomal protein S9; InterPro
FT                   IPR020568:IPR014721:IPR020574:IPR000754; KEGG:
FT                   apv:Apar_1249 ribosomal protein S9; PFAM: ribosomal protein
FT                   S9; SPTR: C8W884 Ribosomal protein S9; PFAM: Ribosomal
FT                   protein S9/S16"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67293"
FT                   /db_xref="GOA:E1QY29"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY29"
FT                   /protein_id="ADK67293.1"
FT                   /translation="MADNTAVYTGTGRRKEATARVRLVPGTGKVTVNGRDALSYFGRQQ
FT                   LVDNAVAPFRVTDTVDRFDVLANCDGGGINGQSGALRLGIARALLEAGEYRADLKKAGF
FT                   LTRDARAVERKKYGLKKARKRPQFSKR"
FT   gene            186323..187660
FT                   /locus_tag="Olsu_0162"
FT   CDS_pept        186323..187660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0162"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="COGs: COG1109 Phosphomannomutase;
FT                   InterProIPR016055:IPR006352:IPR005841:IPR016066:IPR
FT                   005844:IPR005845:IPR005846:IPR005843; KEGG: apv:Apar_1248
FT                   phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase; PRIAM:
FT                   Phosphoglucosamine mutase; SPTR: C2D8P7 Phosphoglucosamine
FT                   mutase; TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I; TIGRFAM: phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67294"
FT                   /db_xref="GOA:E1QY30"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY30"
FT                   /protein_id="ADK67294.1"
FT                   /translation="MKYFGTDGFRGRANEGLNVDHAFKIGRYVGWYYGARRGRKARVIL
FT                   GKDTRRSSYMFESALVSGLVASGADAYTLHVIPTPGLAFETADGGFDCGIMITASHNPY
FT                   SDNGIKLVNTEGYKMDEDVLEKIEDYIDGKLEVPLATGDAIGCTVDYMQGRNRYIAHLI
FT                   ASCGFSMQGVKVGLDCANGAASSVARPVFDAMGAETHVINNAPNGFNINVDCGSTHIER
FT                   LQDFVVRNGLDVGFAYDGDADRCLAVDERGHLVDGDLILYVCGTYLAKHGRLAKNTVVP
FT                   TVMSNFGLFRAFDDAGLSYERTAVGDKNVWACMMEHGYTLGGEQSGHVIFADLEKTGDG
FT                   IMTSLRIMEVLRAERERLSELTRPVTLYPQQLVNVRVADKDAAMSAPEVKEAIGRAEAL
FT                   LEGNGRILVRASGTEPLVRVLAETPREALCTQANDIVLKALEPYRQ"
FT   gene            187756..189603
FT                   /locus_tag="Olsu_0163"
FT   CDS_pept        187756..189603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0163"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="COGs: COG0449 Glucosamine 6-phosphate synthetase
FT                   contains amidotransferase and phosphosugar isomerase
FT                   domains; InterPro IPR005855:IPR017932:IPR000583:IPR001347;
FT                   KEGG: ccu:Ccur_04700 glutamine--fructose-6-phosphate
FT                   transaminase; PFAM: sugar isomerase (SIS); glutamine
FT                   amidotransferase class-II; SPTR: C2D7F4
FT                   Glutamine--fructose-6-phosphate transaminase (Isomerizing);
FT                   TIGRFAM: glucosamine/fructose-6-phosphate aminotransferase,
FT                   isomerizing; PFAM: SIS domain; Glutamine amidotransferases
FT                   class-II; TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67295"
FT                   /db_xref="GOA:E1QY31"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY31"
FT                   /protein_id="ADK67295.1"
FT                   /translation="MCGIVAYTGKNQAEEFLLKGLQALEYRGYDSAGIEVVSPSGNLHG
FT                   VKCAGRVQTLVDRCKTANPVGTTGIAHTRWATHGAPSDRNAHPHLDCSGRIAIVHNGII
FT                   ENYAELRSYLARNGHTLVSDSDSEVIAHLVEDAWKGPARGDLVRALSNAAERLTGSYAI
FT                   AVICADAPDQVAVTRKGAPLVVASAEDGAYAASDVTPLASVTSHVITLDDGQLALLEGS
FT                   GGVQVFDADCNPVEHPDTFDIDWDASAATLGGYPDFMAKEISEQPEAIERLLKDRLGEH
FT                   GINLDELSMSNEELATIDRIYLVACGTSYHVGLIARELVEQWAKIPVFCEYASELNYKE
FT                   PLVTAHTLCVIITQSGETADTLTAARRMRAMGCKVFAITNVLGSTAARESDGTLYVQAG
FT                   PEICVCSTKAYTAQIVASALLALRLSLAKGQMDQAEVERHFHDLKQLPDLIREVLKRDW
FT                   QDQRAASLFRNARSALFLGRGVNSTTAYEGALKLKEVSYLHAEAYPAGEMKHGPIALLE
FT                   PGFPVVAIVPADHVHDKTVSNIQEVIARGATCIAVATDGDEQVASLCEHVLWIPAAPDE
FT                   RLAPILAVVHLQLLARYVARARGCDVDKPRNLAKSVTVE"
FT   gene            189608..190177
FT                   /locus_tag="Olsu_0164"
FT   CDS_pept        189608..190177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0164"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /note="COGs: COG0736 Phosphopantetheinyl transferase
FT                   (holo-ACP synthase); InterPro
FT                   IPR008278:IPR002582:IPR004568; KEGG: apv:Apar_1247
FT                   holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase; SPTR: B9CMF6
FT                   Holo-(Acyl-carrier-protein) synthase; TIGRFAM:
FT                   holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase superfamily; TIGRFAM:
FT                   phosphopantethiene--protein transferase domain;
FT                   holo-[acyl-carrier-protein] synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67296"
FT                   /db_xref="GOA:E1QY32"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY32"
FT                   /protein_id="ADK67296.1"
FT                   /translation="MARAGIGVDMLEIARMRRAMERHPSILRRTFTEEECAYCETTARP
FT                   AEHYAARFAAREAVLKALGTGFSDGIGMKDVSVGRGDDGRPRVVLMRRAAELAQAQGVQ
FT                   EVVLSLSHTREVAVANAVAVTQDVRPQVDDVPDPAREMQASFREARSVIDELERLQDGI
FT                   MDILDSDTPSQEQTASAPASGDAMGE"
FT   gene            190184..191797
FT                   /locus_tag="Olsu_0165"
FT   CDS_pept        190184..191797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0165"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="COGs: COG0063 sugar kinase; InterPro
FT                   IPR004443:IPR000631:IPR017953; KEGG: apv:Apar_1246
FT                   carbohydrate kinase, YjeF related protein; PFAM:
FT                   YjeF-family domain protein; protein of unknown function
FT                   UPF0031; SPTR: B9CMF7 Carbohydrate kinase, YjeF related
FT                   protein; TIGRFAM: carbohydrate kinase, YjeF related
FT                   protein; PFAM: YjeF-related protein N-terminus;
FT                   Carbohydrate kinase; TIGRFAM: yjeF N-terminal region; yjeF
FT                   C-terminal region, hydroxyethylthiazole kinase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67297"
FT                   /db_xref="GOA:E1QY33"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY33"
FT                   /protein_id="ADK67297.1"
FT                   /translation="MQPVLNVEDVRRVEGGLTEVGVSISELMHRAGAAAANEVLGIGDV
FT                   ETVAVLCGVGNNGGDGWVASEALRKRGLTVTVVTPVEVEEVQSDLARVVARSAQASGVS
FT                   VLVAPPRDELKALLASSDVVLDAMLGTGFHGGPRAPFDIWIACVNGSGARVVSVDVPSG
FT                   LSAQTGLADGAHVIADMTVTMLSLKPGLLSDCGRDACGAIVVAPLAEQTERLVREADPV
FT                   AWRADLEDYADVLQAPSNAVDKFTRGSVLVVGGSLRFPGAPVMAALAAARAGAGYVTLA
FT                   VPAPVAPIIQPHLLEIPVLALPAEEDGTFSTGSIEQVVQLAQKRTATLVGPGMRVSSGT
FT                   AGIVSRLIATEVPLVIDADGLNCLARLTSNRLDDFPELLRRNAPIVLTPHRRELGRLVG
FT                   LEDTPPASLTSAMEAARRIVWSDGGSEITVVSKGSATACIGTDVAILPKPGPASLATAG
FT                   SGDVLAGVMASFLARSNTGNEDLPLLAALACEVHGYAGSIAAERLGSRGAMARDIIDAL
FT                   GLAEDALEEQIAFPESASQA"
FT   gene            191819..192979
FT                   /locus_tag="Olsu_0166"
FT   CDS_pept        191819..192979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0166"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="COGs: COG0787 Alanine racemase;
FT                   InterProIPR009006:IPR000821:IPR020622:IPR001608:IPR 011079;
FT                   KEGG: apv:Apar_1245 alanine racemase; PFAM: alanine
FT                   racemase domain protein; PRIAM: Alanine racemase; SPTR:
FT                   B9CMF8 Alanine racemase; TIGRFAM: alanine racemase; PFAM:
FT                   Alanine racemase, C-terminal domain; Alanine racemase,
FT                   N-terminal domain; TIGRFAM: alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67298"
FT                   /db_xref="GOA:E1QY34"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY34"
FT                   /protein_id="ADK67298.1"
FT                   /translation="MPNVSYPKNRWAWVEVDLNAIRKNTRAFKALLEPRTQMMCAVKAD
FT                   AYGHGAVECAKAMASSGASQFAVATVDEGVELRRGGVAQPILMLNECPLEGIDDLLAFD
FT                   VMPSVYTSGFALAYGERAVSLGKVGRYHLAIDTGMSRIGVLPEDVVEFRRMIDFHRGLE
FT                   CAGSFTHFATADAIGDWDFRQQSLRFSDAVSALEGAGLEVGLVHCDNTPGTVLHPENHF
FT                   DMCRVGIGLYGLQPSETTAPRIALEPAMSVRARVTRVVNPAVGEGVGYGFTYRVPKPNI
FT                   QIATVPVGYADGLSRSLSNNMDVLVRGMRARQVGRICMDQFMFAVDVNDIRAYHPATAV
FT                   ERGDVVTLIGRDGDDEISADEMADRRDTINYEVVCNFSQRLDRIFT"
FT   gene            192989..193600
FT                   /locus_tag="Olsu_0167"
FT   CDS_pept        192989..193600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0167"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="COGs: COG1573 Uracil-DNA glycosylase; InterPro
FT                   IPR005122:IPR005273; KEGG: apv:Apar_1244 phage SPO1 DNA
FT                   polymerase-related protein; PFAM: Uracil-DNA glycosylase
FT                   superfamily; SPTR: A4EBV6 Putative uncharacterized protein;
FT                   TIGRFAM: phage SPO1 DNA polymerase-related protein; PFAM:
FT                   Uracil DNA glycosylase superfamily; TIGRFAM: uracil-DNA
FT                   glycosylase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67299"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY35"
FT                   /protein_id="ADK67299.1"
FT                   /translation="MGVMHIPGHTHQRPGEVSLEEIRSLMGNCQLCELGQTRSNLVFGV
FT                   GDPHARVMIIGEGPGKNEDLQGEPFVGAAGKKLDALLGNAGLTRDEVYIANVVKCRPPS
FT                   NRNPRPAEIEACSPFLREQVRSIWPDAIICLGNFASQWVLKTDRGVMSLRGRLHQQGHF
FT                   VVLPTFHPAACIYHSEWQPLLEEDLRLLGAWLREHPAGEA"
FT   gene            193603..194121
FT                   /locus_tag="Olsu_0168"
FT   CDS_pept        193603..194121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0168"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="COGs: COG0802 ATPase or kinase; InterPro IPR003442;
FT                   KEGG: apv:Apar_1243 protein of unknown function UPF0079;
FT                   PFAM: protein of unknown function UPF0079; SPTR: C8W878
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   P-loop hydrolase UPF0079; TIGRFAM: conserved hypothetical
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67300"
FT                   /db_xref="GOA:E1QY36"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY36"
FT                   /protein_id="ADK67300.1"
FT                   /translation="MGGLLRRDARGTFLSPDTASTIELGCELGRCLGPGDVLVLTGDLG
FT                   AGKTQLTKGIARGLGVTDDVTSPTFTIEMVYEGSSMPLYHFDLYRLNDAAQLEDTGLFD
FT                   VLGADGPCVIEWGEQFSDDIGEERLDVFVTRLDDEADPGEEPPRRVTLVARCPRAERII
FT                   DALGSRLDA"
FT   gene            194245..196713
FT                   /locus_tag="Olsu_0169"
FT   CDS_pept        194245..196713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0169"
FT                   /product="(SSU ribosomal protein S18P)-alanine
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /EC_number="3.4.24.57"
FT                   /note="COGs: COG0533 Metal-dependent protease with possible
FT                   chaperone activity;
FT                   InterProIPR016181:IPR006464:IPR017861:IPR000182:IPR 000905;
FT                   KEGG: apv:Apar_0181 metalloendopeptidase, glycoprotease
FT                   family; PFAM: GCN5-related N-acetyltransferase; peptidase
FT                   M22 glycoprotease; PRIAM: O-sialoglycoprotein
FT                   endopeptidase; SPTR: B9CN99 Putative O-sialoglycoprotein
FT                   endopeptidase; TIGRFAM: metalloendopeptidase, glycoprotease
FT                   family; ribosomal-protein-alanine acetyltransferase; PFAM:
FT                   Acetyltransferase (GNAT) family; Glycoprotease family;
FT                   TIGRFAM: metalloendopeptidase, putative, glycoprotease
FT                   family; ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67301"
FT                   /db_xref="GOA:E1QY37"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY37"
FT                   /protein_id="ADK67301.1"
FT                   /translation="MSDSPIQNSRPRLVLAIDTSTDMLACAVGTLVPQEGGGLAVELLS
FT                   SGDHPCRRQANIEIASTVHACVERSGHVMADLDDVLVGRGPGSFTGVRIGIATAKGLAC
FT                   GLSKPLLGASTLDATAWVAWRSGIRGKLAVAADAMRGEVYPGIYLLTDVGCERQFDIET
FT                   VIKADTCIEEWSACVDRHELVLTGNGLKKYRERFEAAGFANFADESLWFPTGEALLRAA
FT                   AEHPESCGNGDPALVLPVYTRLSDAEESERRRLGIQAPASVEATGVDEALADRHLQLRP
FT                   MSVNDLPAVAALEARAYAGTAHTPWGERLFAAELEQPGRSWWVAHDLGQVIGFAGGQMA
FT                   GDDFEITDVVVAPDRRRAGIASRLVARIAYDAHVLSARTASLEVDEGNEAGRATYASLG
FT                   FKGVGRRPDYYGAGHDALILKATLPLTADAEHAPERIEPAASIRPWPIVAGPRSVEARA
FT                   SLDAAGDLILAIESSCDETAMAVIDSHGVICANVVATSIDFHARFGGVVPEIASRKHVE
FT                   AIVGVFEEVMAQAGAHFGCDALVPADLAAVGVTAGPGLVGALVVGVAFAKGLCAAAGLP
FT                   LLAVNHLEGHLLANLFETPDLRPPFVASLVSGGNTMLVHVRDWGDYQVMGATIDDAVGE
FT                   AFDKVAKALGLGYPGGPVISRLAAQGNKGAVHFPRAMMHSHDYRFSLSGLKTAVITYIE
FT                   GESRAGRPIDLPDLAASFEAAVIDVQVSKALTAVDETGVSDFCVGGGVAANPELRAAYR
FT                   REFGRRGVRVTVPPLVVCGDNGAMIAVAALRNWRAGVLAPLTQDADPNAKLGCWSSSEP
FT                   PVVGEGWPSK"
FT   gene            197099..198049
FT                   /locus_tag="Olsu_0170"
FT   CDS_pept        197099..198049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0170"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="COGs: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain; InterPro
FT                   IPR006311:IPR017909:IPR001638; KEGG: acl:ACL_1251 ABC-type
FT                   transport system, substrate-binding and permease component;
FT                   PFAM: extracellular solute-binding protein family 3; SMART:
FT                   extracellular solute-binding protein family 3; SPTR: A4EBF0
FT                   Putative uncharacterized protein; PFAM: Bacterial
FT                   extracellular solute-binding proteins, family 3; TIGRFAM:
FT                   Tat (twin-arginine translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67302"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY38"
FT                   /protein_id="ADK67302.1"
FT                   /translation="MATNPHTGVHQTTNAPMDGKGGCSRRDFLKLSGLTTLAVGGTALL
FT                   SACGPAAQGTTDGMDGTSSGSDTGTLGDGKTMRVGMEAAYAPYNWQTAESTDYTIPIEN
FT                   VDGAYADGYDVQLAKTVADALGMEPVAVKMSFTGLIDALNNGQIDIIMAGMSATDERKQ
FT                   AVDFSEPYFVGGFGLLVKSDSPYASATSLSDFSGAAVLGQKDTLLDTVIDDIPGVNHLT
FT                   PVDSVPSQLSQLNQGTCDAITFNTENTKGFLRANPGLVAVQLADGRGFQETVPCNAGIK
FT                   KGQESVLAKINDAIATVPDDKRQEIFDACVDRQPA"
FT   gene            198152..199471
FT                   /locus_tag="Olsu_0171"
FT   CDS_pept        198152..199471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0171"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="COGs: COG0765 ABC-type amino acid transport system
FT                   permease component; InterPro IPR010065:IPR000515:IPR002345;
FT                   KEGG: acl:ACL_1251 ABC-type transport system,
FT                   substrate-binding and permease component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: A4EBF1 Putative uncharacterized protein;
FT                   TIGRFAM: polar amino acid ABC transporter, inner membrane
FT                   subunit; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component; TIGRFAM: amine acid ABC
FT                   transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67303"
FT                   /db_xref="GOA:E1QY39"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY39"
FT                   /protein_id="ADK67303.1"
FT                   /translation="MSASQEGPEPANDPAAMPIPRRDGPVGFVLADHRYVFLGTSVIAL
FT                   AGMWLSMQPRSHMSFLAGVYAVEVGMYYALLAFLAVAGVALANKLLRWRDYARTSPFVR
FT                   PAARRAERIASCLVVLITCVLFVDRVVMGFSAIVSAAIASDTNPQDFLSGAVYMVFEGR
FT                   AIFAQGIATTVELALFGTVIAFFLAIFLVFLRIQQIDRPDNDAVRFLKVLGVGFARVYS
FT                   SVVRGTPMMVQSLLIYFAGFAVLRGTGMSTTQIGSVWTTFVAGLVTISLNSTAYMMEVL
FT                   RGGIEAVDAGQTEAARSLGLSQWQAMTKVVFPQGIKNAIPALSNELVVNIKDSSVLSVI
FT                   GVFDLMFATTTVAGIYYRQLEVYAVATLCYLILTMIASKLLSIMAHHLDVSAPGPVLST
FT                   SDATSTAGTAGGKADPNKVKLAVAHKRARRRGAGITAPGR"
FT   gene            199482..200270
FT                   /locus_tag="Olsu_0172"
FT   CDS_pept        199482..200270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0172"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="COGs: COG1126 ABC-type polar amino acid transport
FT                   system ATPase component; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: dhd:Dhaf_2298 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: A4EBF2 Putative uncharacterized protein;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67304"
FT                   /db_xref="GOA:E1QY40"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY40"
FT                   /protein_id="ADK67304.1"
FT                   /translation="MTGDPNTTTSAEPIIRVEGLRKSFGSHEVLKNIDFEVMPGEVVTV
FT                   IGASGSGKSTLLRCINLLETPDAGHVWFRGQDLAAEHVNVNALRERIGMVFQGFNLFNN
FT                   LNVLDNCTLAPITLRRATRAEAEAEARRKLEAVGLLEFAQAPSASLSGGQKQRVAIARA
FT                   LCMEPDLMLFDEPTSALDPEIVGEVLGVMRDLAADGMTMVVVTHEMDFAKNVSDKVVFM
FT                   DQGVIAEQGSPERLFTRPGHARTREFLARYLEDTGVAQGV"
FT   gene            200273..201703
FT                   /locus_tag="Olsu_0173"
FT   CDS_pept        200273..201703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0173"
FT                   /product="peptidase M20"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro IPR011650:IPR001261:IPR002933;
FT                   KEGG: apv:Apar_0748 peptidase M20; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein; SPTR: A4EBF3
FT                   Putative uncharacterized protein; PFAM: Peptidase family
FT                   M20/M25/M40; Peptidase dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67305"
FT                   /db_xref="GOA:E1QY41"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY41"
FT                   /protein_id="ADK67305.1"
FT                   /translation="MADVWRFFSHEDDYADLAQDELCARLGRALAIRTVGGPTREETDW
FT                   AAFDELEDLFRDSYPYVFESALVERIDHSLLLTLEGTDEDLDPVMLMGHMDVVCVVEGT
FT                   ESDWTHDAFSGHVDGECVWGRGALDMKDQVVGELEAVEYALSHGWRLRRTIMLCFGQDE
FT                   ETFQSGARALGRTLEERGIRLAFAVDEGDYRIVDTAPLGAPGHHGMCVGLAEKGYADVR
FT                   LTVRSPGGHSSNPFGGTSLAILARAIDRVASAPWPVELIELERQALSVLAPHVSQDPLA
FT                   SLVAGGRASIDANAERIATLFLADRDLYPLVTTTVAPTMVEGGSQQANVMPQDMSATIN
FT                   FRMLPGVSCQDVLERVRTLVADLPVEVELLADVSNDPSRVSRADGHGFCKLADVAGRYF
FT                   VDPDDGEPLTLIPSLVVGATDARMYEGVCDSCLRFSAFVADDGEVGRGVHGTDERITRR
FT                   AYLQGVRFFIRLIEECCL"
FT   gene            202160..202513
FT                   /locus_tag="Olsu_0174"
FT   CDS_pept        202160..202513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0174"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="InterPro IPR011051:IPR014710:IPR013096; KEGG:
FT                   swi:Swit_5057 cupin 2 domain-containing protein; PFAM:
FT                   Cupin 2 conserved barrel domain protein; SPTR: A5VHA4 Cupin
FT                   2, conserved barrel domain protein; PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67306"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY42"
FT                   /protein_id="ADK67306.1"
FT                   /translation="MSWKITRRNEATFYEPPAHFDVRCTRLNNADEVNDGRVVFGLSHF
FT                   LPGGGCEYGSNPCESIYYIVEGEMDITTDDGKTTTLHKGDSYHCGPDTEKGIKNNGPVT
FT                   CQMLTIIVPPAAK"
FT   gene            202592..203374
FT                   /locus_tag="Olsu_0175"
FT   CDS_pept        202592..203374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0175"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR016040:IPR002347:IPR002198;
FT                   KEGG: afu:AF1207 2-deoxy-D-gluconate 3-dehydrogenase
FT                   (KduD); PFAM: short-chain dehydrogenase/reductase SDR;
FT                   SPTR: O29061 2-deoxy-D-gluconate 3-dehydrogenase (KduD);
FT                   PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67307"
FT                   /db_xref="GOA:E1QY43"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY43"
FT                   /protein_id="ADK67307.1"
FT                   /translation="MTDLFDLTGKKAVVVGGAGGIGQAIAEGLGEAGAQVMITSRKEES
FT                   LKRAQSEIKESSGVDVLYHVADVTDEDAVEKLLDAAVDEMGTVDILVNSQGYNKKFPGT
FT                   EFPVDEWNKLMDVNVKSLMLTCKHFGKYWKDNDKQGKIINVGSVRGIRAVGNGGMGNVG
FT                   YCSTKGAVEMLTKAYASDLGPKIQVNCIGPTITYTPMMVGLLPDDETTRNAIAKAMPAK
FT                   RIGYPDDCKGVSIFLASKASDFITGSSIYPDGGLNAVG"
FT   gene            203465..204334
FT                   /locus_tag="Olsu_0176"
FT   CDS_pept        203465..204334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0176"
FT                   /product="Acetoacetate decarboxylase"
FT                   /note="InterPro IPR010451; KEGG: rlg:Rleg_5523 acetoacetate
FT                   decarboxylase; PFAM: Acetoacetate decarboxylase; SPTR:
FT                   B1SYR7 Putative uncharacterized protein; PFAM: Acetoacetate
FT                   decarboxylase (ADC)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67308"
FT                   /db_xref="GOA:E1QY44"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY44"
FT                   /protein_id="ADK67308.1"
FT                   /translation="MGLTFEKNKIYEMPVFFGPSPDPKNPRPDGTILNKPADVEAATVM
FT                   FETDASMLEALLPDGFSLAEPVLSVAQCEFKHIGNFAGNSYTLINISVPARFDGERDHL
FT                   RGDLVLAMYENHAEPIIGGRELLGYSKIYADIPRLAEHDGIVRGQASDWGFKFLDLRLD
FT                   LNRQPEDGEYMSRITGESEAKFNYKYIQACPEKGQKPWEAAVDASYPVANPTIGWEAPE
FT                   GYPYTLAEPRRQPCAGTVEFHAPTGEDMPMSWWIPAYLAKLPIKRYVGASHAFYTDPAD
FT                   YTRIYRLR"
FT   gene            204410..205927
FT                   /locus_tag="Olsu_0177"
FT   CDS_pept        204410..205927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0177"
FT                   /product="methylmalonate-semialdehyde dehydrogenase
FT                   (acylating)"
FT                   /EC_number="1.2.1.27"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR016161:IPR010061:IPR016162:IPR015590; KEGG:
FT                   methylmalonate-semialdehyde dehydrogenase; PFAM: Aldehyde
FT                   Dehydrogenase; SPTR: B0PE38 Putative uncharacterized
FT                   protein; TIGRFAM: methylmalonate-semialdehyde
FT                   dehydrogenase; PFAM: Aldehyde dehydrogenase family;
FT                   TIGRFAM: methylmalonic acid semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67309"
FT                   /db_xref="GOA:E1QY45"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY45"
FT                   /protein_id="ADK67309.1"
FT                   /translation="MSVKRKGYCVNGEWKTSATDIYTKVTDSSTGEIIAEVPRCTKEEV
FT                   DEAIASAEAAFPAWSALSLSRRAQMMFRWRDVLVDHLDELTLLCAKEHGKNLNESRGDI
FT                   LKAIEPTELACSLPYAIQGSNAVQVTTGFDCSTFRQPLGVVAGIVPFNFPAMIPWGWMV
FT                   PLAIACGNTVILKAATPTPLTSMRILELFYEEAHFPKGVVNLVTCTHNEADILLTDERI
FT                   KAVTFVGTTGVGKQVTATAAAHGKRVQAQCEAKNHALVLADCDLEATTNAVINSAFGCA
FT                   GERCMALPVCCVEESIADEFVAMLKQKAEAMVIGRAYDSETKLGPLVSAEHKARVEGWI
FT                   AKGVEEGAQLVLDGRGRVIEGSEGGFYLGPTIFDHVEPGMTVGDREIFGPVVCIKRVHG
FT                   YEEGIKIMNANPFANGSSIFTQDGYWARRFKLETDGGMVGVNVGIPVPTAYYPFSGNKQ
FT                   SFFGDQHVLGLDGYRFYTRAKTVTEHWFDEKSSTKKLDSWEGTVERA"
FT   gene            206002..207225
FT                   /locus_tag="Olsu_0178"
FT   CDS_pept        206002..207225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0178"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2271 Sugar phosphate permease; InterPro
FT                   IPR016196:IPR011701; KEGG: dsy:DSY1454 hypothetical
FT                   protein; PFAM: major facilitator superfamily MFS_1; SPTR:
FT                   C2BY46 MFS transporter; PFAM: Major Facilitator
FT                   Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67310"
FT                   /db_xref="GOA:E1QY46"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY46"
FT                   /protein_id="ADK67310.1"
FT                   /translation="MSTQGSGRKWLGFAVLMLAGITINVSQLKVVPINNDIVTELDVDL
FT                   TSTAWLTSVFTIAGIFLALPGSGIMTRVGPKRMLVALLACLLAGNLLGILGFAVSSYVV
FT                   VLVSRIIEGISCALIIPCGLSLLAFWFGGMSSMGLATGLFTIANPVANFVVMNVSLPIL
FT                   VTTGSVTGCWWFVVILALVSLVGSVALVDDGTSAGEGPDASEKVSIADATINNRPLVTI
FT                   CIAMFFLSFCLMGVVTDYPTIFTVAHGLDQVTANFYTSLNGFIGIPAAIVLGWVIGKTG
FT                   KPFTVALVGAIGTLLVDLGLLWLNPATYLLNVMAASIFTGGFAVTAFFEITPQLAERKE
FT                   YVPLASGALNTFYYLGIFLSTPCLTALSADGTDWTVPALLMACSAAVLCVLVVVTRHLA
FT                   EREGIEVH"
FT   gene            207362..208375
FT                   /locus_tag="Olsu_0179"
FT   CDS_pept        207362..208375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0179"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="COGs: COG1024 Enoyl-CoA hydratase/carnithine
FT                   racemase; InterPro IPR001753; KEGG: cbe:Cbei_2230 enoyl-CoA
FT                   hydratase/isomerase; PFAM: Enoyl-CoA hydratase/isomerase;
FT                   SPTR: A6LVL5 Enoyl-CoA hydratase/isomerase; PFAM: Enoyl-CoA
FT                   hydratase/isomerase family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67311"
FT                   /db_xref="GOA:E1QY47"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY47"
FT                   /protein_id="ADK67311.1"
FT                   /translation="MGTPLADYVKLPQLEEYKEWFKDFADLYREDGILQVTWKTNDGPM
FT                   CHSGMSHRACSQLTRVLSLDWKNEIIIFTHIGDSWMTESDPNGWDTYAELPIQRFQHQY
FT                   FDDTNLIKNMVFDLDVPTIGAIPGPGFHWDSAMLCDITIASDDTWMEVPHAHGGLVPGD
FT                   GMGLMAQHFFGTKRGNYYAMTARQWTAQQMLDWGMVSEVVEKGTVMDRAWEIARMLKTM
FT                   PYENRTIMSNLAKRPLKKLFVEDLKLHTVSEQYASLLRIAAGDLGDTNAGQQDEKYISQ
FT                   TNDWRYCHDWMQQPPTRESWEGFRTKPFEWAKEVEEGKATNPFTPKPTEPYRPKKV"
FT   gene            208470..209393
FT                   /locus_tag="Olsu_0180"
FT   CDS_pept        208470..209393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0180"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847:IPR011991:IPR005119; KEGG: sen:SACE_0823 LysR
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   LysR; LysR substrate-binding; SPTR: A4F7Y9 Transcriptional
FT                   regulator, LysR family; PFAM: LysR substrate binding
FT                   domain; Bacterial regulatory helix-turn-helix protein, lysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67312"
FT                   /db_xref="GOA:E1QY48"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY48"
FT                   /protein_id="ADK67312.1"
FT                   /translation="MEIRQLRYFVAVAEMQSFTKAAKMLFVSQSALSQQLGKLEDETGL
FT                   HLVDRTTRAVSLTDVGKKVLPSVRHILREVDNLASIDEASSGLLLDGRHEVRIGFDLRG
FT                   MYNRDLRHTITDSLFKLRALVPDLHVSFAALNHENLVSELEDGRVDLGFFLHQDRRLHG
FT                   SNALEVKYLGQDEMVIAIRSAEDVGEGPDAARHVLRKHDVCLLDRESTGSYQSIKIFEE
FT                   LGVEPRLYFASSRESMLMLLDSGECASVLPRGVILRHDRSNVRTIRLDMGDATLYWLAA
FT                   WHKDGDSRIIDAILDAISCREDLFFA"
FT   gene            209475..211115
FT                   /locus_tag="Olsu_0181"
FT   CDS_pept        209475..211115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0181"
FT                   /product="Amidohydrolase 3"
FT                   /note="COGs: COG1574 metal-dependent hydrolase with the
FT                   TIM-barrel fold; InterPro IPR011059:IPR013108; KEGG:
FT                   ele:Elen_2060 amidohydrolase 3; PFAM: Amidohydrolase 3;
FT                   SPTR: C8WIY2 Amidohydrolase 3; PFAM: Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67313"
FT                   /db_xref="GOA:E1QY49"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY49"
FT                   /protein_id="ADK67313.1"
FT                   /translation="MNSEANSEAVALASNHVFVSARRPDEAATLVLRGGCVERLLPREA
FT                   ASDLAAAGIEVRDLGEAFVTPGFHDAHQHVFHAALFPSGLATEYRGTSERDVVDHMVSF
FT                   ARTRPGDGWLLGHGWRETFWNPAQAPTRSSLDAAFPNRPVALYSGDAHTLWVNSAGLRE
FT                   LGIDEGTEPPQGGSFDRDDEGRLTGVLREAAGMFYVARVLRSLPLDEMKGIYRSYFVRL
FT                   NAMGVTSVCDMALSLVPGADGINPAVYEALLAEGDLTLRAHLFPTLSEDESNLEGLQAR
FT                   LTGDMLRAPGFKQFFDGVSSQHTAWVTDEYANPRFAGDVGRPTVAPERMRALVLAAASR
FT                   GHAVRIHTIGDEAVRQAIDIFTEAHRRYGDPHQGANTMEHVEDIHPEDIARMAAAHVVA
FT                   SVQPPHVTIDVTQPARDLGEWRARRMWPFDQMLHQGVTLAFGTDAPVVAPNALDVLWCA
FT                   TERSDPDAHEPASGWHPEHRVSRIQAIGAYTAGSAAAVARAGELGTLEPGMLADLAVWD
FT                   TNLLTVPSERLQGSRVLETYVGGCRVWCA"
FT   sig_peptide     209475..209555
FT                   /locus_tag="Olsu_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            211434..213380
FT                   /locus_tag="Olsu_0182"
FT   CDS_pept        211434..213380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0182"
FT                   /product="NAD+ synthetase"
FT                   /note="COGs: COG0171 NAD synthase; InterPro
FT                   IPR003010:IPR003694:IPR014729:IPR014445; KEGG:
FT                   apv:Apar_0182 NAD+ synthetase; PFAM: NAD synthase;
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; SPTR: B9CN98 Glutamine-dependent NAD+
FT                   synthetase; TIGRFAM: NAD+ synthetase; PFAM: NAD synthase;
FT                   Carbon-nitrogen hydrolase; TIGRFAM: NAD+ synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67314"
FT                   /db_xref="GOA:E1QY50"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="InterPro:IPR041856"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY50"
FT                   /protein_id="ADK67314.1"
FT                   /translation="MQDGFVKVAARSPKVSVADVHANVDACVAEAADAVRSDGAKLVVL
FT                   PELCVTGYTCEDLFWQDELLDAAERGLRTLAERTTVLDALVLVGIPARVNDKLYNCAAA
FT                   LAHGELLGLVPKRNIPNYNEFYEARHFAAGPTDVSHVRFADWENIPFGTSQLFACSTLL
FT                   QLKVAVEVCEDLWVASPPSIAHAQAGATVICNLSASNAVVGKADYRRELVVGQSARLVS
FT                   AYVYASAGWGESTQDLVFSAHDLIAENGVLLAQASPFGEAAVTTEIDVASLSAERRRLS
FT                   TFGCTPTAQDAGYEVTTFSLATADTRLTRRVDPHPFVPANPARRAERCEDVLSIQSHGL
FT                   AKRLSHTRSDCAVVGVSGGLDSTLALLVCARAFDILGLDRSGILAVTMPGFGTTDRTHG
FT                   NATVLADTLGATLREVDITTAVLQHFSDIGHDESDHSVTYENAQARERMQVLMDMANQE
FT                   GGLVVGTGDLSELALGWATYNADHMSMYGVNAGIPKTLVRHLVRYVADITASDGLSRVL
FT                   LDVLDTPVSPELLPATAHGTISQRTEDLVGPYELHDFFLYQVLRRGFAPRKVYRLARYA
FT                   LGEGTAAGYDDATILKWLRTFYRRFFSQQFKRSCLPDGPKVGSVAVSPRGDLRMPSDAC
FT                   ANSWLRELAGLGK"
FT   gene            213593..213883
FT                   /locus_tag="Olsu_0183"
FT   CDS_pept        213593..213883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0183"
FT                   /product="Chaperonin Cpn10"
FT                   /note="COGs: COG0234 Co-chaperonin GroES (HSP10); InterPro
FT                   IPR011032:IPR020818:IPR001476:IPR018369; KEGG:
FT                   apv:Apar_0183 chaperonin Cpn10; PFAM: Chaperonin Cpn10;
FT                   SPTR: C2D880 10 kDa chaperonin; PFAM: Chaperonin 10 Kd
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67315"
FT                   /db_xref="GOA:E1QY51"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY51"
FT                   /protein_id="ADK67315.1"
FT                   /translation="MTLKPLGDRVLVKPAPKEEKTASGLYISSGAQEKPQRGEVIAVGA
FT                   GKLNDKGERIVPDVKVGDQVYYGKFGGNEIKVDGEDFLLLRADDIYAIVTE"
FT   gene            213936..215576
FT                   /locus_tag="Olsu_0184"
FT   CDS_pept        213936..215576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0184"
FT                   /product="chaperonin GroEL"
FT                   /note="COGs: COG0459 Chaperonin GroEL (HSP60 family);
FT                   InterPro IPR002423:IPR001844:IPR018370; KEGG: apv:Apar_0184
FT                   chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1; SPTR:
FT                   B9CN95 60 kDa chaperonin; TIGRFAM: chaperonin GroEL; PFAM:
FT                   TCP-1/cpn60 chaperonin family; TIGRFAM: chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67316"
FT                   /db_xref="GOA:E1QY52"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY52"
FT                   /protein_id="ADK67316.1"
FT                   /translation="MAKDIAFGTDARAKLAKGVNTLADAVTTTMGPKGRYVAIERSFGA
FT                   PTITNDGVSVAKEIELKDPIENMGAQLVKEVATKTNDTVGDGTTTATLLAQVIVNEGLR
FT                   NVAAGANPIAIRRGVDKAVTAAVDEMKKAARDVSTSEQIASVGTISAGDPAIGAKISEA
FT                   MEVVGKDGVITVEDSQTFGIDIDTVEGMQFDKGYISPYFATNNENMTAELQNPYILMTD
FT                   QKISNIQDILPVLEAIQKSGSPLLLIAEDVDGEALATLILNKLRGTLNVCAVKAPGYGD
FT                   RRKRMLEDIAILTGGQPAMKELGVELTDVTAEMLGRAKSVKVTKDETTIVDGAGSKEAI
FT                   EERLGQINSEIENTDSDFDREKLQERKAKLAGGVAVIKVGAATEVELKEVKHRIEDALQ
FT                   ATRAAVEEGIVAGGGVAFLQATKALDDVDCADNDERIGVEIIRKALSAPVRTIAQNAGF
FT                   EGSVVVEKIKGLPEGEGLDSANGEWGDMIEMGVLDPVKVTRTTLQNAASVSGLILITEA
FT                   TVSDEPKDTSIEDAISRAAAAGGQGGGMY"
FT   gene            complement(216089..216982)
FT                   /locus_tag="Olsu_0185"
FT   CDS_pept        complement(216089..216982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0185"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterProIPR017896:IPR011352:IPR017900:IPR001989:IPR
FT                   007197:IPR001450; KEGG: apv:Apar_0135
FT                   (formate-C-acetyltransferase)-activating enzyme; PFAM:
FT                   Radical SAM domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; SPTR: C8W8Y3
FT                   (Formate-C-acetyltransferase)-activating enzyme; PFAM:
FT                   Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67317"
FT                   /db_xref="GOA:E1QY53"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023912"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY53"
FT                   /protein_id="ADK67317.1"
FT                   /translation="MPADDAAAPRLGRRASERTSERVMVNKVIPFSLVDGPGSRCSVFL
FT                   QGCNIRCAYCHNPETQATCINCTDCVAGCPSGALSLREGRVVWDEATCIGCDQCIHVCG
FT                   HRASPKVRLLDAGEVFGIVRGYVPFIRGVTTSGGECMLHPRFLKGLFERCRGIGLETLI
FT                   DTNGTIDFEGHEDLLAVANGVMLDVKAWDDGLFRRLTGSGNATVLKNLAFLGERDKLEE
FT                   IRVVVVDGWNDPEDAIDGIADTLGELVGRQRLKLIRFRRFGVIGELSSMASPSDERMAQ
FT                   LERRARDVGFGEVVTT"
FT   gene            complement(216982..218481)
FT                   /locus_tag="Olsu_0186"
FT   CDS_pept        complement(216982..218481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: apv:Apar_0136 hypothetical protein; SPTR:
FT                   C8W8Y4 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF3029)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67318"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY54"
FT                   /protein_id="ADK67318.1"
FT                   /translation="MSGFMDIITARNLTYKQKVLHLAQAAENSEHPLKTTKEFDRLFAA
FT                   HAIDDMCEGNAPYRPRYIAPDYQLFAEQGSDFLRLDAPKDLDDLLWGLAMLYDNVPSVT
FT                   SRPVYVGQLDRVIEPFIANLDDESVMDRLARFLDYVDRTVASGYCHANIGPEYTRAGEL
FT                   LLRVEQRLQNAVPNFTLKYDPAITPDGYARLALETTMLCSNPAFANDRIHRETYPDDYT
FT                   VVSCYNVLPLRGGAYCLDRILLPHLAELATGVDDFMDNLIPEATGALLEFMNERVRFIV
FT                   ERSHFFESSFLVREGLIERERFCGMFGVAGMSECVERLLSPGGNHVYGTDPEANALAER
FT                   IMERICSQVAGFDAVYSEVAGGHFLMHAQAGFSDQKGVTPGVRIRVGEEPESLFDHIRM
FT                   QARMHRFFNTGVSDIFPIEPTAKGNPDALLDVVKGAFALDDKYLSFYSSDSDLVRITGF
FT                   LAKRSEMERFQGGGAVLQDTAHDGLGNYTANHLADRKVSLG"
FT   gene            complement(218717..219646)
FT                   /locus_tag="Olsu_0187"
FT   CDS_pept        complement(218717..219646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0187"
FT                   /product="Indigoidine synthase A family protein"
FT                   /note="COGs: COG2313 Uncharacterized protein involved in
FT                   pigment biosynthesis; InterPro IPR007342; KEGG:
FT                   apv:Apar_0138 indigoidine synthase A family protein; PFAM:
FT                   Indigoidine synthase A family protein; SPTR: B0PDC2
FT                   Putative uncharacterized protein; PFAM: Indigoidine
FT                   synthase A like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67319"
FT                   /db_xref="GOA:E1QY55"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY55"
FT                   /protein_id="ADK67319.1"
FT                   /translation="MKNLKDYLVVSPEVQEALDNNRPVVALESTIISHGMPYPRNVETA
FT                   LNVERIIRDHGAVPATIAIIGGKLVAGCSAEQIERLGKKGLEVTKASRRDLPVLIERAA
FT                   DGASTVAATMIIASLAGISVFATGGIGGVHRGAETTMDVSADLEELAQTPVMVICAGAK
FT                   SILDLGLTREYLETKGVTVLGYQTDVLPAFYTRESAFGVDYRVDTASELAGIFNAKEAV
FT                   GLRGGLLVTNPIPEQYSMDADAINQTIDEAVAEAGALGVRGKDITPYLLDKIQKMTGGA
FT                   SLEANIQLVYNNVALGAEVAKELCARRA"
FT   gene            complement(219739..220839)
FT                   /locus_tag="Olsu_0188"
FT   CDS_pept        complement(219739..220839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0188"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR000792:IPR002173:IPR000835:IPR011611; KEGG:
FT                   apv:Apar_0139 transcriptional regulator, MarR family; PFAM:
FT                   PfkB domain protein; regulatory protein MarR; SMART:
FT                   regulatory protein LuxR; SPTR: B0PDC1 Putative
FT                   uncharacterized protein; PFAM: pfkB family carbohydrate
FT                   kinase; Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67320"
FT                   /db_xref="GOA:E1QY56"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY56"
FT                   /protein_id="ADK67320.1"
FT                   /translation="MDSLTERERQILSWIEENPAVTQSELAGRAGISRSSVAVHVSSLM
FT                   RKGAILGRRYVVRKAPYVTVVGGANLDIGGRPFQELRQRDSNPGSVTTSPGGAGRNIAH
FT                   NLALLGQDVRLVSAFGTDERAALLTGACRSAGIDISSSLTVSGGTTSTYLFVADRRGDM
FT                   SVAVADMRIFDELTPAFLERHLDALDRADVCVIDANLPVASIRYLSEHVRAPLFCDPVS
FT                   TAKAEKLGGVLGRLHTLKPNRLEAEVLTGVHISDRTSLDRAVDRLLGTGLERVFVSLGS
FT                   EGVLCADHTHRTLLPPLETRVANTTGAGDAMMAAITWSWLCGHSLEEGGRAGIAAAAIC
FT                   VESPDTISASMSEDALLARMETCTTE"
FT   gene            221184..222386
FT                   /locus_tag="Olsu_0189"
FT   CDS_pept        221184..222386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0189"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="COGs: COG1015 Phosphopentomutase;
FT                   InterProIPR017850:IPR010045:IPR017849:IPR013553:IPR 006124;
FT                   KEGG: apv:Apar_0140 phosphopentomutase; PFAM:
FT                   Phosphopentomutase domain protein; metalloenzyme domain
FT                   protein; PRIAM: Phosphopentomutase; SPTR: B9CM23
FT                   Phosphopentomutase; TIGRFAM: phosphopentomutase; PFAM:
FT                   Metalloenzyme superfamily; TIGRFAM: phosphopentomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67321"
FT                   /db_xref="GOA:E1QY57"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY57"
FT                   /protein_id="ADK67321.1"
FT                   /translation="MGRRAFLVVLDSFGIGEAPDAAEYGDEGSNTLCACATSPHFSMDN
FT                   MRDLGLFNIEGALDSVYDVHLSPTSAPQGAFARLREASKGKDTTVGHWEMAGVISPKLF
FT                   PTYPDGFPAEVIEEFERQCGRKVLCNRPYSGTDVIRDFGDEMVERGALIVYTSADSVFQ
FT                   IAAHEDVVPCEKLYEYCRIARGILTGAHGVARVIARPFVGESGSYVRTPRRHDFSLEPT
FT                   GTTMLDRLTEEGADVISVGKIFDIFAHRGIKESIPTTGNPEGIERTIELLDRDFEGLCF
FT                   TNLVDTDMIYGHRNDVDGYAKALAYFDAHVPAILSKLREDDLFMIVADHGCDPVTPSTD
FT                   HSREYVPWVIAGPRVRAGADLGTRPTFADVSATILDYLDASPLGVGVSHVSEILEVRDD
FT                   G"
FT   sig_peptide     221184..221246
FT                   /locus_tag="Olsu_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            222379..223107
FT                   /locus_tag="Olsu_0190"
FT   CDS_pept        222379..223107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0190"
FT                   /product="purine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="COGs: COG0813 Purine-nucleoside phosphorylase;
FT                   InterPro IPR004402:IPR018016:IPR000845; KEGG: apv:Apar_0141
FT                   purine nucleoside phosphorylase; PFAM: purine or other
FT                   phosphorylase family 1; SPTR: B9CM24 Purine nucleoside
FT                   phosphorylase; TIGRFAM: purine nucleoside phosphorylase;
FT                   PFAM: Phosphorylase superfamily; TIGRFAM: purine-nucleoside
FT                   phosphorylase, family 1 (deoD)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67322"
FT                   /db_xref="GOA:E1QY58"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY58"
FT                   /protein_id="ADK67322.1"
FT                   /translation="MASVPTPHNDALEGQIAPLVLMPGDPLRARYIAEGYLEDVTCFNG
FT                   VRNMLGFTGTYQGNPVSVMGSGMGMPSIGIYSYELYNFYGVDAIVRIGSAGGIGDGLRL
FT                   RDLVIAQGACTDSNYARQFALPGTFAPIADFGLLRRAVESAERLGVPVRVGNVLSEDAF
FT                   YSADETGAARWAAMGVLALEMEAAALYMNAAHAHKRALAMLSISDLVFTGEALPASERQ
FT                   TSFTQMMEVALSLAVPEAEK"
FT   gene            223216..224286
FT                   /locus_tag="Olsu_0191"
FT   CDS_pept        223216..224286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0191"
FT                   /product="nucleoside-binding protein"
FT                   /note="COGs: COG1744 Uncharacterized ABC-type transport
FT                   system periplasmic component/surface lipoprotein; InterPro
FT                   IPR006311:IPR017909:IPR019546:IPR003760; KEGG:
FT                   apv:Apar_0142 basic membrane lipoprotein; PFAM: basic
FT                   membrane lipoprotein; Twin-arginine translocation pathway,
FT                   signal sequence, subgroup; SPTR: C8W8Z0 Basic membrane
FT                   lipoprotein; PFAM: TAT (twin-arginine translocation)
FT                   pathway signal sequence; Basic membrane protein; TIGRFAM:
FT                   Tat (twin-arginine translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67323"
FT                   /db_xref="GOA:E1QY59"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY59"
FT                   /protein_id="ADK67323.1"
FT                   /translation="MNMNLSRRQFMRGTAALAVTLGLGGCGGTSGGTDTGATDKASEAS
FT                   YKIQMVTDTGGVNDQSFNQLAWEGLQKLKDERGWDISYLESKQESDYATNLDKAVDDNA
FT                   NLVWGVGFAMADAVENSAKSNPDVQFAVIDNAYENPPSNLVGVCFRAQEPSFMVGYIAA
FT                   CTTKTGQVGFVGGVSSSIIDQFEWGYKAGVAYGAKEKGTEVTVSAQYADSFTDSAKGKA
FT                   IASKMFSDGCDVVFHAAGGVGTGVIEAAKEANKYAIGVDKDQAYLAPDNVLTSALKRVD
FT                   KAVIEVSQKIEAKEVSGGDNMSLGMSEEAVGIPEDHKLMGEDVYKAAIELGDKIRGGSI
FT                   VPPASEADYATYVAAL"
FT   sig_peptide     223216..223311
FT                   /locus_tag="Olsu_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            224388..225917
FT                   /locus_tag="Olsu_0192"
FT   CDS_pept        224388..225917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0192"
FT                   /product="nucleoside ABC transporter ATP-binding protein"
FT                   /note="COGs: COG3845 ABC-type uncharacterized transport
FT                   systems ATPase components; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: apv:Apar_0143 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: B9CM26 Ribose import ATP-binding protein
FT                   RbsA; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67324"
FT                   /db_xref="GOA:E1QY60"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY60"
FT                   /protein_id="ADK67324.1"
FT                   /translation="MEACSEYAVQMHGITKTFGTFTALDGVDLDVRRQTVHAILGENGA
FT                   GKSTLMNVLYGLYQADSGEVYLGGERVEIGGPSDAIKRGIGMVHQHFMLVENFTVTENI
FT                   ILGDEVCGPAGTLDMRRAREDVAKIVDEYGFDIDPDAKIEDITVGMQQRVEILKALYRG
FT                   ADTLILDEPTAVLTPQEIEQLIRIMRDLVSKGKTIIIITHKLKEIMSSADVCTIIRRGQ
FT                   YMGTVDVADVDEAELAAKMVGRRVNLTVEKAPATPGETVLSIRDLHVKDERGIEQVTGL
FT                   SLDVRAGEIVGIAGVDGNGQKELVDAITCLVKVESGTISVQGTELQNTSPRYVLDHGVA
FT                   TVHSDRHRFGMVLPMTVAENMVLERHGEERFGKGLMLDYDKMRSFTRELIEEFDIRPSG
FT                   CEDSVAKGLSGGNQQKAVIAREVSGSPELLVAVQPTRGLDVGAIEFVHKTLVRERDKGK
FT                   AVLLISLELDEVMSVSDTIDVIYGGKIVGSFEQGSVGEEELGLLMAGGGSK"
FT   gene            225914..227047
FT                   /locus_tag="Olsu_0193"
FT   CDS_pept        225914..227047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0193"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /note="COGs: COG4603 ABC-type uncharacterized transport
FT                   system permease component; InterPro IPR001851; KEGG:
FT                   apv:Apar_0144 inner-membrane translocator; PFAM:
FT                   inner-membrane translocator; SPTR: B9CM27 Inner-membrane
FT                   translocator; PFAM: Branched-chain amino acid transport
FT                   system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67325"
FT                   /db_xref="GOA:E1QY61"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY61"
FT                   /protein_id="ADK67325.1"
FT                   /translation="MKTLIRIMRKPITSSLVAILVGFVVASIVLAAAGYDPLASFAALF
FT                   NGMLGKPKYISNVVIKATPLLLTGIAVAFAFKVGLFNIGAEGQYIIGTICAVMAGTTLN
FT                   LPAPIQVPLVVLAGMLGGAAGGAFVGWLKARFGIHEVITSIMMNWIALYLCNFVVNTSA
FT                   FHQPDSTASYPVNPSSYTMVLPNWKLSEAGMDTLKDVPWLYDVLVKTDVNVGILVAIVA
FT                   AVLVAVLLSRTKSGYEMRAVGLNREAARFAGISVEKNIVLCMLISGALCGLAGALTITG
FT                   TAPHSLSILAAFENAGFNGLSVAFIAGCSPIGCIPASLLFSGLIYGGQTVQQVMGAPSD
FT                   IINIMIGTIVFFMALGGVIPMLAARLEKREKEAAHAQ"
FT   sig_peptide     225914..226006
FT                   /locus_tag="Olsu_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            227037..227957
FT                   /locus_tag="Olsu_0194"
FT   CDS_pept        227037..227957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0194"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /note="COGs: COG1079 ABC-type transport system permease
FT                   component; InterPro IPR001851; KEGG: apv:Apar_0145
FT                   inner-membrane translocator; PFAM: inner-membrane
FT                   translocator; SPTR: C8W8Z3 Inner-membrane translocator;
FT                   PFAM: Branched-chain amino acid transport system / permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67326"
FT                   /db_xref="GOA:E1QY62"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY62"
FT                   /protein_id="ADK67326.1"
FT                   /translation="MLSNLLLLVGITLMYSTPLVFGALGGVVSERSGVTNIGIEGMMSV
FT                   GAIAAASTSYFTGNPWLGFLAAGIAGTLIALLHAIASVTFNADQTVSGVAINLLAPGVS
FT                   LFVCRRLFDNAAMTPPVTTLPKLFGEGAFAGTEFSNLNVDVTVMLALVAALVVWFVLYK
FT                   TKWGLRVRAVGEHPAAADTLGIDVGRTRYVCVLVSGLLAGFGGASVTLAIISQFTQTAI
FT                   SGQGFIALAAVIFGKWKPQGAYGACLLFGLAQALAVILGGGATPIPSQIVAMFPYVMTI
FT                   VVLVLFVGRSEAPKADGVPYIKGGR"
FT   sig_peptide     227037..227102
FT                   /locus_tag="Olsu_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            228051..228497
FT                   /locus_tag="Olsu_0195"
FT   CDS_pept        228051..228497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0195"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /note="COGs: COG0295 Cytidine deaminase; InterPro
FT                   IPR016193:IPR006262:IPR016192:IPR002125; KEGG:
FT                   cth:Cthe_1582 cytidine deaminase; PFAM: CMP/dCMP deaminase
FT                   zinc-binding; SPTR: B9CM29 Cytidine deaminase; TIGRFAM:
FT                   cytidine deaminase; PFAM: Cytidine and deoxycytidylate
FT                   deaminase zinc-binding region; TIGRFAM: cytidine deaminase,
FT                   homotetrameric"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67327"
FT                   /db_xref="GOA:E1QY63"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY63"
FT                   /protein_id="ADK67327.1"
FT                   /translation="MEDSELVREAIVAREGAYVPYSHFSVGAALLDADGRVWHGCNIEN
FT                   AAYSPGNCAERTAIFKAVSEGVRGFVAIAVVGGAEGRPISDWCAPCGVCRQVLREFCDP
FT                   GSFRVVLARSPQDMRGYLLKELLPMGFGPEDLRRADDNGEADAQ"
FT   gene            228494..229825
FT                   /locus_tag="Olsu_0196"
FT   CDS_pept        228494..229825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0196"
FT                   /product="thymidine phosphorylase"
FT                   /EC_number="2.4.2.2"
FT                   /EC_number="2.4.2.4"
FT                   /note="COGs: COG0213 Thymidine phosphorylase;
FT                   InterProIPR000312:IPR013102:IPR017459:IPR018090:IPR
FT                   020072:IPR000053:IPR017872; KEGG: apv:Apar_0147
FT                   pyrimidine-nucleoside phosphorylase; PFAM: glycosyl
FT                   transferase family 3; Glycosyl transferase, family 3-like;
FT                   Pyrimidine nucleoside phosphorylase domain; PRIAM:
FT                   Pyrimidine-nucleoside phosphorylase; SPTR: B9CM30
FT                   Pyrimidine-nucleoside phosphorylase; TIGRFAM:
FT                   pyrimidine-nucleoside phosphorylase; PFAM: Glycosyl
FT                   transferase family, a/b domain; Pyrimidine nucleoside
FT                   phosphorylase C-terminal domain; Glycosyl transferase
FT                   family, helical bundle domain; TIGRFAM:
FT                   pyrimidine-nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67328"
FT                   /db_xref="GOA:E1QY64"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY64"
FT                   /protein_id="ADK67328.1"
FT                   /translation="MRMYDVIEHKRNGGELSDEEIRFFVDGYSSGEIPDYQASALCMAI
FT                   YYQGMTERETASLTMDMVRSGDVVDLSGIDGVKVDKHSTGGVGDKTSLAVAPIVASLGV
FT                   RMAKMSGRGLGHTGGTLDKLESIPGLSCDIDGARFEEIVRTVGVAIVGQTGNLVPADKK
FT                   LYALRDVTATVDSLPLIASSIMSKKIAAGSDKILLDVKCGSGAFMKTVDDAIALAKSMV
FT                   SIGEHVGRTTVALITDMGRPLGNCIGNALEVSEAVATLRGEGPRDLTDVCVELAGNLLF
FT                   LAGRGELDACRLLARGQIANGEGLAKLKEMVAAQGGDASVLDDCASRLVEPRLSRELRA
FT                   TRDGHLFSMDTERCGMASVALGAGRARKEDAIDHSAGIVLAKKTGDSLVEGDLLATLFA
FT                   ADEGLLDEGERVFRDALDIRDEPPAAPPLFHARVSCEGVERTDA"
FT   gene            229952..231223
FT                   /locus_tag="Olsu_0197"
FT   CDS_pept        229952..231223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0197"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="InterPro IPR017896:IPR017900:IPR001450; KEGG:
FT                   apv:Apar_0185 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; SPTR: C2D7W3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67329"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY65"
FT                   /protein_id="ADK67329.1"
FT                   /translation="MADKRDMLDDLIDIQRDWRKVSNPLGDLARGLAADPSGVKTFNPA
FT                   DYKERPRANSVFCLDVASKRRDVCRRCLDVCPVDAIEIGESSVRVADGCRKCGLCTMVC
FT                   PTEALPVQRIMAKALYDKVARAAQIHERCYLTCTRALGRLPKDNEIVLPCVGAVPSELW
FT                   FSLLAEYDNVDVYLPLGICDRCRTTTGEEAYATQIARAEELTGASVGLEVEEGDLNHEQ
FT                   SRAYKRSQFMGQMVRAGQSLAATANPALGGIQAVARRIQQHSNQIYEMQRSLERTVGGK
FT                   TSGNRRRILTQKRKMMLTAIQHHPGLSRDLELRVPVCDPTLCTMCGACVTACPPHACDL
FT                   DERGHFSVEPAYCVNCGACATVCPEHALAMEPCDPQDLVIRDEEAERRRKAAERQRAQV
FT                   ALARERGRRRLEHGLDALERLADE"
FT   gene            231267..232328
FT                   /locus_tag="Olsu_0198"
FT   CDS_pept        231267..232328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0198"
FT                   /product="GTP-binding protein YchF"
FT                   /note="COGs: COG0012 GTPase probable translation factor;
FT                   InterProIPR012676:IPR004396:IPR012675:IPR006073:IPR
FT                   002917:IPR013029; KEGG: apv:Apar_0186 GTP-binding protein
FT                   YchF; PFAM: Protein of unknown function DUF933; GTP-binding
FT                   protein HSR1-related; SPTR: C2D7W2 GTP-binding protein;
FT                   TIGRFAM: GTP-binding protein YchF; PFAM: GTPase of unknown
FT                   function; Protein of unknown function (DUF933); TIGRFAM:
FT                   GTP-binding protein YchF"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67330"
FT                   /db_xref="GOA:E1QY66"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY66"
FT                   /protein_id="ADK67330.1"
FT                   /translation="MSLSIGIVGLPNVGKSTLFTALTKKGGLAANYPFATIDPNVGVVD
FT                   VPDERLQRLAEMANPAKVVPATVEFVDIAGLVKGANAGEGLGNQFLANIRNCDAICEVV
FT                   RYFKDPDVVHVDGRVDPASDADTIITELILADLGSLERSIPKLEKEAKRDKDNLPRLQI
FT                   ARRLQSWLDEGNRAATLDMTDDERAAAHDLFLLTMKPILYVANCDEDQLGDRPQIDGTP
FT                   AIPICAKVEAELSELEPEEASEYLESLGLERSGLETLAQAAYRLLGLQSFFTAGPKEVR
FT                   AWTVRIGAKAPEAAGVIHSDFERGFIKAETIGYDDYVSLGGEQGAKEAGRLRMEGKDYV
FT                   VQDGDVMVFRFNV"
FT   gene            complement(232385..233863)
FT                   /locus_tag="Olsu_0199"
FT   CDS_pept        complement(232385..233863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0199"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="COGs: COG1316 Transcriptional regulator; InterPro
FT                   IPR004474; KEGG: apv:Apar_0187 cell envelope-related
FT                   transcriptional attenuator; PFAM: cell envelope-related
FT                   transcriptional attenuator; SPTR: C2D7W0 Putative
FT                   uncharacterized protein; TIGRFAM: cell envelope-related
FT                   function transcriptional attenuator, LytR/CpsA family;
FT                   PFAM: Cell envelope-related transcriptional attenuator
FT                   domain; TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator common domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67331"
FT                   /db_xref="GOA:E1QY67"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY67"
FT                   /protein_id="ADK67331.1"
FT                   /translation="MALHRKHESMTREEQRARSAARHGLDRGAPSASDLSRGNALAYYG
FT                   SRRRRPRLSRGLRAALITVASVFLVSGIALAAYVAHINAKINGNVSSDLLSVLTDAQDN
FT                   EPFYALLLGIDKDEERAQGSEYGSDSSAYRTDTIILARVDPKNKKVTLVSIPRDTYVDM
FT                   EEHGRGKINSAYSFGGAAYATKVVSKLAGVPISHYAEVDMDGFAQVVDAVGGVTIDLPV
FT                   PVRDPEYTGLDLPAGEQTLDGQTAALLGRTRHAYDSYGGGDFYRAANQRMLIGAVVKKV
FT                   LASDPITMAGTVSTMAGHVTTDMDVSTMLSIASKFVGINVDEDIYSGQMPTESKYVNAT
FT                   WYEICDTAAWKSVMERVDQGLPPYADASQDSTAGIAGSVGVSAGGDGSSDATSSATEVA
FT                   ADYSGTVMVYNASGVAGIAGSAADKLTQRGYSAQADNASSRTDTSKVIYNGGAADKAQG
FT                   VIETLGLSVSARQNDGSYEKDADVIVVLGTDRAR"
FT   gene            complement(233931..235391)
FT                   /locus_tag="Olsu_0200"
FT   CDS_pept        complement(233931..235391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0200"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="COGs: COG1316 Transcriptional regulator; InterPro
FT                   IPR004474; KEGG: apv:Apar_0187 cell envelope-related
FT                   transcriptional attenuator; PFAM: cell envelope-related
FT                   transcriptional attenuator; SPTR: C2D7W0 Putative
FT                   uncharacterized protein; TIGRFAM: cell envelope-related
FT                   function transcriptional attenuator, LytR/CpsA family;
FT                   PFAM: Cell envelope-related transcriptional attenuator
FT                   domain; TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator common domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67332"
FT                   /db_xref="GOA:E1QY68"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY68"
FT                   /protein_id="ADK67332.1"
FT                   /translation="MARKHMSGEDLASDAERLSRARAAKHYAQANLKRRHRRRRIVGAI
FT                   VGVFAALLLGAGGAAWAYINNINQRLGSNIDPKLRQTLESATAQDPGDPFYMLLLGIDK
FT                   DEGRAEGSEYGSSDSAYRSDSIMLVRVDPKNKKATLVSIHRDTLVDLGEHGKQKINAAY
FT                   SIGGAAYATEVISQFAGVPISHYAEVDMDGMAAVVNAVGGVTVDLPVPVRDPGYTGLDL
FT                   PAGEQTLDGQTAALLCRARHAYDSYGDGDVYRAANQRSVIAAVVKKVLGSDLATMTATV
FT                   SAMADMVNTDMNVSSILSLATQFSGMDADTDILTGMAPTTSRYQNDTWYELCDTNAWRA
FT                   MMERVDQGLSPYEDASSDLSSGVSAQSADQTSTEKAPTSDSSASPTGEAADGDKAVLKG
FT                   TVTVVNASTTDGVAGDAATRLSGVGFTASAQSAGVVSETTHVYYNGDGKAAARGVVQTL
FT                   GLGVTAEPNDGTQPTGTDVVVVLGTDTN"
FT   gene            235733..237322
FT                   /locus_tag="Olsu_0201"
FT   CDS_pept        235733..237322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0201"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /note="COGs: COG0519 GMP synthase PP-ATPase domain/subunit;
FT                   InterProIPR004739:IPR001674:IPR017926:IPR014729:IPR
FT                   011702:IPR001317:IPR000991:IPR018318; KEGG: apv:Apar_0189
FT                   GMP synthase, large subunit; PFAM: GMP synthase domain
FT                   protein; glutamine amidotransferase class-I; tRNA methyl
FT                   transferase-like; SPTR: C8W937 GMP synthase, large subunit;
FT                   TIGRFAM: GMP synthase, large subunit; GMP synthase, small
FT                   subunit; PFAM: Glutamine amidotransferase class-I; GMP
FT                   synthase C terminal domain; NAD synthase; TIGRFAM: GMP
FT                   synthase (glutamine-hydrolyzing), C-terminal domain or B
FT                   subunit; GMP synthase (glutamine-hydrolyzing), N-terminal
FT                   domain or A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67333"
FT                   /db_xref="GOA:E1QY69"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY69"
FT                   /protein_id="ADK67333.1"
FT                   /translation="MQTSRPQQFVAVFDFGAQYGQLIARRVRDLNVYSEMVPCDISADE
FT                   LAAMAPAAIILSGGPASVYADDAPDMDGRIFELGVPILGFCYGQQIMAVKLGGKVGHTE
FT                   KGEYGPAELCRCGESRILAGTPGSQTVWMSHRDAVSDVPAGFSVTSTTETCPIASMEDA
FT                   SRRFYATQFHPEVRHTACGQAMLENFLFGICGLGRSWTMDNIIDEKVAEIREQVGGRKV
FT                   ILALSGGVDSSVVAALVHRAIGDQLTCVFVNHGLLRKGEPEMVEEVFREQFNVPLVHVH
FT                   AEERYLRLLAGVSDPEQKRRLIGGEFWKVFFEEAQKIGDVEMLAQGTIYPDIIESGARK
FT                   TGGKASTIKSHHNLIPFPEGVRFDLIEPLDHFFKDEVRALGIALGLPAKMVWRQPFPGP
FT                   GLAIRIIGEVTSEKLDMLREADAVVREELDAYNGRLFEETGDRNSEHSCWQYFAVLPDI
FT                   RSVGVMGDERTYARPVIVRAVESSDAMTADWAKLPYEVLGKISSRIVGEVDGVNRVVYD
FT                   VTPKPPATIEWE"
FT   gene            237702..238352
FT                   /locus_tag="Olsu_0202"
FT   CDS_pept        237702..238352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0202"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apv:Apar_0204 hypothetical protein; SPTR:
FT                   C8NHA7 50S ribosomal protein L31 type B"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67334"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY70"
FT                   /protein_id="ADK67334.1"
FT                   /translation="MMFNTAESVLIVEAGNTGKFSKLLYNMIGKNDDTEAGPTGPVDGS
FT                   VDASIFNEDQFAQTAISSSQKVVFIGWPEGAGDYIDAIRLDNPEAIDEEGVYIGVSGNH
FT                   ACITVNTEPPSKEDYWKFLERAREHGMEFDDLLAALRPEEEAAEPEESNDSNPVLGFAK
FT                   MVGKTIGRAAADGANGINQAVVLHQKAGEIREQRYQYAVKRFYYEKLKGFVEA"
FT   gene            238355..239887
FT                   /locus_tag="Olsu_0203"
FT   CDS_pept        238355..239887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0203"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apv:Apar_0205 hypothetical protein; SPTR:
FT                   C8NHA6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67335"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY71"
FT                   /protein_id="ADK67335.1"
FT                   /translation="MNDFDKGFEFSARHAAAVPAGMDATSWVNSVEAAIEELYSAMDSY
FT                   DHYKNSKAAQDSLKGFLAEEWAFGTANVDAAVKRVDAKGIRLDSHDLGSADVAWGADQY
FT                   QLKFLTDPKNIARKLATTLRDSYNGRPKRYADLSFDEWAVEKGFAGKTPDDLLYGDMGG
FT                   LIPSDKLEAAKQYTLMRIECAKGRGLDEEVRRWTKVRDNLTDRIKTPEGVEGRPATNEE
FT                   MRRKAADVSSKKKLDPADDGMTTSQLIAASDIVKQSLKAGGTAAALSAALSVAPEIYRA
FT                   IDYLIAEGEIDDEHLKSIGTAACAGAANGFVSGSATAAITAAAAKGTFGETVKAAAMGS
FT                   RGANVIASLVVLTMETCRNSYLVASGQIEPVEMANNMGQSVFSTVMMLGGAAVATALTG
FT                   GATFPVLIGSFVGGAAGSMAFKPVSSCVMKVCVDSGVTFFGLVEQDYEVPKHLLSMLGI
FT                   KGANIKTANIKMAGVSTAPRFSTPSVKTASLHTANVAFFERGLVGVNKVAYS"
FT   gene            240401..241129
FT                   /locus_tag="Olsu_0204"
FT   CDS_pept        240401..241129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0204"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bad:BAD_1141 phosphate ABC transporter; SPTR:
FT                   A7A8T0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67336"
FT                   /db_xref="GOA:E1QY72"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY72"
FT                   /protein_id="ADK67336.1"
FT                   /translation="MEQDKHEEGVRHRSASEHDERQGQSLEEAAQKEKGRGKSVFGFFG
FT                   KLSLKAKLAVFAVAAVIAIGFFGFALPWMTDNHETQYLATSDLKSAVDIDSLSTIDYTY
FT                   HGIAEKHGKFLWQDRVDYRVKYEAHIRASYTLSDIQFGINEEDKVVTAYLPEAQIGDPQ
FT                   LDNSKFGYLPESATADMKDVIALCREDAANDVDKEEIKEQAEASLKDTVKALTLPLLGD
FT                   EYQLEFKPIAEYNEGADLNA"
FT   gene            241122..241706
FT                   /locus_tag="Olsu_0205"
FT   CDS_pept        241122..241706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bad:BAD_1140 hypothetical protein; SPTR:
FT                   A7A8S9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67337"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY73"
FT                   /protein_id="ADK67337.1"
FT                   /translation="MRKPWLACLALAAALSLSALSGCAKSSETPDFSGYTEIAELATVE
FT                   CTFHNVAEVYNDGTNMLFGINVGYKKAWFEYDGTVQLGVDVSKVRIDGPDANNVVTITV
FT                   PNAQVIGQPQADESTFSDIHSDTGLLTPITTVDQSIALEEAQKEMKESAEANSTLMNGA
FT                   RERAKTLLSQYVTKIGDLQGVKYEVQFKDAE"
FT   sig_peptide     241122..241199
FT                   /locus_tag="Olsu_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            242516..243115
FT                   /locus_tag="Olsu_0206"
FT   CDS_pept        242516..243115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ccu:Ccur_13950 hypothetical protein; SPTR:
FT                   C7MLC2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67338"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY74"
FT                   /protein_id="ADK67338.1"
FT                   /translation="MRGEKTDTLLDIATSCNGYVTSAQATDAGIPRRKLTDAVSAGKLV
FT                   RVDRGLYALPDVWEDPLYITQRRFSRGVFSDDTALFLHGMTDRAPFAPTMTFPRSYNAT
FT                   AARAAGIICRTCADDVLDLGLCDVKTEYGNAVRAYDVERTLCDLVRGQGTPDAQLVTPA
FT                   MKSYVRSKICDPMKLVEYARALGVEAKIRNYLEVLL"
FT   gene            243112..243954
FT                   /locus_tag="Olsu_0207"
FT   CDS_pept        243112..243954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0207"
FT                   /product="Domain of unknown function DUF1814"
FT                   /note="InterPro IPR014942; KEGG: apr:Apre_0680 domain of
FT                   unknown function DUF1814; PFAM: Domain of unknown function
FT                   DUF1814; SPTR: B1C0W0 Putative uncharacterized protein;
FT                   PFAM: Domain of unknown function (DUF1814)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67339"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY75"
FT                   /protein_id="ADK67339.1"
FT                   /translation="MRTKNAMQLKARINARAKNVGISAQSMMQNYLFERFLERLSKSKW
FT                   RSNVVIKGGMLISSLVGVASRTTMDLDTTITGFTLTHESAEKVFREVAAVSVDDDWSFE
FT                   FDRTEDIREADDYPGIRIHLKAIYPPMSVPLMIDVTTGDSIIPGPIAYNYPLLFDEGNV
FT                   RLMSYPLETVLAEKLETVVSRGVTNTRPRDFYDIHLLWRTKGDSCVISTLYEALEATCA
FT                   KRGSAERMKRWQVVLDEVSADQTMLALWGKYMKKNPYASGIELAQCCETARKILGAAI"
FT   gene            243951..244592
FT                   /locus_tag="Olsu_0208"
FT   CDS_pept        243951..244592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0208"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eel:EUBELI_01741 hypothetical protein; SPTR:
FT                   C4Z3E1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67340"
FT                   /db_xref="GOA:E1QY76"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY76"
FT                   /protein_id="ADK67340.1"
FT                   /translation="MSGSGQIDYLNEERNRNPQLWPIIKGLLALLVIVLIAACGTAVLI
FT                   NLAGPGVAAFFASLSTLDSAIVVALITATVSVITYVSGNVASNIMKRNEYLRMHREKPY
FT                   MQLISMFYDFQSQTKTGKEFTQEELINLFNQFTKELTLWGSSKAIKAWGNWRVASSRGH
FT                   NDPNDLLFGMEKVLIQLRKDMGLKRGIAEGDLLRLTVNDIDDYIGQNRRD"
FT   sig_peptide     243951..244109
FT                   /locus_tag="Olsu_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            245591..247153
FT                   /locus_tag="Olsu_0209"
FT   CDS_pept        245591..247153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3593 ATP-dependent endonuclease of the OLD
FT                   family; KEGG: cha:CHAB381_0630 hypothetical protein; SPTR:
FT                   A7I126 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67341"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY77"
FT                   /protein_id="ADK67341.1"
FT                   /translation="MKIRSVEITNFRGYASETEVAMDDLTVFVGKNDIGKSSVLEALDI
FT                   FFNDGKGAVKFDKSDINVENQKGGDQEASIAVVFADLPDEIVIDTTAKTNLKDSYLLNG
FT                   EDKLEIVKKYKGTGAPKVYIKALHPTNSGCCDLLLKKNADLKKLVKQYKLEEEVDTKSN
FT                   VSMRAALWSHFSDDLKLQEIEIDISKEDAKAIWSKLSTYMPVYSLFQADRENSDSDSEV
FT                   QDPLKESVKEVLNDLALKEELDEVAQKVREKLQEVANRTVDKLKEVDPEVASSLDPVIP
FT                   ATESLKWADVFKNVSITGDGDIPINKRGSGTKRLILLSFFRAEAERRLAESETNGVIYA
FT                   IEEPETAQHTENQKKLIEALQELSKIDGVQVILTTHSPYIVKHLEFENLRLIAKGNNPG
FT                   DRKISKVLPGQLRYPSLNEVNFIAFNESTEEYHDELYGAIEENEWLGEYKSNKQLVPYK
FT                   KVWKGSVMPMEIPLTEYIRHQIHHPENKENERYTLEQLHESICMMRDFIKQKRSESDEE
FT                   SAE"
FT   gene            247778..247990
FT                   /locus_tag="Olsu_0210"
FT   CDS_pept        247778..247990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0210"
FT                   /product="prevent-host-death family protein"
FT                   /note="InterPro IPR006442; KEGG: ccu:Ccur_13030
FT                   hypothetical protein; SPTR: A7BET3 Putative uncharacterized
FT                   protein; TIGRFAM: prevent-host-death family protein; PFAM:
FT                   Phd_YefM; TIGRFAM: prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67342"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY78"
FT                   /protein_id="ADK67342.1"
FT                   /translation="MTALTMGLSEAKNNFSRVTAEVNRTGKSVTILKNNKPWVVIQPAR
FT                   ENSNATDVAVDFMDEYADVFEELAK"
FT   gene            247987..248369
FT                   /pseudo
FT                   /locus_tag="Olsu_0211"
FT   gene            248788..249942
FT                   /locus_tag="Olsu_0212"
FT   CDS_pept        248788..249942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0212"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP3815 hypothetical protein; SPTR: B6XTN6
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67343"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY79"
FT                   /protein_id="ADK67343.1"
FT                   /translation="MAKTTNKTSSLTSEEILGRFVVRARRVEDHSLVKNGDIERYATPR
FT                   MTFSVTETGSASTQHHVCTDEKAIESLATRLRPFIVRSEPIYLPKILDAICAQAPGEAL
FT                   SENEAEVLETTKSWFSHRYEKKDSERYGVQLIGRDGELLTSLLSDALLAEAWIYTDAVH
FT                   ADPKGEKAEAQKLSYSDRYRAASSYSCEFASVIVNLLNLVRSLSERSLLQVPDSAWTEP
FT                   ASYAEADKNDQEQIAAGSAYVFPIGTEIPAGANPEDIPGARKATPAVMLRLQHPESSAT
FT                   VISFDISQKHASCYEAIYSSKDGFLVFCIDEIGKLMISKEAMAQGGGPVGSISFAASES
FT                   HQSEAHDFLASIAPPNIFGLKFIFEGKPIFALLQPSKRIAATTK"
FT   gene            250678..251139
FT                   /locus_tag="Olsu_0213"
FT   CDS_pept        250678..251139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0213"
FT                   /product="putative flavodoxin"
FT                   /note="InterPro IPR001226; KEGG: apr:Apre_0423 putative
FT                   flavodoxin; SPTR: C7RG60 Putative flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67344"
FT                   /db_xref="GOA:E1QY80"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY80"
FT                   /protein_id="ADK67344.1"
FT                   /translation="MKALVVYYSYSGITRRLAEDIALITDGELRELKPQKPYSFSYNTA
FT                   VKEAREEIEKGYCPPLAEGVEPVEGAEVIFIGSPNWLKTFAPPVLTFLKTVDLSGRTII
FT                   PFCTHGGGGFGRMIEDYKKECRNSIIKEGIALKGDYSFDELQSWLNNNL"
FT   gene            251398..251682
FT                   /pseudo
FT                   /locus_tag="Olsu_0214"
FT   gene            complement(251670..251894)
FT                   /locus_tag="Olsu_0215"
FT   CDS_pept        complement(251670..251894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0215"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce5042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67345"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY81"
FT                   /protein_id="ADK67345.1"
FT                   /translation="MRRFSRGGLLVNVESNAPLIKVFISHTFHPIASLFHIDGLLAVRP
FT                   ERLLQPQIQLERAFASDGHRLGSSILDFR"
FT   gene            complement(251894..252325)
FT                   /locus_tag="Olsu_0216"
FT   CDS_pept        complement(251894..252325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: det:DET1117 hypothetical protein; SPTR: C6LJW5
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67346"
FT                   /db_xref="InterPro:IPR023811"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY82"
FT                   /protein_id="ADK67346.1"
FT                   /translation="MQYKCKVTVLKTKVFPDLQEKYLANPQSGPCPCFEAGQVFTFERT
FT                   PENDSFYRLGKGTLAGGGDFPCGEAWDAISRYVYTALQGGSIMHRWTNDERMMIACCND
FT                   GTRPVIFKIERIDVPETPEEESWLASQDFANRADEAYTG"
FT   gene            complement(253083..254042)
FT                   /locus_tag="Olsu_0217"
FT   CDS_pept        complement(253083..254042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0217"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG2207 AraC-type DNA-binding
FT                   domain-containing protein;
FT                   InterProIPR009057:IPR018060:IPR012287:IPR020449:IPR
FT                   018062:IPR000005; KEGG: ele:Elen_0328 transcriptional
FT                   regulator, AraC family; PFAM: helix-turn-helix- domain
FT                   containing protein AraC type; SMART: Helix-turn-helix, AraC
FT                   domain; SPTR: C8WKL2 Transcriptional regulator, AraC
FT                   family; PFAM: Bacterial regulatory helix-turn-helix
FT                   proteins, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67347"
FT                   /db_xref="GOA:E1QY83"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY83"
FT                   /protein_id="ADK67347.1"
FT                   /translation="MEKAFQEKMLGDTGFSPVPSPDGFEELWRSYRSGQGACRGWFHFL
FT                   SPQEADWSISIHDFVMDDDFVMSSETSDYLTITCFKSISGEEFNPYRKLRPNSLWGQSF
FT                   KGEPWKGIAHAGIPVQSISIEVSHEFSRRFLEKEYPGGFASVEEAFVSLGNDGEHLELK
FT                   ALLAKLWPVPGGQSHSALYYEGKVLEAMGLIVEGTRQPRASTRKPVSSSDWARIQDVVR
FT                   YIDDHCSSVLRIADLSAIACMSPTKFKETFKKANGKTVTGYVQERRMSQAELLLRQPDL
FT                   TIEQIARSVGYTCTSRFSELFRREVGMLPSEYRKTLRP"
FT   gene            254187..254804
FT                   /locus_tag="Olsu_0218"
FT   CDS_pept        254187..254804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011733; KEGG: ele:Elen_0329 hypothetical
FT                   protein; PFAM: Conserved hypothetical CHP02185 integral
FT                   membrane family protein; SPTR: C8WKL3 Putative
FT                   uncharacterized protein; TIGRFAM: conserved hypothetical
FT                   protein; PFAM: Hypothetical bacterial integral membrane
FT                   protein (Trep_Strep); TIGRFAM: conserved hypothetical
FT                   integral membrane protein TIGR02185"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67348"
FT                   /db_xref="GOA:E1QY84"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY84"
FT                   /protein_id="ADK67348.1"
FT                   /translation="MGQQETAGKGTGRLAARDLVTVGIFTALYLVFMMVGGAFFAPNPV
FT                   LTFWMPAAVALLTGPIYLLLIAKVPKHGPLIVVGVVEGLLLFATGMYWGWAVACVVLGI
FT                   AADIIAGIGRFRSKALNFTAFVVYSLSPMGSYLMLWANPTGYASYLVGKGAEQAYMDTM
FT                   MSTATDWMLPAMVLATVACAIISGLLGMRLLHRQFEKAGITA"
FT   sig_peptide     254187..254300
FT                   /locus_tag="Olsu_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            254815..255570
FT                   /locus_tag="Olsu_0219"
FT   CDS_pept        254815..255570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0219"
FT                   /product="cobalt transport protein"
FT                   /note="COGs: COG0619 ABC-type cobalt transport system
FT                   permease component CbiQ and related transporter; InterPro
FT                   IPR003339; KEGG: ele:Elen_0330 cobalt transport protein;
FT                   PFAM: cobalt transport protein; SPTR: C8WKL4 Cobalt
FT                   transport protein; PFAM: Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67349"
FT                   /db_xref="GOA:E1QY85"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY85"
FT                   /protein_id="ADK67349.1"
FT                   /translation="MPKTRKIPGASLRRDGTPGRGVRLDPRAKLASIAAMAVAVALAPN
FT                   MLCDFALMGFAFAFGSMLGQLRVSAAMLVLYALFITLAQFVPYLDDVGLRTMFSSFLLL
FT                   MRKVFACGLMAYATVKTTHIDEFMSALTRMRVPRAVTIPLAVALRYVPTVREDWGFIKD
FT                   AMRMRGISPSPLGFIQAPMRTIDCIYVPLLMSASRAADELSMAAVARGIENPVARTCYL
FT                   HIELRRADLLTFAASLAVVASMLVIRAGA"
FT   sig_peptide     254815..254988
FT                   /locus_tag="Olsu_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            255567..257063
FT                   /locus_tag="Olsu_0220"
FT   CDS_pept        255567..257063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0220"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1123 ATPase components of various ABC-type
FT                   transport systems contain duplicated ATPase; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: ele:Elen_0331 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: C8WKL5 ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67350"
FT                   /db_xref="GOA:E1QY86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY86"
FT                   /protein_id="ADK67350.1"
FT                   /translation="MISFRHVSFSYGTSPAADNAGVRDVSLSVAPGEVVVLCGRSGCGK
FT                   STLLRLANGLVPRFFPGEKTGHVMLDGTDVDDLATWEIAQRTGSLFQNPHTQFFNVETT
FT                   GEVAFGLESAGWPEGKIRPRVSETFEELGLSTLADRSIFELSGGERQKIAYASIWAQHP
FT                   ANLLLDEPTSNLDLTSIDAMTAFVGHAKERGCAILVAEHRLSWLANIADRYVYLEKGSV
FT                   GRVMEAAEFASLDAREVERMGLRARSTGEIAPRANPSVNTDSPRAGDALLATRALSVSY
FT                   GAAPVLRGAALELRAGEIAALVGRNGAGKTTLCRVLCGFERRTRGEILLNGTTAARRER
FT                   VRVSSMVFQDVNYQLFAESATEEVTFGLPRRKAESVDVARVLSELDLVALGDRHPATLS
FT                   GGQKQRLAVAACVAAGKRVLVFDEPTSGLDLDGMRRIARLLRRLADQSRALLVVTHDLE
FT                   LVACACDRVLCVEDGALRAPLATAEQFDAVKALMGSVVSR"
FT   gene            257075..258850
FT                   /locus_tag="Olsu_0221"
FT   CDS_pept        257075..258850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0221"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components;
FT                   InterProIPR011527:IPR003439:IPR017940:IPR003593:IPR
FT                   017871:IPR001140; KEGG: ele:Elen_0338 ABC transporter
FT                   related; PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; SPTR: C8WKM2 ABC
FT                   transporter related; PFAM: ABC transporter; ABC transporter
FT                   transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67351"
FT                   /db_xref="GOA:E1QY87"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY87"
FT                   /protein_id="ADK67351.1"
FT                   /translation="MEIRRGADPVALVFAWAGRHRRYLVASVVCATLSGLLVAVPYLAV
FT                   FDVMSAVYGGTATADAIAVDVAILAVGIALRFVLFAFAGTLSHKGAYGTLFDVRCRILE
FT                   RLSKAPLGEMDERSTGKIKTVLSDDVENLELLLAHNLPEALMYGAGPVATFAFLLFANV
FT                   PLALATLIPAIAALAVLVSLFKVMSSIMGRATKSLEDMNSVMAEYVSGMRTVRALDMGT
FT                   RSFGRFRKAVDEENAVWCEISRKTGPGFASYVIIIEAGLLIMVPAGAFMLTNGAIDVST
FT                   YLLFAFVGSLYLTEIRLLQSFANKLSQVSASAERVQELLDIPVFGGGVPFPDDASIRLD
FT                   GVSFSYADDAPEVLHDVSLDVAVGERIAIVGASGSGKSTLIQLIGRFYDVTSGSVSIGG
FT                   IDVRRIDYDDLLAHVSAVFQKTFLASGTILENIRMGSDATLDEVRAAARRAQADDFIQA
FT                   LPQGYDTRMGTLGGRLSGGERQRIAIARAILKDAPILILDEATSAADPENQVLIDRAID
FT                   NLCEGKTVLVVAHRLDVVDGCDAVAVMEDGRITCMGPHDAVLETSSYYRSAWAAWTRSR
FT                   SMSYRIGEKEGRHVR"
FT   gene            258840..260561
FT                   /locus_tag="Olsu_0222"
FT   CDS_pept        258840..260561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0222"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components;
FT                   InterProIPR011527:IPR003439:IPR017940:IPR003593:IPR 017871;
FT                   KEGG: ele:Elen_0338 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: C8WKM2 ABC
FT                   transporter related; PFAM: ABC transporter; ABC transporter
FT                   transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67352"
FT                   /db_xref="GOA:E1QY88"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY88"
FT                   /protein_id="ADK67352.1"
FT                   /translation="MSDKARDAARNPFAKNRDFYLSCICTIAEGLLGGANFVLIWMVMH
FT                   QVFAGAVELAALLQITGMLVVVFAARLAIYRFGYVRGQVGGAHVSHDLRIALGDAIKHI
FT                   PLSHFAKRSSGQYLQALTVNVNDYEQILTHRTGDIVRGAVLATTVCAFTFWLYAPAGIV
FT                   IACSFLSLVPAVALSWRQVRAFGPRKDEVRASSSSAIMEHVDGMQTLRAYGVAGVHNRS
FT                   IVESMRAFSHVSYVYERAIIPVGAVWSIFAGLAQPLLVWMCYSAWTAGTLPVESFLLIA
FT                   MLPLFTLKLGSALFIDLTAYRNLEIARRNIASVLEEPEETGSFDDMPMQGTGIELAHVG
FT                   FSYGDGPAVLEDFDLTIPEGRLTALVGDSGCGKSTVLNLVAQLYRPQSGTVSFGGVDAS
FT                   GFAPESVLRNVALVDQDVFLFDDSVMDNVRYARPSASDEDVHEACRLANADAFVQALPQ
FT                   GYDTRIGERGGKLSGGERQRLSIARAILRDAPIVLLDEATSNLDIENELAVREAVANLL
FT                   AHRKTVVMVAHTLPIVRTADQIAVIDGGRVAELGCHDELMVLGGKYARMWAASSNG"
FT   gene            complement(260562..262079)
FT                   /locus_tag="Olsu_0223"
FT   CDS_pept        complement(260562..262079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0223"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1123 ATPase components of various ABC-type
FT                   transport systems contain duplicated ATPase; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: dhd:Dhaf_1767 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: C8PTX7 Putative ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67353"
FT                   /db_xref="GOA:E1QY89"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY89"
FT                   /protein_id="ADK67353.1"
FT                   /translation="MEESAVSLADVTFSYRGAGVPSLSSLSLDVAAGECVLLCGKSGCG
FT                   KSTVLRLLNGMIPEFYDGEASGKVEVAGMDPASCPQYEIARSVGTVFQNPRTQFYTLNT
FT                   TSEVAFGCENQGLERAEIVRRVGNAAEELGIESLMNRSIFQLSGGEKQRLAVASVYASD
FT                   PDVFLLDEPSANLDFPAIRELQRILSLLKAKGKTILVAEHRTWYLEGIADRAVYLDGGR
FT                   VAGSYAMEELAGLTREQRLETGIRPVRLDAFDIPRTSAPTEPPCSCEIHLRDLAFSYSR
FT                   RSECSLSVGDARFGAGHIEMIVGDNGAGKSTLASVICGLAKERRGTIAIGGASTKARKR
FT                   LPISYEVMQEVNHQLFCDSVEDEVVLGAARPDASALESVLDRMDLRDVRDRHPLTLSGG
FT                   QKQRCAIAAAVFCGKRVIAFDEPTSGLDYAHMAQTAELLRELAGTGIFVLVVTHDYELA
FT                   RIIGDRVTEMRGGGVAGQYDLDEEGVLRLRTFFGIGSPFSCRREGGI"
FT   sig_peptide     complement(261984..262079)
FT                   /locus_tag="Olsu_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(262085..262837)
FT                   /locus_tag="Olsu_0224"
FT   CDS_pept        complement(262085..262837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0224"
FT                   /product="cobalt transport protein"
FT                   /note="COGs: COG0619 ABC-type cobalt transport system
FT                   permease component CbiQ and related transporter; InterPro
FT                   IPR003339; KEGG: ele:Elen_0330 cobalt transport protein;
FT                   PFAM: cobalt transport protein; SPTR: C8PTX6 Putative
FT                   transporter; PFAM: Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67354"
FT                   /db_xref="GOA:E1QY90"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY90"
FT                   /protein_id="ADK67354.1"
FT                   /translation="MSVLDRIYGKRREHQGLRFDPRTKLALLVLLDIAVFLGRSLPYEC
FT                   AVFLICALLVAVGGMAGVSFRSCVAFALLVALQHVIGPVMGQSLALSLAQFLAVAVRKV
FT                   LPCVLVAYWVVETTGVGEFSAALWKSRVPRNAIVTTSVIFRCFPTIGEEWRAIRSAMKM
FT                   RGIGTGPSAWIVHPVRTLVCLYVPLFASVATISDELAAAALCRGLDDPGPHTSLSEIGF
FT                   HAQDRIVLALVAAGVLVVTAFALAGKGF"
FT   gene            complement(262834..263430)
FT                   /locus_tag="Olsu_0225"
FT   CDS_pept        complement(262834..263430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011733; KEGG: cbe:Cbei_3098 hypothetical
FT                   protein; PFAM: Conserved hypothetical CHP02185 integral
FT                   membrane family protein; SPTR: C8PTX5 Conserved
FT                   hypothetical integral membrane protein TIGR02185; TIGRFAM:
FT                   conserved hypothetical protein; PFAM: Hypothetical
FT                   bacterial integral membrane protein (Trep_Strep); TIGRFAM:
FT                   conserved hypothetical integral membrane protein TIGR02185"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67355"
FT                   /db_xref="GOA:E1QY91"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY91"
FT                   /protein_id="ADK67355.1"
FT                   /translation="MDSQKKHSSSRGAISAGVFIALYLAVYVIIGVACMPVPILFLLMP
FT                   ELVALVAAPVYHTMLSKSPSGTPIFIAAILPSLILIASGHIPIAPLVSVPVGIAAVLIA
FT                   RKGQYKSFRWNAASHAVFSWNLLGGFVPIWFMRDYFFQDTFERGMSADFCDTLYALTPD
FT                   WMFLAMMLAIVVFSLAGSLIARKLLAGRLESAGIL"
FT   gene            complement(263666..264268)
FT                   /locus_tag="Olsu_0226"
FT   CDS_pept        complement(263666..264268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0226"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="COGs: COG1309 Transcriptional regulator; InterPro
FT                   IPR009057:IPR001647:IPR012287; KEGG: dtu:Dtur_0355
FT                   transcriptional regulator, TetR family; PFAM: regulatory
FT                   protein TetR; SPTR: C8PTX3 Transcriptional regulator, TetR
FT                   family; PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67356"
FT                   /db_xref="GOA:E1QY92"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY92"
FT                   /protein_id="ADK67356.1"
FT                   /translation="MKRNSKKPAERRKELVDAAAHLFAEKGYENASVRDILDAVGGAPG
FT                   MFYYYFKSKQDIYVAVMEDFISERMSRKCEIMEDDERSFDERISVLRSLVEDDVDEYVR
FT                   SFDPEPGESVPDASYKLWDMVQMLDRMAGPYAKLMLEGVRTEKIKNRLGVNEESAEACA
FT                   LFVLYGLWGVMYNGRFAPECGQHSPEEAFEIAQELFH"
FT   gene            264471..265427
FT                   /locus_tag="Olsu_0227"
FT   CDS_pept        264471..265427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0227"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="COGs: COG3177 conserved hypothetical protein;
FT                   InterPro IPR003812; KEGG: ele:Elen_1397 filamentation
FT                   induced by cAMP protein Fic; PFAM: filamentation induced by
FT                   cAMP protein Fic; SPTR: C8WGX5 Filamentation induced by
FT                   cAMP protein Fic; PFAM: IclR helix-turn-helix domain;
FT                   Fic/DOC family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67357"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY93"
FT                   /protein_id="ADK67357.1"
FT                   /translation="MPYEPPFERNDAIDTLCMEIAELVGMLSPQAPLAKSPTLHRELRI
FT                   KTIRSSLMIEGNKLDEKTVTAIIDGKRVLGDIHDILEVENAKRAYDLIPELNPHSIDDL
FT                   LRAHRTMMDGLVSEAGRFRGGNVGVFDGDALIHAGTPAAYVPEVMADIFGWLEETSMHP
FT                   LLASCVFHFEFEFCHPFSDGNGRTGRLWHTLLLSKWRPALAWLPIESTIRRRQAGYYEA
FT                   LAKSDAIGSSERFVEFMLEVIRDSILPFSKPANERELTRARVLDFFREHGGGNISQLAE
FT                   NLGCSKRSAERIVAELKEEGVLSRQGSPRSGIWVVGE"
FT   gene            265470..265745
FT                   /pseudo
FT                   /locus_tag="Olsu_0228"
FT   gene            complement(265832..272860)
FT                   /locus_tag="Olsu_0229"
FT   CDS_pept        complement(265832..272860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0229"
FT                   /product="OstA family protein"
FT                   /note="InterPro IPR006626:IPR001412:IPR005653; KEGG:
FT                   mmw:Mmwyl1_0481 filamentous haemagglutinin outer membrane
FT                   protein; PFAM: OstA family protein; SPTR: B7CDR1 Putative
FT                   uncharacterized protein (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67358"
FT                   /db_xref="GOA:E1QY94"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR041286"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY94"
FT                   /protein_id="ADK67358.1"
FT                   /translation="MQLIKMGRAVVFAALLSLFMVAVSPNMALASDVTIDFDDTDKDYT
FT                   ADNPSDVYYVKGESHDHNLTVKGGTEDDPIVVHLQNLLLDMSDEDKSAVNVESGSYAKI
FT                   MLDDGCTATLKGGAKHGFAIDDYGRAALRTAGSHVTITGPGTLNAHGRDDSKSGTSGSD
FT                   GGAGIGGSHNEGCGTLAISDVDGAPTINAHGSGQAAAIGTGDDYKSGNDDAHWDENDCI
FT                   AITGGTVDADVPEKDGAAIGTGRDSDLGSIKITGAPIVTAKTTHEDAAAIGAAYKGSVG
FT                   SIEIDITGGSITATAEGDDSAGIGTSDGSPKDDGRVGSISITTSGTASVTARAHEEAAG
FT                   IGLTVGAELGTITVSAKGESTISAYGGESGAGIGGAAGNYPTGKSPIKISTADSATINA
FT                   QGGENGAGIGSGNGESGEIEIAMDGGTINAKGTNDGAGIGSGNDESGAISISGTGTINA
FT                   EGDDYASGIGSADAESAGAITIEGAAGGRKLIVNATSYRNSGNDHPDCCAAIGGGSGDV
FT                   GDITLKNATITATPSTHAAAIGTAEHGDIGTITIDNCDIKTQERDKDGYAITNGKGRQV
FT                   GIGATGQRSDVGSIVISDTDYVGTCIGVGYHGDVRTITITDSNITATPVQPVLAKNDEG
FT                   EAATGIGAGLEGSAGSISITGSTVVANGISGGPGIGNGGALNEAATDITAIHNGSTGSI
FT                   VIDDSTVTATGSVGGESKVQAPPPNEGIWVYYIAASPGIGCGGNSHVDKIAIKGSTVTS
FT                   TAGSDKYKGAAGIGAGSFANCGPIEISDSTVVATGKHTGAGIGSGGIDTRMLEVYDVSE
FT                   GIANIIKTAGIKTSTISIADSNVTAHGGSYGGAGIGGARNGSVDGDITIADSVVDAKGG
FT                   GDGAGIGASRRETAVTGSLYMDHTIAISGASQVTATGGDRSAGIGGSFGAAVRAIDISL
FT                   ATIQDPEVPSNHGFTNFVKATGGKGAAGIGSGAATEGAVQPGSEGVSVAVSGGYVYAKG
FT                   GGSGAGAAGAGPGIGVGAARSGKSHSDRINGFTVIGGYVEAVAGGSGADDIGCGVGTEN
FT                   KGTGVWNVTGGTILADTWNVDTPIIDGGSISAQLTGAKNSADERVYQTTLKAIAPNVPV
FT                   DPDGIATVARYGTNDMYSHFDSSRVWPYLPASDVGAQHVTLYYSRFGDGIPESEYFWGT
FT                   TKTDGSGWLKTGGTAEFIPPSKKITVGNPFTLSLDDASLGDTGWTFTSTGAASVAGAAS
FT                   TASPGASVDMTATAAGPYTVTAESTTADQDDERYWNHKATYTGNVEAIDTFISFMNSPS
FT                   KTYDGQPAAHPEVYTNSPGDVSLRYKGHTASGKTYNAVVPPTEAGDYTVTAKVAASGCY
FT                   SEASISEDFVISPAPTAVVLTAHESGAASAVTATVSGLHEAAGSVTFTVEGSSETRVVD
FT                   VAAGPDNTYTAQFTVENVPAGTYKISATFASPNYVTSQTERTFDKEKSVRTLDVDSPYG
FT                   KTYGDADFKLSAQAVPATDHDVWTYEVVDDGKEAVVAVDDEGNVSIKHAGHALVKVTLT
FT                   DGTDGLYEPAEAIVEISVAKKAITVASQLMDEAGSTPQASVVYGSIPTDPSRYVLSIGN
FT                   ATDAEAARIRDALAAQPLDAATPAGTAVVKIARRTAGAGGGGGTSATYDLADYRLTLTQ
FT                   AHVQVAKRSVVISAADATGVYGGVEPAYSLTYDAGLPANRQADAGMASFDTVTSMFTTA
FT                   PAVSGPDGFADLDAGTYEGKIAAAGGESANYNVTFAPGTLTVTPASLRDASRVSVGQVD
FT                   PVVYDGRAHTVAKSDIQVTDTKAGASSASPLSESDYDVAVAGDATNAGTALAVVTGTGN
FT                   YTGSVVRRLEILPAELAIKTPSATKLYDGSALTAEGSMSGLVAGETATFKTTGTQTEAG
FT                   SSPNSYELTWDGTANRMNYRANVDVGTLTVLGNDISGFSVSAPDDVTYDGRSHKQTMTV
FT                   TGEDGRKLVAGTDYTLSYDGDTTNAGSVTVTATGAGAYTGEVSATYEIKPARLLIETTS
FT                   AAKAYDGSPLVGSASMDGLIGSETATLTATGTLTDPGSTPDTYTLTWDGTAKEQNYRIR
FT                   DKVGTLTVEASDALAVTAGNYSAVYDGQTHAAECTANVDGATFEYSVDGGATWSTTTPS
FT                   IKDVGEVDYTVRASAFGYNAKTAEGKLVVTAPDEPVTVVVAADNLVKPVGAKDPEFTAQ
FT                   VVGTLGSDTVEYEFSREEGEVEGVYRITVTGDSVQGVYNVVYVPGTLTITNDALPMRTI
FT                   TFDLGGGTLNGSEGPIVWRVREGQVIKLPEAPVRDGYRFVEWHGSSYQPGDEYQVEGDH
FT                   TFTAAWHAQAPAAAVDQVARRIADTGDATPVTAIALVAVAALVIIVVARRCSPRE"
FT   sig_peptide     complement(272771..272860)
FT                   /locus_tag="Olsu_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            273207..273854
FT                   /locus_tag="Olsu_0230"
FT   CDS_pept        273207..273854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0230"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2227
FT                   2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1 4-benzoquinol
FT                   methylase; InterPro IPR013216; KEGG: msm:MSMEG_4708
FT                   putative methyltransferase; PFAM: Methyltransferase type
FT                   11; SPTR: C5VFP8 Methyltransferase type 12; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67359"
FT                   /db_xref="GOA:E1QY95"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY95"
FT                   /protein_id="ADK67359.1"
FT                   /translation="MGGRAHISSRRTASAGCRWNHNSAYYSELVSDAALRGGVALDVGC
FT                   GDGALLELLAGVCRHVVGVEADPATARTAAGRVAGSGTVICGDFMAAQDFAPEEFDTIT
FT                   CVACLHHMPLETALVRMAELLRPGGRLLVVGLSANKTIADWLLSALMVVSARVSGWLHR
FT                   EGTYRGMRVARPCESLDEIRAVAGERLPGALVRRRLYWRYSLEWTKPLAVQP"
FT   gene            274267..274437
FT                   /locus_tag="Olsu_0231"
FT   CDS_pept        274267..274437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0231"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5697 alternative primary sigma 70
FT                   transcriptional factor; SPTR: Q2J784 RNA polymerase sigma
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67360"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY96"
FT                   /protein_id="ADK67360.1"
FT                   /translation="MADVGSIVSNVAQTLADAVGLETSVGSYGDAKFSSCAEDSDGTPP
FT                   AQCDSAWLRAR"
FT   gene            274407..274658
FT                   /locus_tag="Olsu_0232"
FT   CDS_pept        274407..274658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0232"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: taf:THA_1682 rubrerythrin, putative; SPTR:
FT                   A1XDA1 STIP"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67361"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY97"
FT                   /protein_id="ADK67361.1"
FT                   /translation="MRQRMAAGAIEAADAAAFPEGNTLIRQMSDEILQGFQRLGHAEEE
FT                   TQESLEHELRSVRSRMDAEEESYMRAVRKADEESGEWR"
FT   gene            274655..276280
FT                   /locus_tag="Olsu_0233"
FT   CDS_pept        274655..276280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1430 hypothetical protein; SPTR:
FT                   B6FNR5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67362"
FT                   /db_xref="InterPro:IPR029322"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY98"
FT                   /protein_id="ADK67362.1"
FT                   /translation="MRSNVGALMIDLRNNSLAANGACDEASLQTSALQEVIDDTSAGES
FT                   AAYRSMRDYLTQVRMPAIVLQDDFLLAFVKDVYADMGQVGEKLLPLGPVVDTDALADSV
FT                   AQRRFWANTLYGQADSLPAAVPLLADGLRGFADMVMGQADELQRRLDLALEYLGDGSIY
FT                   AASSAYAGSLQRQQDALASVGRDPVTGAFDISGLDLSWVPQLDEGWQRRHNRAVLERYF
FT                   TLDDDGNITGVRPGMEARLGELLDIVRQSLLGDGAPAEIGRLTADERYVLLYLAIKDGP
FT                   QMLSRESSAMQSAIGALAGQFSVQDIISHIEDFSNMVDGNDENPLTQYLAFTTDDGIFY
FT                   GKDMRTSIQHKSGFGDWIEFFGPFLGMDLDTDITTFAYGGKEYRIQTWDGTYGAGVAYG
FT                   GEVAVYTRDAPTSPSDEYLAMTSQEIRDNLDVLSARQTKSIFTTYESAEGSDVPNIHIT
FT                   VNTGGADHVDREAGKGNWTFDSKIVPRYDDGSIKPGYKKQDTSVEASLVFEDEGLQEAA
FT                   MNALMEDGVNVTEKGDKLVVTWSK"
FT   gene            276292..277281
FT                   /locus_tag="Olsu_0234"
FT   CDS_pept        276292..277281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tko:TK1492 hypothetical protein; SPTR: C9BHL1
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67363"
FT                   /db_xref="UniProtKB/TrEMBL:E1QY99"
FT                   /protein_id="ADK67363.1"
FT                   /translation="MTRRGLLAASLALAGGALGLAGCGLLRREEEVPDVTVSSGEDALA
FT                   YALQALGERYGEGFSQAEGTEVTSYEPDYTGRLMYELCARPDSDPGKVFGCGVSTEKET
FT                   GKLAYALMEDYTQYLFKGQMEGPFLEVVRGLSGLAGYSVQMAEPYVGDRDWRPDELDAY
FT                   VNNGFTHPRVDVTLMMPADGTEGEWAGTIHECLEGIWGLGQRMYVYAGLEGYDPYSAQL
FT                   YILDSTQNEVRGRDPEPPSVDRILELMWPDVVYRDGSETWDGTGDAGGPGLRQAPADYL
FT                   VRRAPRDAVSTAWGGPTDPSIVTTLHPFGFIALWQESAACCVGHPQFI"
FT   sig_peptide     276292..276357
FT                   /locus_tag="Olsu_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(277393..277944)
FT                   /pseudo
FT                   /locus_tag="Olsu_0235"
FT   gene            278218..278496
FT                   /locus_tag="Olsu_0236"
FT   CDS_pept        278218..278496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0236"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="InterPro IPR007337; KEGG: swo:Swol_1074 putative
FT                   DNA-damage-inducibile protein; PFAM: RelB antitoxin; SPTR:
FT                   B9CME2 RelB antitoxin; TIGRFAM: addiction module antitoxin,
FT                   RelB/DinJ family; PFAM: RelB antitoxin; TIGRFAM: addiction
FT                   module antitoxin, RelB/DinJ family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67364"
FT                   /db_xref="GOA:E1QYA0"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYA0"
FT                   /protein_id="ADK67364.1"
FT                   /translation="MTTATMPRKAEIKTRTTDQVKKDAMNVYSRWGLSLSDAINMFLIK
FT                   SIEVGGLPFDLRVEKPSYEALSAKAYHAELNPDGIAVLPAEWDDDDE"
FT   gene            278486..278830
FT                   /locus_tag="Olsu_0237"
FT   CDS_pept        278486..278830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0237"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR011067; KEGG: bln:Blon_1607
FT                   transcriptional modulator of MazE/toxin, MazF; SPTR: B9CME1
FT                   Putative uncharacterized protein; PFAM: PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67365"
FT                   /db_xref="GOA:E1QYA1"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYA1"
FT                   /protein_id="ADK67365.1"
FT                   /translation="MTSSGVPRPWEIWHARFDFSEGKGYKYRPVIVVDVAEDGSIVMMV
FT                   TSATNRLHLEHDHFISGWQAAGLEKPSIARADRIAQIPADYLGTAGRIGRLDGADIQAI
FT                   TRILAEIAEG"
FT   gene            278958..279260
FT                   /locus_tag="Olsu_0238"
FT   CDS_pept        278958..279260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0238"
FT                   /product="protein of unknown function UPF0157"
FT                   /note="InterPro IPR007344; KEGG: apv:Apar_0759 protein of
FT                   unknown function UPF0157; PFAM: protein of unknown function
FT                   UPF0157; SPTR: C8WAQ0 Putative uncharacterized protein;
FT                   PFAM: Uncharacterised protein family (UPF0157)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67366"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYA2"
FT                   /protein_id="ADK67366.1"
FT                   /translation="MEKELSKMTLEELWELFPTFLVEHKDAWDSRYDEMEARLRHVLSE
FT                   CPVKVISHVGSTAIPGIWAKDIVDILVEIARLFRGVMTVGRSPATRRVICLLQQL"
FT   gene            279379..280248
FT                   /locus_tag="Olsu_0239"
FT   CDS_pept        279379..280248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_2632 hypothetical protein; SPTR:
FT                   B1W2U7 Putative uncharacterized protein; TIGRFAM: Tat
FT                   (twin-arginine translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67367"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYA3"
FT                   /protein_id="ADK67367.1"
FT                   /translation="MTRRGLLAASLALAGGALGLAGCGLLRGREEEVPDVTISSGEDAL
FT                   AYALQALGERYGEGFSQAEGTEITSYMPDDTDLTYELCARPDSDPGKVFGCDVSTDRET
FT                   GRLLDVLEDDYTQYLFKDQMEGPFLEVVRGLSGLAGYSVQMAEPYVGDRDWRPDELDAY
FT                   VNNGFTHPRVDVTLMMPADGTEGEWAGTIHECLEGIWGLGQRMYVYAGLEGYDPYSAQL
FT                   YILDSTQNEVRGRDPEPPSVDRILELMWPDVVYRDGSETWDGTGDAGDPGYVKHPQITW
FT                   YDGHPVMP"
FT   sig_peptide     279379..279444
FT                   /locus_tag="Olsu_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(280649..281923)
FT                   /locus_tag="Olsu_0240"
FT   CDS_pept        complement(280649..281923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0240"
FT                   /product="protein of unknown function DUF1254"
FT                   /note="COGs: COG5361 conserved hypothetical protein;
FT                   InterPro IPR010679:IPR010621; KEGG: mhu:Mhun_1063
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF1254; protein of unknown function DUF1214; SPTR: C7GAX4
FT                   Putative lipoprotein (Fragment); PFAM: Protein of unknown
FT                   function (DUF1254); Protein of unknown function (DUF1214)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67368"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYA4"
FT                   /protein_id="ADK67368.1"
FT                   /translation="MWETIEAAYIYAFPLVLMDATRASATNTEGAVPGKAPVNQFMHGA
FT                   ALANAQFKNVVSPNVDTVYSQVWYDLSEEPIVYVLPETDRFCKVQVLDAWTNTAAVLDR
FT                   AGTYAITLSTWSGDLPDDVTRIDVPTAMAWSITRTVLSGEADLPNVHAVQAKMLLRPLS
FT                   AYLGGGAYRPPKGSYREENDYVPIDKVLSLDPVTFFKKANALMEKNPPFATDAEMLEKL
FT                   AAVHVGPGMEFDASVLTGDIQASWRKMLKGLRPKLAAEGMRFSNQLGQWSYFGAPIGDF
FT                   GTEYAYRALVAIAGLGANTVEVALYPRTEKDADGNVLTGEKSYMLHFEGYPQVLDGGFW
FT                   SITAYGDDDFLIDNPIDRYCINDRSGLRVSADGSVDVILSKDAPADATNWLPIGDGGFH
FT                   LYMRIYTPDMDAIKTWTAPVITAID"
FT   sig_peptide     complement(281849..281923)
FT                   /locus_tag="Olsu_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(282080..282976)
FT                   /locus_tag="Olsu_0241"
FT   CDS_pept        complement(282080..282976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0241"
FT                   /product="ABC-3 protein"
FT                   /note="COGs: COG1108 ABC-type Mn2+/Zn2+ transport systems
FT                   permease components; InterPro IPR001626; KEGG:
FT                   apv:Apar_0280 ABC-3 protein; PFAM: ABC-3 protein; SPTR:
FT                   B9CMJ2 Manganese transport system membrane protein MntB;
FT                   PFAM: ABC 3 transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67369"
FT                   /db_xref="GOA:E1QYA5"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYA5"
FT                   /protein_id="ADK67369.1"
FT                   /translation="MGGIEFEILQYAFMQRALATGVVTALVCGVISCWITHMGWSLMGD
FT                   AISHAILPGVVLAHIVGIPYVVGALAFALVTVALVGQVKKSRVIKPDTAIGIVFTAFFA
FT                   LGTVLISKVPSQINLSHILFGNLLGVTVADMQQVLFVGMPILAILLLKRRDLTLIAFDS
FT                   SHAQAMGIPVRFLSGLLLVALALAIIISLQAVGVILSVSLLIVPGATARLISDDMKHML
FT                   WISPLVAMISVLAGIVLSYLFDASSGGMIGLVLGVAFGIVYLFGPHGAAWQAQGGTGLS
FT                   QKGARSSSTPAHDSSTG"
FT   gene            complement(282976..283773)
FT                   /locus_tag="Olsu_0242"
FT   CDS_pept        complement(282976..283773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0242"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1121 ABC-type Mn/Zn transport systems
FT                   ATPase component; InterPro IPR003439:IPR003593:IPR017871;
FT                   KEGG: apv:Apar_0281 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: B9CMJ3
FT                   Chelated iron transport system membrane protein YfeB; PFAM:
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67370"
FT                   /db_xref="GOA:E1QYA6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYA6"
FT                   /protein_id="ADK67370.1"
FT                   /translation="MSVSDVACPDISAGLSVSGLSAWYGSSQVLHDVSFTLSRGDLCAL
FT                   VGVNGAGKSTLFKAIMGMVHSQGICSFAGEGLPVARKAGLVGYVPQSEDIDVMFPLRVR
FT                   DVVMMGRYCHLGFTRRPSKHDRDTVEDALGRVGLSDLADRPLSQLSGGQRKRVFVARGI
FT                   AQQARLMLLDEPFAGVDKRSEGIICDLLASLASEGAIILVAIHDLRMAREFFDRCLAID
FT                   GTIIAQGSAKEVLGDRNLLESFGLSEAGIGTAAHMVPIETGAA"
FT   gene            complement(283770..284825)
FT                   /locus_tag="Olsu_0243"
FT   CDS_pept        complement(283770..284825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0243"
FT                   /product="periplasmic solute binding protein"
FT                   /note="COGs: COG0803 ABC-type metal ion transport system
FT                   periplasmic component/surface adhesin; InterPro
FT                   IPR006128:IPR006129:IPR006127; KEGG: apv:Apar_0282
FT                   periplasmic solute binding protein; PFAM: periplasmic
FT                   solute binding protein; SPTR: B9CMJ4 Periplasmic chelated
FT                   iron-binding protein YfeA; PFAM: Periplasmic solute binding
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67371"
FT                   /db_xref="GOA:E1QYA7"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYA7"
FT                   /protein_id="ADK67371.1"
FT                   /translation="MDIGQKGPGMPMISKHTSPITSGRSGLTPPALYTRRSALGLFAGA
FT                   ALVGLGACSKMGAKTGSMDEGASSDADSKPFVLTTFTVTRDIAANVAGDFLDVRSITKA
FT                   GAEIHDYEPTPEDIKQAEGAALILNNGLGLERWFERFATDSHAERVDLSKGVDPISISE
FT                   GDFAGEANPHAWMSPKNGQIYVDNMVAAFSRLDPDHASDYESNGKSYKESLEKISSELI
FT                   QRLDELPTDQRTLVTCEGAFSYLCRDANLDEIYLWPVNSAEEGTPQQIAKVVQAVRDKS
FT                   IPAVFCESTVSPKAMRQVADETGASLRADAEHMLYVDSLSDGDGPVPTYLELLSHDAKV
FT                   IVEGLTGKESK"
FT   gene            285057..285821
FT                   /locus_tag="Olsu_0244"
FT   CDS_pept        285057..285821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0244"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.4"
FT                   /note="COGs: COG0588 Phosphoglycerate mutase 1; InterPro
FT                   IPR005952:IPR001345:IPR013078; KEGG: apv:Apar_0426
FT                   phosphoglycerate mutase 1 family; PFAM: Phosphoglycerate
FT                   mutase; PRIAM: Bisphosphoglycerate mutase; SPTR: B9CKZ8
FT                   2,3-bisphosphoglycerate-dependent phosphoglycerate mutase;
FT                   TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase family; TIGRFAM: phosphoglycerate
FT                   mutase, BPG-dependent, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67372"
FT                   /db_xref="GOA:E1QYA8"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYA8"
FT                   /protein_id="ADK67372.1"
FT                   /translation="MAEDKYMHLVIVRHGESEWNKLNLFTGWTDVDLTETGHEEAIAGG
FT                   KALHEAGYDFDVCYTSLLKRAIHTLNHVLDELDRNWLPVHKTWRLNERHYGALQGLNKA
FT                   DAAAEHGEAQVKIWRRSFDVQPPALEPGDERDPHVQEMFRDVPKGDLPYTECLKDTIAR
FT                   AWPYFESEIKPQMEAGKRVLIAAHGNSLRALVMQFEHLTPEEILEVNIPTGIPCSYTFD
FT                   KDWNVVDKHYIGDPATIEAKINAVANQGKVKK"
FT   gene            285875..286189
FT                   /pseudo
FT                   /locus_tag="Olsu_0245"
FT   gene            286252..286479
FT                   /pseudo
FT                   /locus_tag="Olsu_0246"
FT   gene            286573..287607
FT                   /locus_tag="Olsu_0247"
FT   CDS_pept        286573..287607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1373 ATPase (AAA+ superfamily); KEGG:
FT                   bth:BT_0221 hypothetical protein; SPTR: C4GC58 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67373"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYA9"
FT                   /protein_id="ADK67373.1"
FT                   /translation="MIISRPSYMQKLISGMGSDQVKVVTGIRRCGKSFLVFNLFKDYLL
FT                   KRGIPKTNIIEMAFDRFSNRRYRDTETFYSHVTGELGKTSGKRYVLLDEVQLLDSFPEV
FT                   LMDLIAMPDVDVYVTGSNARLLSKDVVTEFRGRGQEIAMAPLSFSEFMSAYGGDKHDGY
FT                   AEYATYGGLPAVLSKKMTQEKADYLSSLYDVLYIRDIVERNGIRDTGNLEELIELSSAI
FT                   GSLVNPSKISATFRSEKNTTIAPETVDRYLSHLEDAFLVSRAKRYDLKGRRYIGTPFKL
FT                   YFSDLGLRNARMNFRQMEGFHIMENVIYNELRGRGFGVDVGVVPTGVRGKDGKVCRTQL
FT                   EVDF"
FT   gene            287687..288442
FT                   /locus_tag="Olsu_0248"
FT   CDS_pept        287687..288442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0248"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439:IPR003593:IPR017871;
FT                   KEGG: ele:Elen_2749 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: C8WMK2 ABC
FT                   transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67374"
FT                   /db_xref="GOA:E1QYB0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYB0"
FT                   /protein_id="ADK67374.1"
FT                   /translation="MVAGGMRQSISPILAVEGYSKSYGKKRVVEDVALSVLPGSIFGFV
FT                   GHNGAGKTTLIRSIVGALSFDEGDIRICGKSVRTDPVACKRVCAYVPDNPDVYGFLTGM
FT                   QYLDYVADLFCVGSDERVRRIDGFAKHLGMEDRLGEMVSAYSHGMRQKLVLIGAFLHKP
FT                   RLLVLDEPFVGLDPEAAYELRAMMYELTSRGSAIFLSSHVLDTVERLCDTIAIIRQGNI
FT                   IRLGTTDEVRGDESLEQVFLELAREARNG"
FT   gene            288435..290051
FT                   /locus_tag="Olsu_0249"
FT   CDS_pept        288435..290051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ele:Elen_2748 hypothetical protein; SPTR:
FT                   C8WMK1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67375"
FT                   /db_xref="GOA:E1QYB1"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYB1"
FT                   /protein_id="ADK67375.1"
FT                   /translation="MASFAPLLRVQALGAFGVGRLMNERDPKARRRLVLAAVGIGLLVV
FT                   YTVVYMWMVGQTLVLIGAAGALPCLAVTTVGVGCVFSTFVKANGLLFRFRDFDLVVSMP
FT                   TPLWAVVVSRVAPLYSMGLACSLVLGAPLVSAYLLAVGVTPAGLVVSVLALLLAPAVPM
FT                   ALALVVSFCVAWAASRTPFADRALGIVGVLAMVAIVVGVMLVTGGAGTSGQGGLDALAV
FT                   MGGQMRGAVSALWPPSAWAADAIGGSMPALALYVGVSTASGVAVVAVLSRFLVPMNSLL
FT                   CAGGLRKAGSAPTRAGAPRGPLVALVRKEFRLWLGTPIYLMNTAPGPILALVIAIATTA
FT                   VGPDAIASAMNIPGAGRDTVATLMAEVLSWALAFCMAMTSLTAASTSLEGSARWIAQTA
FT                   PVPSSTIVGAKLALSLLVTGPVSVIAGAIAAVGVARTPLDAILCVIAPLAMGALSSCLG
FT                   ALLDARRPNYDWTSEYEPVKRSASVGICVGVGFLATFAGFAATSLTGGVGTAAGVAVAL
FT                   VVLTASALVARAAVHIPLQDR"
FT   gene            290116..290538
FT                   /locus_tag="Olsu_0250"
FT   CDS_pept        290116..290538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0250"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG1725 transcriptional regulator protein;
FT                   InterPro IPR000524:IPR011991; KEGG: apv:Apar_0220
FT                   transcriptional regulator, GntR family; PFAM: regulatory
FT                   protein GntR HTH; SMART: regulatory protein GntR HTH; SPTR:
FT                   C8W964 Transcriptional regulator, GntR family; PFAM:
FT                   Bacterial regulatory proteins, gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67376"
FT                   /db_xref="GOA:E1QYB2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYB2"
FT                   /protein_id="ADK67376.1"
FT                   /translation="MILRIDQTDQTPVYQQIRDQIVAAIARGELSVADRLPSVRTLAGD
FT                   LGVNLHTVNKAYAVLRDEGYLLMRGRSGAVVADFGQTATPERMAANSERLATGLRQLAL
FT                   EHRAQGGAEETFLEAARTQASRVFAEFATESSPEEA"
FT   gene            290541..291665
FT                   /locus_tag="Olsu_0251"
FT   CDS_pept        290541..291665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0251"
FT                   /product="protein of unknown function DUF1648"
FT                   /note="COGs: COG4194 membrane protein; InterPro IPR012867;
FT                   KEGG: apv:Apar_0221 protein of unknown function DUF1648;
FT                   PFAM: protein of unknown function DUF1648; SPTR: C8W965
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1648)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67377"
FT                   /db_xref="GOA:E1QYB3"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYB3"
FT                   /protein_id="ADK67377.1"
FT                   /translation="MIAVATIGMLALLTLVVGLLLAFTPYLMRRNECFAVTVPASAQRD
FT                   PRLVALKRRYAMVMLALAAAATVASLAAGVLMVSGQDVIGTVLMCAALFVPVVMSFVLM
FT                   LRNRCKVSALKLSEGWGVRSHQAVASVAEKDLPGAIPLAWDLVYVPVILGTACLGLVLY
FT                   PGMPEQLPMHADFAGNVSRYVPKTLGSAIGFPIAFEAFMAACLVFAHWTILRSKRPADP
FT                   GAPATSALAYGLFARAQSALLLVTGVLLSGGSGLLFLLSSAGLIGLGQAGLVIMMLCVP
FT                   LVIGGVVLSVVYGQAGSRVFGRMRDDDGLLADDDEHWKLGVLYFNPGDASVFLPKRFGV
FT                   GWTLNLARPSAWAIVVGAVVLTVAFVVLVANLAG"
FT   sig_peptide     290541..290666
FT                   /locus_tag="Olsu_0251"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(291766..292569)
FT                   /locus_tag="Olsu_0252"
FT   CDS_pept        complement(291766..292569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0252"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="COGs: COG2110 phosphatase homologous to the
FT                   C-terminal domain of histone macroH2A1; InterPro IPR002589;
FT                   KEGG: shi:Shel_21040 predicted phosphatase, C-terminal
FT                   domain of histone macro H2A1 like protein; PFAM: Appr-1-p
FT                   processing domain protein; SMART: Appr-1-p processing
FT                   domain protein; SPTR: C7N880 Predicted phosphatase,
FT                   C-terminal domain of histone macro H2A1 like protein; PFAM:
FT                   Macro domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67378"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="InterPro:IPR035801"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYB4"
FT                   /protein_id="ADK67378.1"
FT                   /translation="MEREHKRHLLKELVFGLYAEGGTEPASARRRVTSLQTSEELWNEF
FT                   RALVNTRPPIPAGDGWLALQDELLEGLISETGIASIDDARTSSVDPRMRLWRGDITTLA
FT                   ADAIVNAANSQMLGCWIPGHHCIDNAIHTFAGVQLRLECARIMAEQGHEEPTGQAKLTG
FT                   AYNLPAARVIHTVGPIANGHPSDLQRRQLASCYRSCLDLAAGHGLRSIALCCISTGEFA
FT                   FPQQGAAEIAVQTVQAWLDRHGAEMAVVFNVFTDVDETAYRKLLT"
FT   gene            complement(292571..293440)
FT                   /locus_tag="Olsu_0253"
FT   CDS_pept        complement(292571..293440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG0846 NAD-dependent protein deacetylase SIR2
FT                   family; InterPro IPR003000; KEGG: shi:Shel_21050
FT                   hypothetical protein; SPTR: C9LYS2 SIR2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67379"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYB5"
FT                   /protein_id="ADK67379.1"
FT                   /translation="MTEKTPSRNVTRLVEAIASADAVVVGAGAGMSTAAGLTYSGERFE
FT                   RLFPDFIERYGFADMYSAGFYPYPTPEEHWAYWSRYVWCNRYEAAPKDTYGKLLRLLGG
FT                   KDLFVLTTNVDHQFQLAGIPKERLFYTQGDFGLWQCSVPCHDKTYDNFGTVRRMVVEQQ
FT                   GMRVPSELVPHCPVCGRPMAMNLRADSTFVEDTGWHAAATRYREFLHAHERGRVVYLEL
FT                   GVGMNTPVIVKYPFWRRTYANPDATYVCANYGETYAPDEIRGRSILLDADIDATLSAAL
FT                   EAQRGKEV"
FT   gene            293689..294027
FT                   /locus_tag="Olsu_0254"
FT   CDS_pept        293689..294027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0254"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COGs: COG1733 transcriptional regulator protein;
FT                   InterPro IPR002577; KEGG: blo:BL0458 hypothetical protein;
FT                   PFAM: helix-turn-helix HxlR type; SPTR: A7VYK5 Putative
FT                   uncharacterized protein; PFAM: HxlR-like helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67380"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYB6"
FT                   /protein_id="ADK67380.1"
FT                   /translation="MGTRLEDLPACPVETTLTLIGSKWQVLILRDLTVNGTMRFKELQR
FT                   SIGRISQKVLTSNLRAMEGSGLVHREVFAEVPPRVEYSLTELGQTLAPVLDALRQWGES
FT                   YRERLRKE"
FT   gene            294032..294409
FT                   /pseudo
FT                   /locus_tag="Olsu_0255"
FT   gene            294665..294772
FT                   /pseudo
FT                   /locus_tag="Olsu_0256"
FT   gene            294911..296554
FT                   /locus_tag="Olsu_0257"
FT   CDS_pept        294911..296554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0257"
FT                   /product="Listeria/Bacterioides repeat protein"
FT                   /note="InterPro IPR013378; KEGG: swo:Swol_0298 hypothetical
FT                   protein; PFAM: Listeria/Bacterioides repeat protein; SPTR:
FT                   A8SJ28 Putative uncharacterized protein; PFAM:
FT                   Listeria-Bacteroides repeat domain (List_Bact_rpt);
FT                   TIGRFAM: LPXTG-motif cell wall anchor domain;
FT                   Listeria/Bacterioides repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67381"
FT                   /db_xref="GOA:E1QYB7"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYB7"
FT                   /protein_id="ADK67381.1"
FT                   /translation="MPQRSRCSSHDCRASHGARLGTRALASAVAALVLALSSIAAVPAQ
FT                   AEEPIPDEYKAQVEGNYWSELCWYTDESGLHRVMPTYLVDYFQNSRLKWSDDVAHEYYV
FT                   PGFPDAGIIADKTAEDELRELVTQYWAVYSMDLPHAEPSDPALNHWQGGKQWNPYDFNY
FT                   ETDVLTVDSTDYNVRGDIQERGESSTAVVKHEVGDTVNLDLQLDLDVFKRVRNTALLAV
FT                   INSEFPAYYTMLNDLPENGLASSDGAFAFVLDLPEGLEATDSTTYKLTGIDGFDLSVSK
FT                   EKGGKRLVVKARLKPHGEYEPLKDLYARIQGVRSATLSIDGLKVTDQVARNQDSTVVAY
FT                   AYGAHEVVSSSSNDAIINKDTSAQYDNKHWYARIPMLFAAKQNDAGRDVAAPADKPNLM
FT                   TYSFRVDAPGTCTVTFVNDGDTYASVKAERGKTIDGDALTDESMPANPSKDGCVFKGWN
FT                   TAQDGTGDAFDGSTVVNGDMTVYADYVKKPVPQPGPPSQPKAPAATPKAKVRRALPQTG
FT                   DPALPVAPVAVGVAAVGTLLVGAALRCRAH"
FT   sig_peptide     294911..295048
FT                   /locus_tag="Olsu_0257"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(296654..297328)
FT                   /locus_tag="Olsu_0258"
FT   CDS_pept        complement(296654..297328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR016024; KEGG: apv:Apar_0764 hypothetical
FT                   protein; SPTR: B9CJV7 Putative uncharacterized protein;
FT                   PFAM: DNA alkylation repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67382"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYB8"
FT                   /protein_id="ADK67382.1"
FT                   /translation="MPIRDRLFELRDPKYAAFQAKLTPNVPTERFIGVRVPDARRLAKS
FT                   LSDGLEATEFLTRLPHDYYDEDVLHALLVSEMRDYETCIAAVDLFLPHVDNWAVCDVMS
FT                   PKAFKGHKADLLDKIRGWSSSRETYTCRFGLEMLMTHFLDDNFEADLLEVPASVHSEEY
FT                   YVNMMIAWFFATALAKQWDATVPYLQRGSLAPWVHNKTIQKARESRRVTDEQKAYLKTL
FT                   KR"
FT   gene            complement(297362..298108)
FT                   /locus_tag="Olsu_0259"
FT   CDS_pept        complement(297362..298108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0259"
FT                   /product="cobalt transport protein"
FT                   /note="COGs: COG0619 ABC-type cobalt transport system
FT                   permease component CbiQ and related transporter; InterPro
FT                   IPR003339; KEGG: apv:Apar_0682 cobalt transport protein;
FT                   PFAM: cobalt transport protein; SPTR: A4E7L2 Putative
FT                   uncharacterized protein; PFAM: Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67383"
FT                   /db_xref="GOA:E1QYB9"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYB9"
FT                   /protein_id="ADK67383.1"
FT                   /translation="MVNVIDYVPGDTLLHRLNPVTKLGIAAAIIVATFLADTYPMLVGL
FT                   LALTFALGAYSRSMGKLVSLLKLVVPLAVVMLLLQTVFVRGGGTVFAWATTEGFVTGGK
FT                   ACLRLLGVALPLILMLGVTRLNDLANACVEVLHVPYRYAFTFTTALRFVPVFGQEMNAI
FT                   VEAQTARGVEYDTKNPIGKLRLMLPLCVPLLVGSVGKTDATALAAEQRGFYLRTRESSF
FT                   KRYPMAARDAAALALCVALVAAGVLL"
FT   gene            complement(298222..298788)
FT                   /locus_tag="Olsu_0260"
FT   CDS_pept        complement(298222..298788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR001917; KEGG: apv:Apar_0680 hypothetical
FT                   protein; SPTR: A4E7L0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67384"
FT                   /db_xref="GOA:E1QYC0"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYC0"
FT                   /protein_id="ADK67384.1"
FT                   /translation="MSENTSSQQARTVTSPDRGKLDVRALVLLAVLLAAGFILNFTVGK
FT                   AISSISGGMISPEFIISAFCLTILVIRPNVTQALVIGLISAAVIQITTTSPFVDFAAEG
FT                   AAAMLMALIVSAGMRGSAEKFVPALGTLVTTVVSGVIFMIIKIAMIGAAQELAAAMLPV
FT                   ILATGVFNAILVQALYAPVRKALKR"
FT   sig_peptide     complement(298651..298788)
FT                   /locus_tag="Olsu_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            299271..300008
FT                   /locus_tag="Olsu_0261"
FT   CDS_pept        299271..300008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_0467 hypothetical protein; SPTR:
FT                   C5ES31 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67385"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYC1"
FT                   /protein_id="ADK67385.1"
FT                   /translation="MRITHIYHSGFAVELACCTLLFDWYTGELPRLRYDLPLVTLVSHE
FT                   HSDHYGRCIWSLREQFPNVRYVLDEDVAADAPADARVTAVEPHESYELQLDGMGSLPDA
FT                   AGATVPLSVETLESNDEGVAFLVRACGTSAFFSGDLNSWQWARPAEQNAASEKFFRTEL
FT                   SRIVPGPVDLAFVPLDPRLEDPAAGIAALMDVVGARALFPMHYWDASAAARALMSDARL
FT                   APYLGITHFEDVCELPDPVTPSA"
FT   gene            complement(300031..300813)
FT                   /locus_tag="Olsu_0262"
FT   CDS_pept        complement(300031..300813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0262"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro
FT                   IPR016040:IPR002347:IPR002198; KEGG: ele:Elen_1205
FT                   short-chain dehydrogenase/reductase SDR; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR: C7GFJ6 Oxidoreductase,
FT                   short chain dehydrogenase/reductase family; PFAM: short
FT                   chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67386"
FT                   /db_xref="GOA:E1QYC2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYC2"
FT                   /protein_id="ADK67386.1"
FT                   /translation="MRIALITGASSGLGREYARWADAHGSFDQIWAIARREERLHALAK
FT                   ELSTPVRALPLDLTEGSAATTLQAILDEEACDDPSLEVGLLVNAAGFGKFGTYADMTLA
FT                   EADSMVDLNCRALVDVTQVALAHMRDGGRIVQVASSASFQPLPGLNVYAASKAFVRSYT
FT                   RALRFELRGRGIHVTAVCPLWVKTEFIDVARRTANGQTVRHPFPMLGARRVVRWSMLVN
FT                   AANYPVATCCVTGLLMRIAGKVIPAPLIMWVWEGVRRI"
FT   gene            complement(301082..301666)
FT                   /locus_tag="Olsu_0263"
FT   CDS_pept        complement(301082..301666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0263"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpf:Rpic12D_0749 hypothetical protein; SPTR:
FT                   C6JB88 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67387"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYC3"
FT                   /protein_id="ADK67387.1"
FT                   /translation="MLNRNRIVTVGLALVLLASPVALTACGGSGADEDSDAVATESTST
FT                   EQRTDDTTTSQNSTTSDNSTSGSSGKTYSIATSEITEAYMGVAESGETVYYVGNGDGSK
FT                   TGIFFLNAEKMAHVSFMGAATATDQNGERLITITDELSGNSITFGVTVNDDGTITIDMG
FT                   SELGKAILAKCEVSEAVDAIKTIQGNTSQVG"
FT   sig_peptide     complement(301574..301666)
FT                   /locus_tag="Olsu_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(301837..304200)
FT                   /locus_tag="Olsu_0264"
FT   CDS_pept        complement(301837..304200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0264"
FT                   /product="ATP-dependent transcriptional regulator,
FT                   MalT-like, LuxR family"
FT                   /note="COGs: COG2909 ATP-dependent transcriptional
FT                   regulator protein; InterPro IPR016032:IPR000792:IPR011991;
FT                   KEGG: cbt:CLH_2973 transcriptional regulator, LuxR family
FT                   protein; PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; SPTR: C6LGQ2 Transcriptional regulator, LuxR
FT                   family; PFAM: Bacterial regulatory proteins, luxR family;
FT                   TIGRFAM: glutamate--cysteine ligase/gamma-glutamylcysteine
FT                   synthetase, Streptococcus agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67388"
FT                   /db_xref="GOA:E1QYC4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYC4"
FT                   /protein_id="ADK67388.1"
FT                   /translation="MLNKIPLELDEYLWAQWSCTRLAFICAPLGFGKTEFAHRVLQGLD
FT                   VLEVNAETTDVGVAVTVETARGHDAVLVDNIHDAVSVSQGAALASVVAQCGDTRFVFIS
FT                   RAPMPGWLTPFFAKGDLLIVTNDDLYFTDTDIARLLVANGLAPTPRLVERIAAVTSRYP
FT                   LAVSLALAHILHGEDAWEEDLTDEAMRYFESEFNRRFDPKVQGLMLLIPLFDRIDESLL
FT                   TSVLGEADGEMLLDALQHTTCFVTRDSQGWNVNPGMRAFCQWELMRRYEDAARSPMVER
FT                   AVDYYVAQGNYINALDLCSRAKNGARMLAILDEHARLNPGSGTYCELEHYYHDLPEGMI
FT                   CASPRLMRTMSLLDSMLMDAVGSERWYTELKDYASAPERTRDERHVANANLAYLDLALP
FT                   HRRLISLTDAVGALAKVNASDDPELTPSMTSAMPSIINGGRDLSPWVPTDEKTCVLIGK
FT                   LVERALGRLAVGCIEVALCESKFEKGEDVTPYVARVNAVLPKIRRNGDPSIEFAAIGIQ
FT                   CRNLMYCGDARQALALLDLHRRHFAQSEIPERKRIVANLDALRCHAWLRLGQTERAHAW
FT                   LEESAPDFSKPLDFLNRYIYKTVSQVYISESRYDEALRLMSTLSEYVKSRDRVIDCIHY
FT                   DVLAAIAAWRSGKDDWRRWIADALDQAKRYGYVRTITLYGAAVLPLLTEARRHAKEMGV
FT                   DEDQLARLVRGARAQASHYPNFMSSPSGPAEPLTKTEGQVLRLICQDKSNAEIGELLGI
FT                   KLPTVKTHVSHILTKLGVSRRAQAASEARRLHLV"
FT   sig_peptide     complement(304090..304200)
FT                   /locus_tag="Olsu_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(304398..304772)
FT                   /locus_tag="Olsu_0265"
FT   CDS_pept        complement(304398..304772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_PB00122 sugar ABC transporter,
FT                   substrate-binding protein; SPTR: B4VMT9 Haemagglutination
FT                   activity domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67389"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYC5"
FT                   /protein_id="ADK67389.1"
FT                   /translation="MAFGFKLKTVRTSQSFANEKELFDRIKDEKFTAGKPELVKNGFAD
FT                   VIVFPPLDRQNQVWVMVQGKNKILIQKNQMVGVGDQLVNAAFDTVTGGLFSFGSVLGGN
FT                   VKKIEKLVEATASELEALNL"
FT   gene            305011..305583
FT                   /locus_tag="Olsu_0266"
FT   CDS_pept        305011..305583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nph:NP4734A cell surface glycoprotein; SPTR:
FT                   Q3IN47 Probable cell surface glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYC6"
FT                   /protein_id="ADK67390.1"
FT                   /translation="MEAISMRCPNCMGDVIPFDNGAFGRCASCDSVFRLRDGETAGAAT
FT                   ADFEDGADDTDDAFDFESFFQNAYDEYVDDESDLSDAYFGDRLDSNRSKIDAAVRRFDI
FT                   DDDDAEEVYCVVDTTIFGSCKVGFAVTVSGLYMVDEDGDSAFLDWDDFDDCRIERDGGK
FT                   LIIGGHPFIMSTDEARIVARVMRDLQD"
FT   gene            305616..307052
FT                   /locus_tag="Olsu_0267"
FT   CDS_pept        305616..307052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4260 Putative virion core protein (lumpy
FT                   skin disease virus); KEGG: lsp:Bsph_3109 hypothetical
FT                   protein; SPTR: B0NF62 Putative uncharacterized protein;
FT                   PFAM: SPFH domain / Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67391"
FT                   /db_xref="InterPro:IPR033880"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYC7"
FT                   /protein_id="ADK67391.1"
FT                   /translation="MALIKAALGALTGNLADQWKEMIYCEALDADVLCVRGQKRTGARS
FT                   TNTKGDDSIISNGSIVVVNSGQCMVIVEQGKVVDFCAEPGEYTYDSKAAPSVFTGGLGA
FT                   GLLDTFKNIGRRFTFGGDTGLDQRVYYFNTKEVMGNRYGTPTPVPFRVVDNNIGLDMDV
FT                   SVRCNGEFSFKVADPLLFYKNVCGNVEEPFTRNMIAPQLRSELLTALQPAFARISAMGV
FT                   RYSAIPAHTEEVSAALSDILSKKWREVRGIQIVAFGVNAMAADPEDEKAIKELQRTAVM
FT                   RDPRMAAANLASAQGDAMRAAAGNAAGAFVGLAGMNMAQMAGGVNAQDLFQMGGQGGYP
FT                   DGRPGGHPQGGWGTLGGGCPGAPDGYPGASQPGAEPAGAAALEADSAMAHAAAVPTADA
FT                   SVPPTEPAPEPPEAAAGGTWACPTCGTANRGKFCPECGTPKPKPRYRCDKCGWVPEDQT
FT                   RPPKFCPECGDRFDEGDVER"
FT   gene            307225..311412
FT                   /locus_tag="Olsu_0268"
FT   CDS_pept        307225..311412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0268"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="InterPro IPR008957:IPR003961:IPR003599; KEGG:
FT                   GE10512 gene product from transcript GE10512-RA; PFAM:
FT                   Fibronectin type III domain protein; SMART: Fibronectin
FT                   type III domain protein; Immunoglobulin subtype; SPTR:
FT                   A4EBA7 Putative uncharacterized protein; PFAM: Fibronectin
FT                   type III domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67392"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYC8"
FT                   /protein_id="ADK67392.1"
FT                   /translation="MKGHTPGPRWRATLVGAALALALAAIPGTAWAVTTYSPDNQLTKE
FT                   DYAALGLAIDDSVPDNAVGMAPYDASSEGATTTLFSHSGVYVAANGANANNYTLRSKLN
FT                   TMRQFYTKEVKPVSPFSPKVVPADPKTFTNVYDKYGGMHGAYPFYKLSNKKPDTYYGGI
FT                   KTSPLSDNTNDVLKDATNNGFDGIYATSVAYDQGSGYKDHIAELRVYGDNASMTTEGGV
FT                   KIAGGFAVKLYELDASGRRSEVASLSPSIDSAAIDEVVAKFPRLKDAYRSFTYLDNGYL
FT                   QENDAMFEVQAGDVDNDGVDEIFAYVGIHHDVDGVRQACIDMWDLQGGEWVHSEVWVDC
FT                   GQASHYVTPSGAGHGDCSWHAPVVTMVTGNLDRAGGDELAVTTSAPSNHQKPSDVARCH
FT                   IYTWDSENGTLTGVPALDEEVGVPYIPLSTPDGSAAMVSAGCAFGTFATGNGTTADAFV
FT                   IAGWDCDGASTGSYHNFSYAFVYFDQPSGRYVVRGYDADSRRRALGRDAKRIMDSAMEH
FT                   LGDDERYFPTLAPFAVACARLQGLDQISSGGIENDAVLLGGDVYDFMLFSPSAASTEPI
FT                   GSMSLTSAQANQRGHKKGKDQVWIGDVRVGAVTGDSNYKESFLAVTGVRRDDDPGDDDD
FT                   YYWMDISHFTAQFSKSKFTGYQTGEEGVICEGVRVNDTYGTWVSLCLPNVDHKGVQVRF
FT                   KAMDKFYTAPQLLAVIEDSPYFQDLQDAYGYLNYGGTNFGQDSSSTTGTGVSVEGAAGG
FT                   FMEGTANFLFAAKMRGELQATVSYDHESASTLSYGATFEAHAGEGNKAVVYTVPLIYYH
FT                   YEYRDPSVDDDWHDTVSSVYLKPTIAMVGEEIWDASCKKLGMPRLTRTQTEKGILGNVT
FT                   GDPSSYTLDALTVLPGSTTAFSSNTTTTVTNSSGSTVSQKISVEEEKSSSIGGGVALAY
FT                   ESGWGVGFLGNEGLAGVCFDASAGGSHITSNATGFDFEGLVDNVPEKAEGRSFDWQLRV
FT                   CKSDEKMPDDGTKPSDNQYWIVGYAVSNVTTDGVGAVSGLAVTGTTDHSVTLSWNPTLK
FT                   DDSPYQYGVVMVAQDGTGGTMHLVDQGATSYTWEGLVANTTYQFYVVPASGTDEQSATE
FT                   EGVKSPTVSAKVLPSGHTFELDGANVVGAADASSRKATVAVGGELKLQETALYQQPSTD
FT                   PNNTDGYESVEPTFHWYRLSPYNNTGKDGQEWTFVGKGLDVTYRRDRETALSEDSFEEG
FT                   PTLAPAGTSYTSTLTIPSVSAEDDGSMWRCDVYVSDVVVYSQVVTLDVTHTIVNSTSSS
FT                   FEEKGSARILPGLLSIFRRANHSEIVTIPDAKPDPDDAGGEGQDASQDDAKQERDGTGG
FT                   GSESASRQPSAGASGTPNTGDAMPSPTSLALLGAAGVTSLLCALLLTRRRSG"
FT   sig_peptide     307225..307320
FT                   /locus_tag="Olsu_0268"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            311595..312023
FT                   /locus_tag="Olsu_0269"
FT   CDS_pept        311595..312023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ele:Elen_1874 hypothetical protein; SPTR:
FT                   B1C7P0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67393"
FT                   /db_xref="GOA:E1QYC9"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYC9"
FT                   /protein_id="ADK67393.1"
FT                   /translation="MDRNSTNKPAGSSILRVASIILIVYAVITLVSGLFMMMGVYMVAA
FT                   DADVNIATGIAAIVGIVAFLGGLLNLFVGVVGFRASKRNDRNTLALVLGVISVVFGIYG
FT                   ITTAIGTGDAGSIANAVAGIILPALYLYGVIETRRRVA"
FT   sig_peptide     311595..311735
FT                   /locus_tag="Olsu_0269"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            312177..313289
FT                   /locus_tag="Olsu_0270"
FT   CDS_pept        312177..313289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0270"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /note="COGs: COG2055 Malate/L-lactate dehydrogenase;
FT                   InterPro IPR003767; KEGG: shi:Shel_12130 malate
FT                   dehydrogenase (NAD); PFAM: Malate/L-lactate dehydrogenase;
FT                   SPTR: C7N5Q6 Malate dehydrogenase (NAD); PFAM:
FT                   Malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67394"
FT                   /db_xref="GOA:E1QYD0"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYD0"
FT                   /protein_id="ADK67394.1"
FT                   /translation="METRPYVSWELMNSFLTDAFKGYGVPERDAAICADVLLESDRRGI
FT                   ESHGCNRFKPIYIDRIKRGTLLPKTNLEVVRETPTTVVADAHDGMGMVASHRVMEMLIG
FT                   KAKDSGMAGGAIRNSTHYGIAGYWATMASKEGMIGLTGTNARPSIAPTFGVENMMGTNP
FT                   LTFALPTDEEFPFCIDCATSIVQRGKIEYYAREGRPTPAGMVVAEDGSTVTDSQQILGM
FT                   LVDGTAALAPLGGGPGDEMCGYKGYGYAATVEILSAALAGGQFMKALTGVAPDGSSQMY
FT                   HLGHFFFVVDPDAFCGRETFRKIAGDICRELRASNRAPGYERIFTAGEKEYLAWLDRKD
FT                   RGVPVGEAVQREFVQVRDELGLPYRFPFEK"
FT   gene            complement(313405..314103)
FT                   /locus_tag="Olsu_0271"
FT   CDS_pept        complement(313405..314103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0271"
FT                   /product="B3/4 domain protein"
FT                   /note="COGs: COG3382 conserved hypothetical protein;
FT                   InterPro IPR020825:IPR005146; KEGG: ccu:Ccur_01730
FT                   hypothetical protein; PFAM: B3/4 domain protein; SPTR:
FT                   C7MLU8 Uncharacterized conserved protein; PFAM: B3/4
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67395"
FT                   /db_xref="GOA:E1QYD1"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYD1"
FT                   /protein_id="ADK67395.1"
FT                   /translation="MRLLANESIAGLGIKSIVVGTARNVDPKAPLPDAFLKKQREMEDW
FT                   ALGCDMSEVLDHPVVQGYRDLLQSVGRSAKRNPPTVPALIRNIQHRGSIPHINSIIDIY
FT                   NVESLRSLLAIGGHDLDKVHERIEFTVSKEEGVFLPILSTEKHVAKTDYVYRDAEGIMA
FT                   WLDVRDGERYKFDDETGNAIFIIQGNANTSVGYRLEALGRIRDDLVTCMPDVEFETYVV
FT                   HAGEGLELRE"
FT   gene            complement(314253..315038)
FT                   /locus_tag="Olsu_0272"
FT   CDS_pept        complement(314253..315038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC1450 alpha/beta superfamily hydrolase;
FT                   SPTR: A7B8Z6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67396"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYD2"
FT                   /protein_id="ADK67396.1"
FT                   /translation="MKMHEYAPSSSSEAPTALLIHPMLSSAEGMRLIVADRMGNNLHYL
FT                   IPDLSSHGEATSTEYRSAAMEANQIRDWLIGHGQTHLSLGFGASLGGIVLLELLKYPDL
FT                   TFDRLFFEGTSMFVGARAKEAVVRRMFLSKHRRAAANPQLAIRKMGELYGPQAARPMAE
FT                   SLIAMSELSIRNIVHDCGNVEPPALSPDVQRRCTFAYGERDFDLSRARKVIPRLYPNAT
FT                   LRVWTGFGHCERIMGDPDAYAAMLRKGLPAQQTTQDQAG"
FT   gene            complement(315085..316053)
FT                   /locus_tag="Olsu_0273"
FT   CDS_pept        complement(315085..316053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0273"
FT                   /product="Ketopantoate reductase ApbA/PanE domain protein"
FT                   /note="COGs: COG1893 Ketopantoate reductase; InterPro
FT                   IPR016040:IPR013332; KEGG: bbe:BBR47_39720 hypothetical
FT                   protein; PFAM: Ketopantoate reductase ApbA/PanE domain
FT                   protein; SPTR: C4G9F6 Putative uncharacterized protein;
FT                   PFAM: Ketopantoate reductase PanE/ApbA"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67397"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYD3"
FT                   /protein_id="ADK67397.1"
FT                   /translation="MDVLVVGIGVIGSYLAHAACDAGNAVTVVARGRWGDTIRDRGLVI
FT                   HHHVQHKTTIDHPYVVDGIPQGERFDVAFSVMRQDQQIAALDQLEGIDADLLVLVGNNL
FT                   RAQELADRLRSHGHARRVLFGFQSTAGIRKADHVECVRWGATGLDVAPLHGEPTASDKN
FT                   LLARVFTGGYRPNWTHDFEDWLLYHAAAVLPMCFVSYLCGCDLRAASHELLRQMVAAQG
FT                   EGYALLARLGHPVAPEGNEGLLDGGLKTRMWLAVVWIVARTKIGTLCVDDHCRHAPDEM
FT                   RDLEVGFERIRGLAPDFPMPAWDALLARMGNWNEVCRRWGT"
FT   gene            316133..316630
FT                   /locus_tag="Olsu_0274"
FT   CDS_pept        316133..316630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0274"
FT                   /product="putative protein-S-isoprenylcysteine
FT                   methyltransferase-like protein"
FT                   /note="COGs: COG2020 Putative protein-S-isoprenylcysteine
FT                   methyltransferase; KEGG: apv:Apar_0213 putative
FT                   protein-S-isoprenylcysteine methyltransferase-like protein;
FT                   SPTR: B9CN26 Putative uncharacterized protein; PFAM:
FT                   Isoprenylcysteine carboxyl methyltransferase (ICMT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67398"
FT                   /db_xref="GOA:E1QYD4"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYD4"
FT                   /protein_id="ADK67398.1"
FT                   /translation="MARGESSHLPYAGVGPLYVAAIIVLTAMGVALSQLGLIPHTGWPV
FT                   PVVLRVALGIVLIALGIVVWLAAVLGAGIDEGIRENRLVTTGIYAWVRNPIYVAFGMAC
FT                   TGAIVMAGNVWLLVLPLLFWALLTALMRHTEERWLLDLHGSEYRAYCKCVNRCIPWPPC
FT                   WR"
FT   gene            complement(316782..317561)
FT                   /locus_tag="Olsu_0275"
FT   CDS_pept        complement(316782..317561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0275"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="COGs: COG0789 transcriptional regulator protein;
FT                   InterPro IPR009061:IPR000551:IPR012925; KEGG: ele:Elen_2496
FT                   transcriptional regulator, MerR family; PFAM: TipAS
FT                   antibiotic-recognition domain protein; regulatory protein
FT                   MerR; SMART: regulatory protein MerR; SPTR: C8WL72
FT                   Transcriptional regulator, MerR family; PFAM: MerR family
FT                   regulatory protein; TipAS antibiotic-recognition domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67399"
FT                   /db_xref="GOA:E1QYD5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYD5"
FT                   /protein_id="ADK67399.1"
FT                   /translation="MDESRPAGRHYSVGQLARMAGVSARTLRHYEDMGLLEPTRAENGY
FT                   RTYGPRDVRRLSQILAMRACSLPLTTIRRLLKDSQANLRDTLESHLKTLRAQEKSLTDA
FT                   IARTETAIAAIEGIENMDDEKRFGAIKAQSLKEFEGTYGIEARERYGNAAIDATNERIM
FT                   SLTRDEWDAKDLLEEAIKVQLRLAMASDDPKGDEAAELARMHERWIRIHWGEAYDRETH
FT                   LALVRGYLDDPRFRDYYDAAAGDGGTEFLVRALEANL"
FT   gene            complement(317789..318352)
FT                   /locus_tag="Olsu_0276"
FT   CDS_pept        complement(317789..318352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shi:Shel_17510 hypothetical protein; SPTR:
FT                   A8SJL7 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF2812)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67400"
FT                   /db_xref="GOA:E1QYD6"
FT                   /db_xref="InterPro:IPR021359"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYD6"
FT                   /protein_id="ADK67400.1"
FT                   /translation="MKTRVKKAFLDINEEEKWLNEQGAQGMMLLSYSNGTYEFEDVSPA
FT                   AFQYKVDIPQYSEKERRRDYLDFLEQTGASVVAEYADRVYLRKKASGEPFALYTDRQDV
FT                   ERQAKKRSSHLYAIGFSQIMLGIMFLMQAFLRHEGPVSFWIPAVFGFLFVVSGIVFLAL
FT                   GFRAGRKATKGQVPSREERDIWEA"
FT   gene            complement(318349..318675)
FT                   /locus_tag="Olsu_0277"
FT   CDS_pept        complement(318349..318675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0277"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="InterPro IPR011991:IPR005149; KEGG: shi:Shel_17520
FT                   transcriptional regulator, PadR family; PFAM:
FT                   transcriptional regulator PadR family protein; SPTR: A8SJL9
FT                   Putative uncharacterized protein; PFAM: Transcriptional
FT                   regulator PadR-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67401"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYD7"
FT                   /protein_id="ADK67401.1"
FT                   /translation="MGGSANQGALTETVFYILLRLHHPAHGYALMKDIGEMTDHRVSPG
FT                   AGTLYGALETLQKKGWVTPLEGRMDGRKKEYVITDEGRRVFERDVKRLEELLENARKLK
FT                   GELS"
FT   gene            318945..319115
FT                   /locus_tag="Olsu_0278"
FT   CDS_pept        318945..319115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0278"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hwa:HQ1103A hypothetical protein; SPTR: B9CNI4
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67402"
FT                   /db_xref="GOA:E1QYD8"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYD8"
FT                   /protein_id="ADK67402.1"
FT                   /translation="MCVSKSTIAVTVVLLILGAIAWIPIVLGLGALAAVACLTIWVLVA
FT                   SLWLADVSPMG"
FT   sig_peptide     318945..319043
FT                   /locus_tag="Olsu_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(319430..320131)
FT                   /locus_tag="Olsu_0279"
FT   CDS_pept        complement(319430..320131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ele:Elen_2509 hypothetical protein; SPTR:
FT                   C8WLK1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67403"
FT                   /db_xref="GOA:E1QYD9"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYD9"
FT                   /protein_id="ADK67403.1"
FT                   /translation="MRTTIQAELTATGRLLAQLLAVSTLVSVFVSVATQSVATGGAVPA
FT                   MTLMSYVFSTLAYDEANGWQGFRLTLPISRQNVVVGRYLASLAVAILSALLGAAVACAL
FT                   SAVASTLGADSYLAPLVLTEETHKTIWAVPALSVAAVLVMVDVMFPLGMRSGLTRAVRL
FT                   VPVVLCLLFVGGGTLVGNDGPLSAAMADIVAMIEGGGSVLPLVVGVVVIALVLHLVSML
FT                   ITVQLYARREL"
FT   sig_peptide     complement(320009..320131)
FT                   /locus_tag="Olsu_0279"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(320128..321006)
FT                   /locus_tag="Olsu_0280"
FT   CDS_pept        complement(320128..321006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0280"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439:IPR003593:IPR019825;
FT                   KEGG: ele:Elen_2508 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: C8WLK0 ABC
FT                   transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67404"
FT                   /db_xref="GOA:E1QYE0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYE0"
FT                   /protein_id="ADK67404.1"
FT                   /translation="MPDLLKIQGLTKSYGDFSLQKMELSVPDGHVVGLIGKNGAGKSTT
FT                   MKAVLGLIFPDAGHIELFGRADDDGPCVEVKRRIGVVLDSCPFPAEMTAADVGRLGRRA
FT                   FGSWRQGRFDTLLRDAGISATKKVRRLSRGMGMRLQLAFALAHEPDLLLLDEATSGLDP
FT                   LARDEVLDLLRDHMSHEGRGILMSSHITTDLEKLADIVVCIDGGRKVFEKTLEDICDTS
FT                   GIARCKSEDVERIMRAGLFGQGVLRILRNGYSSDVLVPDRKLLHDALPTVTCERASLDE
FT                   YMLLTLKGEAL"
FT   gene            complement(321052..321429)
FT                   /locus_tag="Olsu_0281"
FT   CDS_pept        complement(321052..321429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0281"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG1725 transcriptional regulator protein;
FT                   InterPro IPR000524:IPR011991; KEGG: ele:Elen_2507
FT                   transcriptional regulator, GntR family; PFAM: regulatory
FT                   protein GntR HTH; SMART: regulatory protein GntR HTH; SPTR:
FT                   C8WLJ9 Transcriptional regulator, GntR family; PFAM:
FT                   Bacterial regulatory proteins, gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67405"
FT                   /db_xref="GOA:E1QYE1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYE1"
FT                   /protein_id="ADK67405.1"
FT                   /translation="MDIVISNTSERPIYEQISSQVKEAILSGDLAAGQQLPSIRALAGD
FT                   LHVSVITTKRAYSDLESLGFIETVQGRGSFVARGNLELLREERLREVEGLLEQALADAS
FT                   AAGITVTDLHEMLDTLAEADM"
FT   gene            complement(321945..322742)
FT                   /locus_tag="Olsu_0282"
FT   CDS_pept        complement(321945..322742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0282"
FT                   /product="zinc/iron permease"
FT                   /note="COGs: COG0428 divalent heavy-metal cations
FT                   transporter; InterPro IPR003689; KEGG: apv:Apar_0715
FT                   zinc/iron permease; PFAM: zinc/iron permease; SPTR: C0EU85
FT                   Putative uncharacterized protein; PFAM: ZIP Zinc
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67406"
FT                   /db_xref="GOA:E1QYE2"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYE2"
FT                   /protein_id="ADK67406.1"
FT                   /translation="MDVSDSLSNLFVGLGLPLFGTTAGAAMVFLMRGNLSRTVSRILTG
FT                   FAAGVMVAASIWSLIIPAIESSGGMGRMAWVPAFVGFWVGIAFLLVLDSVIPHLHLGAS
FT                   KAEGPRSGLTRNSLMVLAVTLHNIPEGMAVGVAYAGLLAGSRALTAAGAFALSLGIAIQ
FT                   NFPEGAIISMPLRAGGDSKSRAFLGGFASGIVEPIGAVITIAAASQVTAALPHLLSFAA
FT                   GAMMYVVVEELIPEMSEGEHSNWGVIAFALGFTVMMALDVGLG"
FT   gene            complement(323049..323984)
FT                   /locus_tag="Olsu_0283"
FT   CDS_pept        complement(323049..323984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0283"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="COGs: COG1250 3-hydroxyacyl-CoA dehydrogenase;
FT                   InterProIPR016040:IPR008927:IPR013328:IPR006176:IPR 006108;
FT                   KEGG: msi:Msm_0965 3-hydroxybutyryl-CoA dehydrogenase;
FT                   PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein; SPTR:
FT                   A5ULU2 3-hydroxyacyl-CoA dehydrogenase, FadB; PFAM:
FT                   3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67407"
FT                   /db_xref="GOA:E1QYE3"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYE3"
FT                   /protein_id="ADK67407.1"
FT                   /translation="MDFKKVTVAGGGVLGSQIAFQSAFRGFDVTVWLRSDASIGRAKPK
FT                   FERLRTIYLQTLEAAKTNPAAWARGFGPERPDDAGIDALKEQVERAYASLKLTTSYDEA
FT                   ADADLVIESIAEDPAQKIAFYQELAKHLPERTVIATNSSTMLPSAFAEATGRPEKYLAL
FT                   HFANEIWRNNTGEVMGHAGTGQAYYDQVVEFAEAIGMVPLCLHKEQPGYILNSMLVPFL
FT                   NAAEALWANGVADPETIDKTWQLGTGAPAGPFRILDVVGLTTAYNIVIMDPRSKDPETV
FT                   QGKIASKLKAKIDAGETGVNAGKGFFDYHK"
FT   gene            324222..324590
FT                   /locus_tag="Olsu_0284"
FT   CDS_pept        324222..324590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0284"
FT                   /product="protein of unknown function DUF1304"
FT                   /note="COGs: COG3759 membrane protein; InterPro IPR009732;
FT                   KEGG: ssa:SSA_0815 hypothetical protein; PFAM: protein of
FT                   unknown function DUF1304; SPTR: A3CM41 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1304)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67408"
FT                   /db_xref="GOA:E1QYE4"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYE4"
FT                   /protein_id="ADK67408.1"
FT                   /translation="MDLVTIVLATLVAVEFLYIMYLEAFATTSEKTAQVFGMPVEELGR
FT                   DSVRTLFKNQGIYNGLVAVMVLVSVYLFASLPVIIMLMCFIILVALYGSLTSNPRIILM
FT                   QGGLAILTLLSAIWTLLV"
FT   gene            324874..325287
FT                   /locus_tag="Olsu_0285"
FT   CDS_pept        324874..325287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0285"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="COGs: COG0735 Fe2+/Zn2+ uptake regulation protein;
FT                   InterPro IPR002481; KEGG: ccu:Ccur_04330 Fe2+/Zn2+ uptake
FT                   regulation protein; PFAM: ferric-uptake regulator; SPTR:
FT                   C2D8Q8 Fur family transcriptional regulator; PFAM: Ferric
FT                   uptake regulator family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67409"
FT                   /db_xref="GOA:E1QYE5"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYE5"
FT                   /protein_id="ADK67409.1"
FT                   /translation="MARGSYNTRQRKAVQAFLQDHASRYLSVDDIYAMLREQGVEVGRT
FT                   TVYRTLEAFVGEGLVSKATMPDGGESRYRLVEPGHEEAGRLVCLDCGRVISIDCAAFQE
FT                   FSRHVRSDHDFDVDLARTVLYGRCSACRTGVAR"
FT   gene            325284..325466
FT                   /locus_tag="Olsu_0286"
FT   CDS_pept        325284..325466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_2438 hypothetical protein; SPTR:
FT                   Q2JA87 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67410"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYE6"
FT                   /protein_id="ADK67410.1"
FT                   /translation="MMAPFHVATDCTETARIAASRSTAGRAAMSVRSATTRTAAVRGAL
FT                   LAVLSPVALGVRLDI"
FT   sig_peptide     325284..325400
FT                   /locus_tag="Olsu_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            325539..326564
FT                   /locus_tag="Olsu_0287"
FT   CDS_pept        325539..326564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0287"
FT                   /product="periplasmic solute binding protein"
FT                   /note="COGs: COG0803 ABC-type metal ion transport system
FT                   periplasmic component/surface adhesin; InterPro
FT                   IPR006311:IPR006129:IPR006128:IPR006127; KEGG:
FT                   ccu:Ccur_04310 ABC-type metal ion transport system,
FT                   periplasmic component/surface adhesin; PFAM: periplasmic
FT                   solute binding protein; SPTR: C7MML4 ABC-type metal ion
FT                   transport system, periplasmic component/surface adhesin;
FT                   PFAM: Periplasmic solute binding protein family; TIGRFAM:
FT                   Tat (twin-arginine translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67411"
FT                   /db_xref="GOA:E1QYE7"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYE7"
FT                   /protein_id="ADK67411.1"
FT                   /translation="MRSSILGNINLSCTRRGMLGLSALAAGSILAGCSAAGMKGGSSDA
FT                   SGDAKLKVSASFYPMYDFAQKVGGDRVDVTCLVPAGTEPHDWEPSTSDIRAISETDVLV
FT                   YSGAGMEHWVSDVLDGISNDKLVTVEASDGVKLRELSAEAQAEEAEEHAHEGHDHDHGH
FT                   GEDASATDPHVWLAPLNAKTQLGNIRDALVKADPDGKETYDANFEKWAAELETLDSEFS
FT                   NGLTDLPNKTIVVSHEAFGYLCDAYGLTQMPIEGIEADSEPDAQQMAKIVEFVQANNVK
FT                   TIFSEELVSPKVAQAIADASGASVEELNPLEGLSDEELAAGEDYLSVMRSNLDALKKAL
FT                   S"
FT   sig_peptide     325539..325673
FT                   /locus_tag="Olsu_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            326564..327325
FT                   /locus_tag="Olsu_0288"
FT   CDS_pept        326564..327325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0288"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1121 ABC-type Mn/Zn transport systems
FT                   ATPase component; InterPro IPR003439:IPR003593:IPR017871;
FT                   KEGG: apv:Apar_1057 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: C8W7P4 ABC
FT                   transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67412"
FT                   /db_xref="GOA:E1QYE8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYE8"
FT                   /protein_id="ADK67412.1"
FT                   /translation="MTVGTSQGTHAPMSGTSVTDVPASDVSPSRVPPVTLEGVHFSYRG
FT                   EEVLRGADLTVGAGEICALVGDNGAGKSTIARLVVGELRPSRGGVRLFGRDPLHFRDWK
FT                   RVGYVPQLPSEAVSRFPASVFELVDASQCRSPRVGLASRRTRRRRSIEMLGRVGMADFG
FT                   RRLIRELSGGQLQRVRLACALVNDPRLLILDEPTTGLDSVSRSAFYSLVAEAHVSHGLA
FT                   ILLVTHDLDALPELDCSVVEVVDGLARKRGE"
FT   gene            327330..328133
FT                   /locus_tag="Olsu_0289"
FT   CDS_pept        327330..328133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0289"
FT                   /product="ABC-3 protein"
FT                   /note="COGs: COG1108 ABC-type Mn2+/Zn2+ transport systems
FT                   permease components; InterPro IPR001626; KEGG:
FT                   apv:Apar_1056 ABC-3 protein; PFAM: ABC-3 protein; SPTR:
FT                   C8W7P3 ABC-3 protein; PFAM: ABC 3 transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67413"
FT                   /db_xref="GOA:E1QYE9"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYE9"
FT                   /protein_id="ADK67413.1"
FT                   /translation="MLEYVFMQRGLLVGSLLGIAVPLVGVTIVLKRLSMIGDALSHTSL
FT                   AGVAGGLVAGASPVAGAIVACVGGALCIEGIRRKFKDQSELAVAVVMATGIGLAGVLSG
FT                   FVPNASSFNSFMFGSILTVTEGEVLSIVVVSVVSVALCVTLRRELFLMSFDERHARVVG
FT                   VPVGAANFVFVMVVALVVAVASRTVGSLIVSSMMVVPVACALQLARSWRQTCIIACSIG
FT                   VLTTVSGLVVSYYLGLKPGGTIVLAAVALLLLVLSAKKLAATLRR"
FT   gene            328402..330480
FT                   /locus_tag="Olsu_0290"
FT   CDS_pept        328402..330480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0290"
FT                   /product="putative collagen-binding protein"
FT                   /note="InterPro IPR008966; KEGG: shi:Shel_12040 putative
FT                   collagen-binding protein; SPTR: C7N5P7 Putative
FT                   collagen-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67414"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYF0"
FT                   /protein_id="ADK67414.1"
FT                   /translation="MRVTSNKKKLGFEILRGGALSVLLTVAMLAVATVAWAAGSSTDLK
FT                   DFITAVDVTGGTLNQDGSITVKPGTELTLGLSFEETSGLQFDNGSLTYDLPSGFDFAAQ
FT                   SGTFPMSITDGGGTTTMNVPYAISDGRLTVTWPTDDPTAYQKLVDAANAKFNISIKGTV
FT                   TDANGDVHFGGDVTKKFNLDDSHDVSIAKSGYVGDDGKIHYTVTVHSTGVNKNVHVTDS
FT                   ISGTALTYDSDSLAISGISSSYTGGTSGNGFDITIPIMRNGETATITYTATIDYSKITD
FT                   NGTAGQTGNKVTVETPDTPGKTESKDFANQISISTISKTGTAATSPTTSNGRTYRSVTW
FT                   NIDANKERRVSLAGKSISDQIAPESQGIMRYSGAGIRIDVYDESGSFKETRTLTWAQLG
FT                   VGDLSSATSWRYDVPSTDGKYEYKVSYTTDVDITDTLQSQTVKNNATEVTPNGDKSTDG
FT                   QATVNPAFNVDVKKKATKVSGTEVTWQFHVTVPKDGYTKLEATDILPNTYLNGQTVYDS
FT                   LVDGSIQVDGLASGESYSVDASETGKVRFVFYKDAAKTQPGAIGTGSERTITVTLKTRF
FT                   NEDWIDAVNNGTAQDYQKTHTNNVRVTANDVSKDASASVNPGLSHGITKGGDQSGTRHV
FT                   GEWDSGIDLPVYRYEVVLTGVSSDSFTITDSFDTSILEYYASDAHDAAHIYGGTQYG"
FT   sig_peptide     328402..328512
FT                   /locus_tag="Olsu_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            330526..331605
FT                   /locus_tag="Olsu_0291"
FT   CDS_pept        330526..331605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0291"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="COGs: COG4932 outer membrane protein; InterPro
FT                   IPR008966:IPR019931:IPR008454:IPR019948; KEGG:
FT                   shi:Shel_12040 putative collagen-binding protein; PFAM: Cna
FT                   B domain protein; Gram-positive anchor; SPTR: C7N5P7
FT                   Putative collagen-binding protein; TIGRFAM: LPXTG-motif
FT                   cell wall anchor domain protein; PFAM: Cna protein B-type
FT                   domain; TIGRFAM: LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67415"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYF1"
FT                   /protein_id="ADK67415.1"
FT                   /translation="MTINVSSLPKTSSGSYYSHYKLVYYLTVKDADALKALRQRATDNN
FT                   GKTTIDNTVNWDGNEGKRSIDYSYDFLGKNLTKWPNPSSNDRTASYTITLNPAGTDINP
FT                   DGDTLTLKDTMTNQVLDVSSIKATPSEGVTYDYDVATKTLTVTFPDATPVTLTYNATVI
FT                   GTGNVQYSNTASLSGQSKTTTQTGNFSSSGSGSASIPSIKLLKYAKGDLTKKLEGATFA
FT                   LYNADANGDIDRNNPVRDKDGSNVTFTSNSQGIVDIKGGQTTVGWTIEEGKTYYLVETQ
FT                   SPDGYKLDPTPIKFTVTDSPTEDDQYISGFTLQVANEEGSNGFVLPDTGGTGTVLSRMA
FT                   SLVLLAGAAFGLRRLRRGM"
FT   gene            331722..333257
FT                   /locus_tag="Olsu_0292"
FT   CDS_pept        331722..333257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0292"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="InterPro IPR019931:IPR001899:IPR008454:IPR019948;
FT                   KEGG: ere:EUBREC_1864 hypothetical protein; PFAM: Cna B
FT                   domain protein; Gram-positive anchor; SPTR: B1S7B6 Putative
FT                   uncharacterized protein; TIGRFAM: LPXTG-motif cell wall
FT                   anchor domain protein; PFAM: Cna protein B-type domain;
FT                   TIGRFAM: LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67416"
FT                   /db_xref="GOA:E1QYF2"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR032334"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYF2"
FT                   /protein_id="ADK67416.1"
FT                   /translation="MVRKSGLLKGALALLAVFLLAVALVPAAAFADTTTPHTITVSEPS
FT                   GQVDTHSYEAYQVFTGTYDSASKQLQGITWGSGVDGDALLAALKADAIIGSKFASATDA
FT                   VTAAAAMSGIIDKSVDAEALAKVVAAHLSSTKVTSANGKIDVVGDGYYLIKDASASLTS
FT                   DTYSKYILQVVGDTEVTAKDTTTTSKKEVKDTNDTTGVTSDWQNTADYDIGDAVPFKLT
FT                   GTVASDYADYPAPYYFAFHDKYVKTQLGDPQNVVVKIDGTEVDSSKYTVSTTSEGFDVV
FT                   FSDLKQTAAQAGSTITVEYTSELLTGANVGSAGNVNASNIEFSNDSNNDQHHGRTPDDT
FT                   VIVFTYKVVVNKANEASQPLAGAEFTLTKTMKDGSTKTIAVTTAQAGTQFNFTGLDDGE
FT                   YTLTETKTPEGYNTLDPIKFTVTSVKDDAGKTLVSINGVTTTGEIDLGTATQKASVDTT
FT                   AGTITTTVVNKSGSTLPSTGGMGTTVLYGLGALLVVGAGVGLYISRRKGHEEA"
FT   sig_peptide     331722..331814
FT                   /locus_tag="Olsu_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            333350..334198
FT                   /locus_tag="Olsu_0293"
FT   CDS_pept        333350..334198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0293"
FT                   /product="sortase family protein"
FT                   /note="COGs: COG3764 Sortase (surface protein
FT                   transpeptidase); InterPro IPR005754; KEGG: ssa:SSA_1631
FT                   sortase-like protein, putative; PFAM: peptidase C60 sortase
FT                   A and B; SPTR: A3CPB4 Sortase-like protein, putative;
FT                   TIGRFAM: sortase family protein; PFAM: Sortase family;
FT                   TIGRFAM: LPXTG-site transpeptidase (sortase) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67417"
FT                   /db_xref="GOA:E1QYF3"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYF3"
FT                   /protein_id="ADK67417.1"
FT                   /translation="MKRHLSTILLAFALLVGMGLLVYPSASDWWNSFHQSQAIAGYIRQ
FT                   VESNPDEENQAIWDAAVAYNQGLDTSDGRFVLSSEEKEVYEGMLDVTGTGIMGYVSIPK
FT                   ISVSLPIYHGTDDTVLQIAIGHIPGSSLPVGGEGTHTVISGHRGLPSARLFTDIDQLAE
FT                   GDHFVLHVLGRTLTYEIDQILTVPPDDLDALGIEGRQDLCTLVTCTPYGVNTHRLLVRG
FT                   HRVPNDPEPSDGDVRTIGCLPFVGAFAGAGLVILVTTGLARRKRGKPHDGPRHARRMGR
FT                   R"
FT   sig_peptide     333350..333427
FT                   /locus_tag="Olsu_0293"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            334203..335159
FT                   /locus_tag="Olsu_0294"
FT   CDS_pept        334203..335159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0294"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR008970; KEGG: bad:BAD_1552 collagen
FT                   adhesin precursor; SPTR: C0CPW4 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67418"
FT                   /db_xref="GOA:E1QYF4"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYF4"
FT                   /protein_id="ADK67418.1"
FT                   /translation="MFTSRRKVGPGGHVAHAVVAVLCAMAIVLTLGMPARAAAAEASIV
FT                   VENCPVDGRTVTAYRVADMDSSYSSWSAVAALSGLAGETGIDLSALGEGTTAAELQSVA
FT                   QTLVGYVSANPNGFGSATATVRDGKAALTKLEPGLYLVTIENVTSGGVSYVFEPHLVAA
FT                   PGWDGGTFSFDRIVQAKYIKEPAKEFANHVTKVWSGDSGSVRPKSVIVDIYDGSQLYRT
FT                   VELHEGNGWSFSWDGEGDWSVKERMDGMGPYTSRIASSVKTDGARMDTSITVTNSYVGP
FT                   PAPGRLAQTGDGTDPLPALGLLVAAGVLVAVGVRVRR"
FT   sig_peptide     334203..334319
FT                   /locus_tag="Olsu_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            335298..336356
FT                   /locus_tag="Olsu_0295"
FT   CDS_pept        335298..336356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0295"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /EC_number="1.1.1.2"
FT                   /note="COGs: COG1063 Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenase;
FT                   InterProIPR011032:IPR016040:IPR002328:IPR013154:IPR 013149;
FT                   KEGG: apv:Apar_1228 alcohol dehydrogenase zinc-binding
FT                   domain protein; PFAM: Alcohol dehydrogenase zinc-binding
FT                   domain protein; Alcohol dehydrogenase GroES domain protein;
FT                   SPTR: C8W864 Alcohol dehydrogenase zinc-binding domain
FT                   protein; PFAM: Alcohol dehydrogenase GroES-like domain;
FT                   Zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67419"
FT                   /db_xref="GOA:E1QYF5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYF5"
FT                   /protein_id="ADK67419.1"
FT                   /translation="MKGYAMLKIGESGWIEKDVPKCGPLDAIVKPLAVAICTSDVHTLW
FT                   EGAIGDRHDMILGHEASGEVVEVGSEVKDFKPGDRVLVPAITPDWNSLEAQAGYSMHSG
FT                   GMLAGWKFSNFKDGVFSEFFHVNDADGNLAHMPEGMDPADACILSDMVPTGFHAVELAD
FT                   VQFGDTVLVVGIGPVGLMSVAGAALRGASRIIAVGTRPVCVEAAKGYGATDFISYKDGP
FT                   IDEQVMELTGGKGVDRVCMAGGGVETFEPAVKCLKPGGKIGNVNYLGSGDYVNIPRVEW
FT                   GVGMGHKDIRGGLMPGGRLRMEKLSSLVTAGKLDLHPEVTHLFHGWDRIEEALFLMRDK
FT                   PADLIKPVVAID"
FT   gene            336537..337550
FT                   /locus_tag="Olsu_0296"
FT   CDS_pept        336537..337550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0296"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="COGs: COG0523 Putative GTPase (G3E family); InterPro
FT                   IPR003495; KEGG: apv:Apar_1227 cobalamin synthesis protein
FT                   P47K; PFAM: cobalamin synthesis protein P47K; SPTR: C8W863
FT                   Cobalamin synthesis protein P47K; PFAM: CobW/HypB/UreG,
FT                   nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67420"
FT                   /db_xref="GOA:E1QYF6"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYF6"
FT                   /protein_id="ADK67420.1"
FT                   /translation="MKVLVVSGFLGAGKTTFIQELIRRTGQDAVIYENEYGEADVDARR
FT                   LRSGSDLKVWESVENCICCSGKQDFATSVLTISNMLDPEYLIVEPTGVARLSRVMENLA
FT                   QVAWERIELLAPVTIVDAGAWEAQRRNAPEVFDDQARSAATIVASKAGAVGAAEAVARL
FT                   AAELNPGAELVTGAWRKLPDEWWSSLLARAIGGGTAMDGVAEDGLSRDAGANASDELET
FT                   MALDHVSLPTPGHLLWILDALSAGVFGRLDRAKGALSCGGQWVRFDLVERAWAVTGAEE
FT                   AEGARCVFIGRDLYRNGLREVFVPALWRDEAETFHHHDHGYDHHDHACDHTMERRR"
FT   gene            complement(338323..340596)
FT                   /locus_tag="Olsu_0297"
FT   CDS_pept        complement(338323..340596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0297"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="COGs: COG1882 Pyruvate-formate lyase; InterPro
FT                   IPR005949:IPR001150:IPR019777:IPR004184; KEGG:
FT                   ere:EUBREC_0469 hypothetical protein; PFAM: pyruvate
FT                   formate-lyase PFL; formate C-acetyltransferase glycine
FT                   radical; PRIAM: Formate C-acetyltransferase; SPTR: C4GDR0
FT                   Putative uncharacterized protein; TIGRFAM: formate
FT                   acetyltransferase; PFAM: Glycine radical; Pyruvate formate
FT                   lyase; TIGRFAM: formate acetyltransferase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67421"
FT                   /db_xref="GOA:E1QYF7"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYF7"
FT                   /protein_id="ADK67421.1"
FT                   /translation="MQLREEWGGFTGGHWVDDVNVRDFIQRNYSAYDGDESFLAGPTDA
FT                   TDRLWGKVQQLQAEERAKGGVLDCETEVVSGLTAYGPGYIDPELKDLERVVGLQTDKPL
FT                   KRAFMPYGGIKMAQQAAENYGYHVDDKYDKIFNEYHKTHNQAVFDAYTPEMRAARHSHI
FT                   VTGLPDTYGRGRIVGDYRRVALYGIDFLIAKKQQDLLDCGDGTMTDDIIRLREEIAEQI
FT                   RALRGIKDMAQIYGYDISRPATNAREAFQWLYFGYLAAIKTQNGAAMSVGRISTFLDIY
FT                   IERDLAAGILSEQEAQELVDHIVLKFRMVKFARIPSYNELFSGDPVWATLEMAGLGMDG
FT                   RHMVTKNDFRFLHTLENMGPAPEPNLTVLYSNRLPVAFRQYAAKVSINTSSVQYENDDV
FT                   MRPVWGDDYSICCCVSATQTGKEMQFFGARANLAKCLLYSMNGGKDVKFRDKKTGKNMQ
FT                   VGPEIAPITSELLDYGEVMHKFDLMMDWLAGLYVNILNLIQYMHDKYYYEAAEMALIDT
FT                   DVRRTFATGIAGFSHVVDSLSAIKYATVRCVRDEDGMIVDFETEGDFPRYGNDDDRADD
FT                   IAVWLLKTFMGKIRKHHTYRDSEPTTSILTITSNVVYGKATAATPDGRKAYTPFAPGAN
FT                   PAYGAEQNGLLASLNSVAKLPYEYALDGISNTQTINPSALGNDLDQRKANLVNVMDGYF
FT                   AAGAHHLNVNVFGVEKLKDAMEHPEKPEYANFTIRVSGYAVKFIDLTREQQLDVIARTC
FT                   HDRM"
FT   gene            complement(340597..341358)
FT                   /locus_tag="Olsu_0298"
FT   CDS_pept        complement(340597..341358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0298"
FT                   /product="pyruvate formate-lyase activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterPro IPR012838:IPR001989:IPR007197; KEGG:
FT                   lrl:LC705_01439 formate C-acetyltransferase activating
FT                   enzyme (pyruvate formate-lyase activating enzyme); PFAM:
FT                   Radical SAM domain protein; PRIAM:
FT                   [Formate-C-acetyltransferase]-activating enzyme; SPTR:
FT                   A7B375 Putative uncharacterized protein; TIGRFAM: pyruvate
FT                   formate-lyase activating enzyme; PFAM: Radical SAM
FT                   superfamily; TIGRFAM: pyruvate formate-lyase 1-activating
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67422"
FT                   /db_xref="GOA:E1QYF8"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYF8"
FT                   /protein_id="ADK67422.1"
FT                   /translation="MLGRVHSTESFGSADGPGVRFLIFLQGCPMRCRYCHNVDTWPLDK
FT                   GSETSADDLLDKAERYRGYWGPQGGITVSGGEALLQAEFVLELFTKAHERHVNTCLDSS
FT                   LAPFTRTSPFFDTFVQLMGVTDLVLADIKHIDAQEHRSLTGHGNENILDCLRYLSEARV
FT                   PVWIRHVLVPGITDNDGYLRRTRGFIETLDNVERIEVLPYHSLGAYKWEQLNIPYTLGG
FT                   VQPPSHERVINAERILRGEQDVPLDNEAKEA"
FT   gene            complement(341559..342287)
FT                   /locus_tag="Olsu_0299"
FT   CDS_pept        complement(341559..342287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0299"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="COGs: COG0664 cAMP-binding protein - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinase; InterProIPR018490:IPR000595:IPR012318:IPR001808:IPR
FT                   014710:IPR011991; KEGG: dhd:Dhaf_1167 transcriptional
FT                   regulator, Crp/Fnr family; PFAM: cyclic nucleotide-binding;
FT                   regulatory protein Crp; SMART: cyclic nucleotide-binding;
FT                   regulatory protein Crp; SPTR: Q24PT1 Putative
FT                   uncharacterized protein; PFAM: Cyclic nucleotide-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67423"
FT                   /db_xref="GOA:E1QYF9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYF9"
FT                   /protein_id="ADK67423.1"
FT                   /translation="MPMTSRGTAQSKGTPCARHDKGAACMDNIRMFAGLPAEAKRELLA
FT                   SARHSSHPRGSILVHEGDPIESILIVRSGRIKTFRTDSDGEEYVLDVLHDGQAIWHGMF
FT                   IEDNVYHYSVGCLSKVDLCSIHRTDFEALLASHPDVAMGIIRMIGTELVDAEEKVMILG
FT                   IRDPRRRLAEYLLHRDARCIGSEINLKLEDIASSVGLRPETVSRNISAFEHEGVVRRLG
FT                   RGRLQVVDRVALKEISEHPE"
FT   gene            342505..343395
FT                   /locus_tag="Olsu_0300"
FT   CDS_pept        342505..343395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0300"
FT                   /product="protein of unknown function DUF548"
FT                   /note="InterPro IPR007536; KEGG: shi:Shel_17290 protein of
FT                   unknown function (DUF548); PFAM: protein of unknown
FT                   function DUF548; SPTR: B6G8Z9 Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function (DUF548)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67424"
FT                   /db_xref="GOA:E1QYG0"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYG0"
FT                   /protein_id="ADK67424.1"
FT                   /translation="MGKRGVDAVLAKRASDRQRASSLACGLGVPVCLDPDELGPETTLL
FT                   VVGAEGLSLEWDGMVLRGDFSRMARRLRPSGLSHELLVRAARVRGHRQVAPSRGETPEP
FT                   SSRIGAGSRVPWAIDATAGMGEDSLLLAAAGFSVDLYERDPVIAALLRDALERAAEDPL
FT                   LAGAIGRMRLHEEDSVPVLEGLACTGPSVGRGPGGPTLSPPDVVFLDPMFPTRQKSASA
FT                   KKKLRMIQRLEEPCDAEGRLVGAALAAGPRKVVVKRPLKGPCLGGVKPAYALAGKAVRY
FT                   DCLIPASMRYDLHNI"
FT   gene            343870..344964
FT                   /locus_tag="Olsu_0301"
FT   CDS_pept        343870..344964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0301"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: cbe:Cbei_4690 membrane
FT                   spanning protein; PFAM: protein of unknown function DUF6
FT                   transmembrane; SPTR: A6M2G8 Membrane spanning protein;
FT                   PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67425"
FT                   /db_xref="GOA:E1QYG1"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYG1"
FT                   /protein_id="ADK67425.1"
FT                   /translation="MEEASAIGVARRKKRELDASFFKKGILVALFSSLMYGFYTAFITA
FT                   GESSSLWLGWLQAISPTAFLAVFILPTVASAINDSCSALWALGITAKQGKLADFGRTVN
FT                   TKPGVILILSALVGGPIATVAYIIALSQAGTIVVPIAALNPAIGSILSRILYKQELGPR
FT                   KIAGIAICVVAGLMIGSASLTGDSSSNIVLGLVLAFVAALGWGAEGCIAGYASCMIDTQ
FT                   IGITIRQCVSGIVELLVVLPVLSLVGGVSLQQTFGYVGAAITDLPTIVCFAVAGFSAYK
FT                   SFASWYRGNSMCGTALGMACNGTYTFVAPLVTWIIVGLVMGVDGYALAPIAWVAAIVMI
FT                   VGILVIAVDPKELFGKKEAENASA"
FT   gene            344951..345214
FT                   /locus_tag="Olsu_0302"
FT   CDS_pept        344951..345214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_4689 hypothetical protein; SPTR:
FT                   C6BX51 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67426"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYG2"
FT                   /protein_id="ADK67426.1"
FT                   /translation="MRPLNYAMLKYFTTAGEACVDDVMTALKGDYSSFSAFKRDKMQEA
FT                   LMTAEKNGLIAESRVDLDSNGDLRVFYSATPEQRDTINSYIQ"
FT   gene            345225..345524
FT                   /locus_tag="Olsu_0303"
FT   CDS_pept        345225..345524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0303"
FT                   /product="microcompartments protein"
FT                   /note="COGs: COG4577 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein; InterPro IPR000249;
FT                   KEGG: cbk:CLL_A1450 propanediol utilization protein PduA;
FT                   PFAM: microcompartments protein; SPTR: B2TJR1 Propanediol
FT                   utilization protein PduA; PFAM: BMC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67427"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYG3"
FT                   /protein_id="ADK67427.1"
FT                   /translation="MRYRGEEAIGLIETIGMVPAIYAADAMLKAGDTELVSYENVGSTL
FT                   VTIVVKGDVAACEAAVKAGREAASSIGKLTASNVMKRPVPPIGDVVSVHDVDFN"
FT   gene            345536..345847
FT                   /locus_tag="Olsu_0304"
FT   CDS_pept        345536..345847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0304"
FT                   /product="microcompartments protein"
FT                   /note="COGs: COG4577 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein; InterPro IPR000249;
FT                   KEGG: dde:Dde_3284 carbon dioxide concentrating mechanism
FT                   protein (PduA related)-like; PFAM: microcompartments
FT                   protein; SPTR: C0D5P4 Putative uncharacterized protein;
FT                   PFAM: BMC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67428"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYG4"
FT                   /protein_id="ADK67428.1"
FT                   /translation="MASEGMNALGAIETFGLVWVLEAGDAMCKAGDVELIGYENTASGY
FT                   ISILVQGDVAACEAAVKAGVKAVEELGAEVYSSVVIPRPHPSLKKITEKYTVEKLLPY"
FT   gene            345859..347403
FT                   /locus_tag="Olsu_0305"
FT   CDS_pept        345859..347403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0305"
FT                   /product="aldehyde-alcohol dehydrogenase"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR016161:IPR016163; KEGG: aoe:Clos_2399
FT                   aldehyde-alcohol dehydrogenase; SPTR: A8MJE9
FT                   Aldehyde-alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67429"
FT                   /db_xref="GOA:E1QYG5"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYG5"
FT                   /protein_id="ADK67429.1"
FT                   /translation="MSLIDNDLLSIQEARILLEHAAESVEVLEGLPAALVDDFLCHLGE
FT                   RLVPMVGEYAQEAYAESDYCSPEDEATLTRWVLTDLLDDVRAQTPVQRIIRSRNGSAEV
FT                   CLPKGVVVSLLPDWLAVPTMLSQLFMAAHSKSPIVFSASARIHATCERVMADVLEVAEF
FT                   CHYPCEALGFLSIFCPEGEEWVCSQPCVRVVIDSREESGGHDFDAAGRDVYHATLGNNP
FT                   VFVESSADLAACADEIVRGKSFCYGMLPGAEQSIVVERDVDEDFQSELRRRGCYFLSDE
FT                   QADRLVDALFMPDGTPYRELIAKSAFDLARRADITVPESTKVLVVEKPYVSEYSFFSKA
FT                   KFGPVLSYYVEDSWRTACEKCIELILNSGHGNALSIFSKDPEVIRQFILKKPVGRVLVN
FT                   VSTGLGCIGCHSDLPKTLTVTGWDCATTSELGVTYGDFVRRRQVGVGTGPLSHELLERA
FT                   SSCDHTPVTVRIRIPDPGGPHDEGLMGSAEAGKEPESSESWFSGVVKAMRNDSEEE"
FT   gene            347406..349949
FT                   /locus_tag="Olsu_0306"
FT   CDS_pept        347406..349949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0306"
FT                   /product="Formate C-acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="COGs: COG1882 Pyruvate-formate lyase; InterPro
FT                   IPR001150:IPR019777:IPR004184; KEGG: cpy:Cphy_1417 formate
FT                   C-acetyltransferase; PFAM: pyruvate formate-lyase PFL;
FT                   formate C-acetyltransferase glycine radical; PRIAM: Formate
FT                   C-acetyltransferase; SPTR: A9KPD0 Formate
FT                   C-acetyltransferase; PFAM: Glycine radical; Pyruvate
FT                   formate lyase; TIGRFAM: pyruvate formate-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67430"
FT                   /db_xref="GOA:E1QYG6"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="InterPro:IPR030897"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYG6"
FT                   /protein_id="ADK67430.1"
FT                   /translation="MDIKEFAKELSEATKDMSDEQRATVRQMFEKVANQLDAPLGEAPA
FT                   HGAGSEPYDVPEGPTDRQVRLKENFLKQVPSITMYRARAVTEIMKANPGMPRIELRAKA
FT                   FRRCCETAPLVIQDDELVVGAPCGAPRAGAFSPDLAWRWLRDELDTIGERPQDPFYISE
FT                   EDKQYCRDVLFPFWEGKSQDEVCEDQYREAGVWTLSGESFVSDCSYHAMSGGGDSNPGY
FT                   DVILMRKGMLDIQEEAKQHLAQLDYANPDDLDRIYFYKSVLDTTEGVMIYAKRMSDYAA
FT                   KLAGECHDARRKAELEQISKILAYVPAHRPRTFWEAVQSVFVIESLLPVEENQTGMSIG
FT                   RVDQYMYPFYKADIEAGRITPYQAFDIAGCMLIKMSEMMWVTSRGQSEFFAGYQPFVNM
FT                   TLGGVTRQGHDATNELTYLLMDAVRHVKVYQPSVACRINNKSPEKYMRKIVDIVRSGMG
FT                   FPACHFDDSHIKMMLAKGVSVEDSRDYCMMGCVEPQKSGRLYQWTSTSYTQWPICIELT
FT                   LNHGVPLWFGKQVTPDLGDPSQYKTYEEFDEAVKKTIYYVTKWTDVATVISQRVARDVA
FT                   PKPLMSIMFEGCMESGKDVSAGGAMYNYGPGVVWTGLATYADSMAAIKKLVFEDHKYTL
FT                   TQLFDAMKADFEGFEQLRKDCLDAPKYGNDDDFADSIAADIVDYTEHIHLDFKTLYSHM
FT                   STGTLSISNNTPFGEMTGASANGRKAWTPLSDGISPTQGADFRGPTAIIKSVSKLSNDS
FT                   MNIGMVHNFKLMSGLLDTPEGENGLVTLLRTASMFGNGEMQFNYLDNKTLIDAQEHPER
FT                   HRDLVVRVAGYSAFFNELCKDVQDEIISRTMLEKF"
FT   gene            350013..350957
FT                   /locus_tag="Olsu_0307"
FT   CDS_pept        350013..350957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0307"
FT                   /product="glycyl-radical enzyme activating protein family"
FT                   /EC_number="1.97.1.4"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterProIPR012839:IPR017896:IPR011352:IPR017900:IPR
FT                   000169:IPR001989:IPR007197:IPR001450; KEGG: cpy:Cphy_1418
FT                   glycyl-radical activating family protein; PFAM: Radical SAM
FT                   domain protein; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; PRIAM:
FT                   [Formate-C-acetyltransferase]-activating enzyme; SPTR:
FT                   A9KPD1 Glycyl-radical enzyme activating protein family;
FT                   TIGRFAM: glycyl-radical enzyme activating protein family;
FT                   PFAM: Radical SAM superfamily; TIGRFAM: glycyl-radical
FT                   enzyme activating protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67431"
FT                   /db_xref="GOA:E1QYG7"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR030905"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYG7"
FT                   /protein_id="ADK67431.1"
FT                   /translation="MSHEQSSVERKVRIFNLQKYNMYDGPGVRSMAFLKGCPLRCKWCS
FT                   NPESQQRGHEVMFKRANCVDCGACVAACPVNVHKMIDGRHVVDRSIPCIGCRKCEKACM
FT                   YHALEVMGDDRTIDDVIAFFDEDADFYRMSGGGITLSGGEVLAQPEAALSILMAAKARG
FT                   YHTAIETCGYASAPTIMKVARYVDLFLFDIKQMDPVKHKYWTGVNNEQILSNVRELLEN
FT                   GYNVRVRMPLLKGVNDSKEEIDAVIAFFKPYRYQKNFDGVDLLPYHKLGVGKYASLDLD
FT                   YEIKDDPSLDDGELNRIEGWIKGADFKVNLVRH"
FT   gene            351015..351638
FT                   /locus_tag="Olsu_0308"
FT   CDS_pept        351015..351638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: drm:Dred_3274 hypothetical protein; SPTR:
FT                   A4J9M1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67432"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYG8"
FT                   /protein_id="ADK67432.1"
FT                   /translation="MHYVTEDELREAYAREAFGSYELPEDARLTPGARQFLIDFRVRFE
FT                   ADASRAGSRVRPHEGPGATHREDGVGLDALVYDANLLGARLRLLARRTLGVDNTVAREA
FT                   EGIGRKWQEACVAGDLADGEQEPGQCESPLGPAPVPALDAGIHPVFFEMACVHAQIGRY
FT                   ARSWAGAQEGMGPTEARVVRCWLADAACACALLEGAIARAEGEV"
FT   gene            351642..352490
FT                   /locus_tag="Olsu_0309"
FT   CDS_pept        351642..352490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0309"
FT                   /product="ethanolamine utilization protein EutJ family
FT                   protein"
FT                   /note="COGs: COG4820 Ethanolamine utilization protein
FT                   possible chaperonin; InterPro IPR013366:IPR018181; KEGG:
FT                   aoe:Clos_2393 ethanolamine utilization protein EutJ family
FT                   protein; SPTR: A8MJE3 Ethanolamine utilization protein EutJ
FT                   family protein; TIGRFAM: ethanolamine utilization protein
FT                   EutJ family protein; PFAM: MreB/Mbl protein; TIGRFAM:
FT                   ethanolamine utilization protein EutJ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67433"
FT                   /db_xref="InterPro:IPR013366"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYG9"
FT                   /protein_id="ADK67433.1"
FT                   /translation="MVDLERANRRLEELLDCVDHPRTVREGQRLYCGLDLGTAFIVLVV
FT                   LDEDGNPVDCKYRFASVVKDGMVVDYVGACDIARALKEEAEKELGAELVECAVAIPPET
FT                   EALDGGVVRNVAESTGLECTAVFDEPTAANLLIGTTDGAVVDIGGGTTGISVFKDGKVV
FT                   ECVDESTGGTHFSLVLAGAKGLSFDEAEVYKRDPGHHAEVLPIVSPTIDKVTTIIQRAC
FT                   RSHDVPEVILVGGTAELTGIEDRVQRHLGIDVHKPSHPMFVTPMGIALGCVLKARGRED
FT                   G"
FT   gene            352483..352788
FT                   /locus_tag="Olsu_0310"
FT   CDS_pept        352483..352788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0310"
FT                   /product="microcompartments protein"
FT                   /note="KEGG: amt:Amet_3830 microcompartments protein; SPTR:
FT                   C2CIJ4 Microcompartments protein; PFAM: BMC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67434"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYH0"
FT                   /protein_id="ADK67434.1"
FT                   /translation="MVDVRVIKAPAPGTMQIIRQRSGARWGEDFRPAAVGLVQGKLIEM
FT                   VVASDIAEKTAGVVVTDIRGSCPQNMVMLAIAGETAEVMECLGKIRDGKDATHDCR"
FT   gene            352775..353044
FT                   /locus_tag="Olsu_0311"
FT   CDS_pept        352775..353044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0311"
FT                   /product="Ethanolamine utilization protein EutN/carboxysome
FT                   structural protein Ccml"
FT                   /note="COGs: COG4576 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein; InterPro IPR004992;
FT                   KEGG: aoe:Clos_2392 ethanolamine utilization protein
FT                   EutN/carboxysome structural protein CcmL; PFAM:
FT                   Ethanolamine utilization protein EutN/carboxysome
FT                   structural protein Ccml; SPTR: C7HVW9 Carbon dioxide
FT                   concentrating mechanism protein CcmL; PFAM: Ethanolamine
FT                   utilisation protein EutN/carboxysome"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67435"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYH1"
FT                   /protein_id="ADK67435.1"
FT                   /translation="MIVGRLIGSIWATRKYDELSGMKLMRVEVIAGDEAGKQLICVDTI
FT                   SAGVGDRVIVTTGASAYLFVRDEFQKNVPVDAVIVGIIDEDVNL"
FT   gene            353062..353964
FT                   /locus_tag="Olsu_0312"
FT   CDS_pept        353062..353964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0312"
FT                   /product="Propanediol utilization protein"
FT                   /note="COGs: COG4869 Propanediol utilization protein;
FT                   InterPro IPR008300; KEGG: cpy:Cphy_1429 propanediol
FT                   utilization protein; PFAM: Propanediol utilization protein;
FT                   SPTR: C5EE91 Propanediol utilization protein; PFAM:
FT                   Propanediol utilisation protein PduL"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67436"
FT                   /db_xref="GOA:E1QYH2"
FT                   /db_xref="InterPro:IPR008300"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYH2"
FT                   /protein_id="ADK67436.1"
FT                   /translation="MKKLVSAQDVVSAAERHESIYVDGNTIVTPQARDVAKERGVCIQG
FT                   GPAAVRPTHGSPETCHEAGLPHEEEGGEPVLSADELERVITAALERGIWTKDDIEGLFG
FT                   REGHSADPDVVPVGVSGRHIHLSQGDLERLFGTGHQLTPIKDLSQPGQFAAKECVTLAG
FT                   PKGVIQKVRVLGPVRPQTQVEILAGDTFKLGVPQAIRLSGHLEGTPGVTVVGPEGSVVL
FT                   DEGVIVAARHIHMNPAQAAERGFHDGQVVSLKIDGERGGLLDNVIVRVTEGGNLDCHID
FT                   TEEANAFHVKCGSTVRVVR"
FT   gene            354009..354293
FT                   /locus_tag="Olsu_0313"
FT   CDS_pept        354009..354293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0313"
FT                   /product="microcompartments protein"
FT                   /note="COGs: COG4577 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein; InterPro
FT                   IPR020808:IPR000249; KEGG: cpy:Cphy_2641 microcompartments
FT                   protein; PFAM: microcompartments protein; SPTR: A9KMZ1
FT                   Microcompartments protein; PFAM: BMC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67437"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYH3"
FT                   /protein_id="ADK67437.1"
FT                   /translation="MASTTEALGMIETKGMVGAVEAADAMVKAANVRLVGKERVGGGLV
FT                   TVFVRGDVGAVKAATDAGAAAAQRVGELLSVHVIPRPDGMVESILPHAE"
FT   gene            354369..354656
FT                   /locus_tag="Olsu_0314"
FT   CDS_pept        354369..354656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0314"
FT                   /product="microcompartments protein"
FT                   /note="COGs: COG4577 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein; InterPro
FT                   IPR020808:IPR000249; KEGG: dsa:Desal_0472 microcompartments
FT                   protein; PFAM: microcompartments protein; SPTR: C6BX59
FT                   Microcompartments protein; PFAM: BMC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67438"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYH4"
FT                   /protein_id="ADK67438.1"
FT                   /translation="MASTTEALGMIETKGMVGAVEAADAMVKAANVRLVGKERVGGGLV
FT                   TVFVRGDVGAVKAATDAGAAAAQRVGELLSVHVIPRPDGMVESILPQAEA"
FT   gene            354988..355272
FT                   /locus_tag="Olsu_0315"
FT   CDS_pept        354988..355272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0315"
FT                   /product="microcompartments protein"
FT                   /note="COGs: COG4577 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein; InterPro
FT                   IPR020808:IPR000249; KEGG: cpy:Cphy_2641 microcompartments
FT                   protein; PFAM: microcompartments protein; SPTR: C7HVW6
FT                   Ribonuclease III; PFAM: BMC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67439"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYH5"
FT                   /protein_id="ADK67439.1"
FT                   /translation="MANIIEALGMIETKGMVGAVEAADAMVKAANVRLVGKERVGGGLV
FT                   TVFVRGDVGAVKAATDAGAAAAQRVGELLSVHVIPRPDGMVESILPHAE"
FT   gene            355318..356979
FT                   /locus_tag="Olsu_0316"
FT   CDS_pept        355318..356979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0316"
FT                   /product="acetaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.10"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR013357:IPR016161:IPR016162; KEGG: cbk:CLL_A1465
FT                   acetaldehyde dehydrogenase (acetylating); SPTR: C2CIJ9
FT                   Aldehyde dehydrogenase (NAD+); TIGRFAM: acetaldehyde
FT                   dehydrogenase (acetylating); PFAM: Aldehyde dehydrogenase
FT                   family; TIGRFAM: acetaldehyde dehydrogenase (acetylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67440"
FT                   /db_xref="GOA:E1QYH6"
FT                   /db_xref="InterPro:IPR013357"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYH6"
FT                   /protein_id="ADK67440.1"
FT                   /translation="MQEYDYDLQSVQAARDLARKGQVAANQIANYSAEQIDRILCAMVE
FT                   VAEKNAVELAEMAVEETTFGNVHDKIYKNHMASGLLYEQIKDQKTIGVIDVDEKRQVIT
FT                   IAEPVGLVMGIVPSTNPTSTVLYKSMIAIKARNAIVFSPHPKAAKCTNLAIRLMNDAAV
FT                   AAGAPENVIQGVSMATIAATDELMHAPEVKMIIATGGPGMVKAAYSSGKPALGVGAGNS
FT                   PSYIERTANVHDAVRQIMASKTFDNGTICASEQSVICETCNRDEVVAEFRKQGGYFMSE
FT                   GECDKVCRILFRNGHSMSPNFVGHAAADIAKAAGIVVPADTRVLIGEQHGVGDRWPLSY
FT                   EKLTTVLGFYVVSDWHEACDLSIALLQNGIGHTMNIHTEDKEIVRKFSIKPASRILINT
FT                   GGTQGGTGLSTGLDVALTLGCGTWGGSSVSENVGPQHLINIKRVANGTVEPDQVAAADE
FT                   TFAKWHPELAAEYGCVSRAQGCDHATSPCGVPTKEAEVGIETPVGHGTSGISYSVGCNS
FT                   CSGKATQEPTQRTDDTIDAAELKRMVDELVAAFRGE"
FT   gene            356993..357784
FT                   /locus_tag="Olsu_0317"
FT   CDS_pept        356993..357784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0317"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="InterPro IPR011717:IPR019734:IPR011990:IPR013026;
FT                   KEGG: ter:Tery_3497 peptidase-like; PFAM: Tetratricopeptide
FT                   TPR_4; SPTR: C7HVW3 Putative uncharacterized protein; PFAM:
FT                   Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67441"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYH7"
FT                   /protein_id="ADK67441.1"
FT                   /translation="MDLSAFYSDLDRLYGEPGTDVKGFLREALRRARLAGDRSAEASVS
FT                   NELGSVLRLRGDLHESEELYVEVLRMLDELSAEGAEVARALVNLGDVYVAQGRNVAAID
FT                   AFDRAEALLGEGHPYEVSAICNNRSSAYRARGRFREARADLRRARHLLERVPNSEGRRA
FT                   TNAVNLAQVLTDEGRLEEAQEVIAGALETYETLGAGRDVHRPHALSTAARIAYLRGGYA
FT                   AAAALYRKAAEVLRDKLGDAPNVRLLERRAGQMDALDASAK"
FT   gene            357860..358801
FT                   /locus_tag="Olsu_0318"
FT   CDS_pept        357860..358801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0934 hypothetical protein; SPTR:
FT                   Q3A620 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67442"
FT                   /db_xref="InterPro:IPR025117"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYH8"
FT                   /protein_id="ADK67442.1"
FT                   /translation="MKGMELASRYYGTFGPALVSGLPYSVESQLAFGLVGPGSECLGFD
FT                   DELSRDHDFGPGFCVWVPRDLYASLGDELSRRYASLPREFMGERRVDTALAGQRVGVFE
FT                   TESFYRTFTGLEREPQGVAEWLRIPEQLLAIVTGGEVFRDPSGRFSHIRHVYQGFYPEE
FT                   VIRKKLAANMAVMAQSGQYNLGRCLRRQDLVAAGCARTEFLCAAMASLHLLARTYMPFY
FT                   KWSFRSLSERAHVGGPICALVRRIASAPVAEVSQADVELLSGVILRCVLALGWATGGSD
FT                   FLLDAATSVWQGIPNDYLRDRPLNEGAYSNGM"
FT   gene            358791..359504
FT                   /locus_tag="Olsu_0319"
FT   CDS_pept        358791..359504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: blt:Balat_0427 hypothetical protein; SPTR:
FT                   B6W8H9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67443"
FT                   /db_xref="InterPro:IPR025191"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYH9"
FT                   /protein_id="ADK67443.1"
FT                   /translation="MACERCDNAARSSYGRRLERRADAERLLSRPAVVRVMGDRGLDGA
FT                   LQRDLCRVVSLEWEQFGMVRGMDGRAGCQDDPRRFLAYRCAQYLAFPHQMIPRVLAELE
FT                   RAELEGRNLVEEKYARMMAVTDPDAYRESCAQRIPEASPVKRAALAQLRDLLLPALADA
FT                   ARDLPESHLHARPDVSSAGRVSSMDYFLAEVEGYSLGSIFALRDALAHQLGHENPIESS
FT                   WELAVGLLGAMGKGA"
FT   gene            359501..360358
FT                   /locus_tag="Olsu_0320"
FT   CDS_pept        359501..360358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0320"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="COGs: COG0789 transcriptional regulator protein;
FT                   InterPro IPR000551:IPR009061:IPR011256; KEGG: cbt:CLH_1370
FT                   transcriptional regulatory protein; PFAM: regulatory
FT                   protein MerR; SMART: regulatory protein MerR; SPTR: C2CIK4
FT                   MerR family transcriptional regulator; PFAM: MerR, DNA
FT                   binding; MerR family regulatory protein; Bacterial
FT                   transcription activator, effector binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67444"
FT                   /db_xref="GOA:E1QYI0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYI0"
FT                   /protein_id="ADK67444.1"
FT                   /translation="MSGMERDDRCDLYQIGEVSKMGGLSQRTLRHYDELGLMEPDVVGD
FT                   NGYRYYSLQTMLKMPVINYLKMMGFSLEEIASMLQHSSLTEAKRLLSKHLASCDKEARL
FT                   LAERRESIVEWVELVDEANMVLRLRPTTVSIRYLPSRELLCLRGRFSGNFAESIVSLDF
FT                   ASYVQGLDNAICGPVILGFDTVEDAMLSASGGRECDMRMLQKPIRPIEPQNNWVQPEGM
FT                   YLSTYHVGAFENMGDAYQRLLGFARENGYKVVGPAIERFVSDFWTTYNPDLFVVEILLL
FT                   TETE"
FT   gene            360361..361452
FT                   /locus_tag="Olsu_0321"
FT   CDS_pept        360361..361452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0321"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="COGs: COG1454 Alcohol dehydrogenase class IV;
FT                   InterPro IPR018211:IPR001670; KEGG: cno:NT01CX_0486
FT                   alcetaldehyde dehydrogenase or NADPH-dependent butanol
FT                   dehydrogenase; PFAM: iron-containing alcohol dehydrogenase;
FT                   SPTR: C7HVV9 NADPH-dependent butanol dehydrogenase; PFAM:
FT                   Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67445"
FT                   /db_xref="GOA:E1QYI1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYI1"
FT                   /protein_id="ADK67445.1"
FT                   /translation="MSEFCLKARLFFGAQAVEHLQSLSCSNVLVITDGFLQESGMVSKM
FT                   TQHLPARAHVSVYSNIKPDPSQELVDAGVEMICDARPDLVIAFGGGSCIDATKAILYFA
FT                   GERGMERPYFLAIPTTAGTGSEVTNFAVITRGNTKVALIDDVLVPDGALLDASFTRSVP
FT                   PKITADTGLDVLTHALEAYVSNNASTFTDALAVKALRIVFEDLPVVFRDGDAMRARGRM
FT                   AEASCVAGIAFTNAGLGINHSLAHALGGRFHVAHGRLNAVLLPYVMRFHMAEAKYRGPY
FT                   ERLAHELGMDGADELLRRVIDLRHELDIEERLADLGSIEAGSFEEHVGEMAEAAIHDRC
FT                   TPTNPRPVSKQDLVNLYRDAYSG"
FT   gene            361656..362018
FT                   /locus_tag="Olsu_0322"
FT   CDS_pept        361656..362018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0322"
FT                   /product="microcompartments protein"
FT                   /note="COGs: COG4810 Ethanolamine utilization protein;
FT                   InterPro IPR000249; KEGG: cbe:Cbei_4064 microcompartments
FT                   protein; PFAM: microcompartments protein; SPTR: A6P0P5
FT                   Putative uncharacterized protein; PFAM: BMC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67446"
FT                   /db_xref="GOA:E1QYI2"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009307"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYI2"
FT                   /protein_id="ADK67446.1"
FT                   /translation="MDSGQEQIRVVQETVSGKEITLAHVIGGPEPVIYTKLGLDPSVDY
FT                   GSSALGIMNITPPESAVIASDIAIKSADVYLGFADRFTGTMIISGEIADVTTAITQVVE
FT                   FFRDTLGYVSCKVTKR"
FT   gene            362025..362459
FT                   /locus_tag="Olsu_0323"
FT   CDS_pept        362025..362459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0323"
FT                   /product="microcompartments protein"
FT                   /note="COGs: COG4810 Ethanolamine utilization protein;
FT                   InterPro IPR000249; KEGG: dds:Ddes_1372 microcompartments
FT                   protein; PFAM: microcompartments protein; SPTR: A7AYD4
FT                   Putative uncharacterized protein; PFAM: BMC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67447"
FT                   /db_xref="GOA:E1QYI3"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009307"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYI3"
FT                   /protein_id="ADK67447.1"
FT                   /translation="MVVERVTREQLFEQVFRGDLPCGANGEMRITRVRVPGREVDLAHV
FT                   MGVSRRRVCEMLGLDIGVHEGEDHTGEALGLMRFTPWEAVVVAADMAVKCGSIEIGFMD
FT                   RFNGSLILTGGIAEVESAEQEVLDYFGNVLGFHVCQMTRR"
FT   gene            362468..362959
FT                   /locus_tag="Olsu_0324"
FT   CDS_pept        362468..362959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4917 Ethanolamine utilization protein;
FT                   InterPro IPR012381; KEGG: ckr:CKR_3021 hypothetical
FT                   protein; SPTR: C6JCW8 Putative uncharacterized protein;
FT                   PFAM: Ethanolamine utilisation - propanediol utilisation;
FT                   TIGRFAM: ethanolamine utilization protein, EutP"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67448"
FT                   /db_xref="GOA:E1QYI4"
FT                   /db_xref="InterPro:IPR012381"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYI4"
FT                   /protein_id="ADK67448.1"
FT                   /translation="MKRLFLMGRSEAGKTSLTQALRGEKLHYHKTQYTYADGDAIDTPG
FT                   EYSESKQVGVGLVCFSFESDVVAILVAANEPFCVFAPNCNAFLNRPLIGIITKINAPNA
FT                   NVPMARQWLQNCCCERIFLVDNSTGEGISELRDYLAEDVPTISLEEAKARQRVGRRDWA
FT                   "
FT   gene            complement(363388..363945)
FT                   /locus_tag="Olsu_0325"
FT   CDS_pept        complement(363388..363945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0325"
FT                   /product="Rubrerythrin"
FT                   /note="COGs: COG1592 Rubrerythrin;
FT                   InterProIPR004039:IPR003251:IPR009078:IPR012347:IPR 009040;
FT                   KEGG: eel:EUBELI_00050 ferredoxin hydrogenase; PFAM:
FT                   Rubrerythrin; Rubredoxin-type Fe(Cys)4 protein; SPTR:
FT                   B6G909 Putative uncharacterized protein; PFAM:
FT                   Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67449"
FT                   /db_xref="GOA:E1QYI5"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYI5"
FT                   /protein_id="ADK67449.1"
FT                   /translation="MKFVCPVCGYVEEFDGDELPADYKCPTCGCAGERFTKQEGELSWA
FT                   AEHVVGVGKAEGVSEDIIEDLRANFNGECSEVGMYLAMSRVAMREGYPEVGMYYRQAAF
FT                   EEADHASRFAELLGEVVTDSTKKNLELRVEAENGATAGKFDLAKRAKAANLDAIHDTVH
FT                   EMARDEARHGKAFAGLLKRYFG"
FT   gene            364222..364674
FT                   /locus_tag="Olsu_0326"
FT   CDS_pept        364222..364674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0326"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="COGs: COG0735 Fe2+/Zn2+ uptake regulation protein;
FT                   InterPro IPR002481; KEGG: ccu:Ccur_01120 Fe2+/Zn2+ uptake
FT                   regulation protein; PFAM: ferric-uptake regulator; SPTR:
FT                   B6GBD9 Putative uncharacterized protein; PFAM: Ferric
FT                   uptake regulator family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67450"
FT                   /db_xref="GOA:E1QYI6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYI6"
FT                   /protein_id="ADK67450.1"
FT                   /translation="MADRRNTRQRQLVLDAVRSRCDHPTADQVYQVVRAQDCHVSRATV
FT                   YRNLHLLADAGDILSIKVPGGERFDLRADAHPHIICSSCGRVADVPFERGGAYEDTLDE
FT                   RASLVTSWQVSTHSLVFTGLCPHCVAEMRRQQLSQPQARQPQLSRR"
FT   gene            complement(364801..365331)
FT                   /locus_tag="Olsu_0327"
FT   CDS_pept        complement(364801..365331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0327"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR020084:IPR000086:IPR015797; KEGG:
FT                   shi:Shel_17300 ADP-ribose pyrophosphatase; PFAM: NUDIX
FT                   hydrolase; SPTR: C7N764 ADP-ribose pyrophosphatase; PFAM:
FT                   NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67451"
FT                   /db_xref="GOA:E1QYI7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYI7"
FT                   /protein_id="ADK67451.1"
FT                   /translation="MAELIDIYDEQRRPTGEVVPRKGSFLREGQFMLYVLALIEDAHGR
FT                   VLITRRTPDKGWAAGWWEVTGGGAVAGESSAQAVAREVREEVGLDVAAQAQARPPVYSY
FT                   RNVDLAHGDNYFVDVYHFTLDLAPADIRLRTSEATDFRIATWDEIASLDEAGIFLHYGR
FT                   LREALAAERNTTP"
FT   gene            complement(365381..365986)
FT                   /locus_tag="Olsu_0328"
FT   CDS_pept        complement(365381..365986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0328"
FT                   /product="putative flavoredoxin"
FT                   /note="COGs: COG1853 Conserved protein/domain typically
FT                   associated with flavoprotein oxygenase DIM6/NTAB family;
FT                   InterPro IPR009002:IPR012349; KEGG: cpy:Cphy_1404 putative
FT                   flavoredoxin; SPTR: C2HI83 Flavoredoxin; PFAM: Flavin
FT                   reductase like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67452"
FT                   /db_xref="GOA:E1QYI8"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYI8"
FT                   /protein_id="ADK67452.1"
FT                   /translation="MAGKRHIDDISDYADEIVKAIPKGVLLTSKAGEKVNSMTIAWGTL
FT                   GTNWGRPVFVAYVRKHRSTVTLLDENPEFTINVPAIADAGAAAGASGENRAARTREAAR
FT                   KALGICGSMRGDEVDKVALAGLTLVDSDVVSVPGIAELPLTLECKVVYRQEQELALYPP
FT                   EIQASYYPQDVDGRATGSNKDEHIMYFGEIVNAYLIEA"
FT   gene            366395..367549
FT                   /locus_tag="Olsu_0329"
FT   CDS_pept        366395..367549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0329"
FT                   /product="ATPase"
FT                   /note="InterPro IPR000463; KEGG: shi:Shel_02770 ATPase;
FT                   SPTR: C4F944 Putative uncharacterized protein; PFAM:
FT                   Archaeal ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67453"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYI9"
FT                   /protein_id="ADK67453.1"
FT                   /translation="MFSNPFTPIFGGRPDFFFGRKAVLTRFDAAMVDQGSEDRVLFVTG
FT                   NRGCGKTALLEQISMRAQASGRKVVDLGAEHTVELLMRHLVRDDELTRGINPAASVSLM
FT                   GAGVSLSGVSSSKTTHLGVQDLGLVFLEACAGQKKGVLVTIDEVQKVSLEDMSAICGAF
FT                   QMASRKGYDVMLVVAGLPYSFDRVIQYEGCTYMRRCSHEELGLLSHDEVAEAFDESVGL
FT                   IDGISMDGEARGLLVDASMGHPYIVQLLGYYLVSDINGRNPPSSHRVVADDVRRAVPMA
FT                   LGTYERRALKPLVEELAPSERDYLRGMTHAMGDGNIASTSEVAKSAGRSQSQLSRARES
FT                   LIRSGTILAPARGKVMFNVPYLRGYILREPYADPDVSRALEWNV"
FT   gene            367598..367867
FT                   /locus_tag="Olsu_0330"
FT   CDS_pept        367598..367867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0330"
FT                   /product="prevent-host-death family protein"
FT                   /note="InterPro IPR006442; KEGG: lba:Lebu_1222
FT                   prevent-host-death family protein; SPTR: C4F8B4 Putative
FT                   uncharacterized protein; TIGRFAM: prevent-host-death family
FT                   protein; PFAM: Phd_YefM; TIGRFAM: prevent-host-death family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67454"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYJ0"
FT                   /protein_id="ADK67454.1"
FT                   /translation="MPIAVPIRDLKNTAAFARLVDESPEPITVTKNGYDKFVAMRSQDY
FT                   MSLQEEVAEARLVRIVTEGDRSYGAGDYADGGRFLSDLRERYGL"
FT   gene            367881..367994
FT                   /locus_tag="Olsu_0331"
FT   CDS_pept        367881..367994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67455"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYJ1"
FT                   /protein_id="ADK67455.1"
FT                   /translation="MLRMSVSEGLAHDPFAHDPFTMRSPITQACGNAVSNL"
FT   gene            368123..368350
FT                   /locus_tag="Olsu_0332"
FT   CDS_pept        368123..368350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0332"
FT                   /product="FeoA family protein"
FT                   /note="InterPro IPR007167:IPR008988:IPR005302; KEGG:
FT                   shi:Shel_17730 Fe2+ transport system protein A; PFAM: FeoA
FT                   family protein; SPTR: C7N7A7 Fe2+ transport system protein
FT                   A; PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67456"
FT                   /db_xref="GOA:E1QYJ2"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYJ2"
FT                   /protein_id="ADK67456.1"
FT                   /translation="MRLAEAGAGDSVRVIKIGGGMRQVCRFASVGIIPGSVVRVVRNDP
FT                   HRPLLAFNRDTLLALGKDECGDIQVGEVSA"
FT   gene            368347..370338
FT                   /locus_tag="Olsu_0333"
FT   CDS_pept        368347..370338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0333"
FT                   /product="small GTP-binding protein"
FT                   /note="COGs: COG0370 Fe2+ transport system protein B;
FT                   InterProIPR002917:IPR011640:IPR011642:IPR006073:IPR 005225;
FT                   KEGG: shi:Shel_17720 small GTP-binding protein domain
FT                   protein; PFAM: GTP-binding protein HSR1-related; Ferrous
FT                   iron transport B domain protein; nucleoside recognition
FT                   domain protein; SPTR: C7N7A6 Small GTP-binding protein
FT                   domain protein; TIGRFAM: small GTP-binding protein; PFAM:
FT                   Ferrous iron transport protein B; Ferrous iron transport
FT                   protein B C terminus; Nucleoside recognition; TIGRFAM:
FT                   ferrous iron transporter FeoB; small GTP-binding protein
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67457"
FT                   /db_xref="GOA:E1QYJ3"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYJ3"
FT                   /protein_id="ADK67457.1"
FT                   /translation="MTGSTLSLALLGQPNSGKSTLFNRLTGSHQHVGNWPGKTVEQKTG
FT                   SFTRNGTRYEVCDLPGSYSLSAQSQEERVTQDYIESGGVDVIVVMADASQLSRSLYMLA
FT                   DVAGIEVPCVLVLNMMDVARSQGKSIDVPLLESRLGVPVVPLVANGKEGYDQLTDAIDS
FT                   AAQRRSLLDESSMGDLYRRHSPEWVRSFEGNAGAPGNAPSSGAGGARGFGSMWLAARDA
FT                   SASEAGAVSCAEARFAWVDRMLEGVQVADHGPTHRLARLDGALLSRRWGKLVSTGIILL
FT                   GLIAAMLVASPVMMAGMGVVGSLEMPIYDGLSQVGTSEFLAAYVSQGLVTAVGYSLAMA
FT                   GFCFGATFVFGLLEETGVVARISYAFDDWMSALGLQGKVIMPFMMSLGCTMAGVTGTRV
FT                   VDSWGQRLLATMLSWAVPCGATFAIIPTIAIVFFGPGGMALVILGIFAVMTLVMFVISR
FT                   LFGRRLNPEDERSGLVMELPPYHRPKFLALLSTSARHGVGVFRRALAIVIVSSTLFWVL
FT                   SWSPSGGVEGSMLYAMGHAIEPVTRVFGMGWKTFVAFLASMFAKEASLGVLSALCQADA
FT                   SQGLYAAASAAKSTGAASTAGLAAGIPPAEALAYMFAVTFNVPCAMALSTTYSETHSGK
FT                   WTAIIGLTYFVLALLIAFVVYHVAVLFM"
FT   gene            370499..371026
FT                   /locus_tag="Olsu_0334"
FT   CDS_pept        370499..371026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0334"
FT                   /product="2'-5' RNA ligase"
FT                   /note="COGs: COG1514 2'-5' RNA ligase; InterPro
FT                   IPR014051:IPR004175:IPR009097; KEGG: ele:Elen_0760 2'-5'
FT                   RNA ligase; PFAM: Phosphoesterase HXTX; SPTR: C8WMV6 2'-5'
FT                   RNA ligase; TIGRFAM: 2'-5' RNA ligase; PFAM: 2',5' RNA
FT                   ligase family; TIGRFAM: 2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67458"
FT                   /db_xref="GOA:E1QYJ4"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYJ4"
FT                   /protein_id="ADK67458.1"
FT                   /translation="MRMFVALELPDGLKAEIADLSRTLSRGCGGRFVDHEGYHLTLAFL
FT                   GVIDEMGVALAADALDEACIGMAPVRLVPNGLGKFGSSRDATLWLGFAPEPELVGLFGR
FT                   VRDGLRVRGLPFDEKPFSPHVTLARHACLSEGTLSVTSLPAETDAACVTLFRSTLSPDG
FT                   PIYTPLHTVGWE"
FT   gene            371100..371669
FT                   /locus_tag="Olsu_0335"
FT   CDS_pept        371100..371669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0335"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR000182:IPR016181; KEGG: spp:SPP_0956
FT                   acetyltransferase, GNAT family; PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: C7H7Q3 Acetyltransferase, GNAT
FT                   family; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67459"
FT                   /db_xref="GOA:E1QYJ5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYJ5"
FT                   /protein_id="ADK67459.1"
FT                   /translation="MPNTDPPSKGLLDGAKEKEALRLSKRKGHNLLVRELCDSDLPALL
FT                   KLCLGNPQYYAYLGEGPTIESLAAEMGELPPGCAPDRKSCLGFFDVEGALIAVLDLVRG
FT                   YPVERCAFIGFFMVDASRQGVGLGSRLITRLLERLHSEGFVRVRLAYVEGNEQSRRFWE
FT                   RCGFTVAGIPTEQGAFAVVPMERALP"
FT   gene            complement(371795..372802)
FT                   /locus_tag="Olsu_0336"
FT   CDS_pept        complement(371795..372802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0336"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="COGs: COG1476 transcriptional regulator protein;
FT                   InterPro IPR001387:IPR010982; KEGG: shi:Shel_23690
FT                   predicted transcriptional regulator; PFAM: helix-turn-helix
FT                   domain protein; SMART: helix-turn-helix domain protein;
FT                   SPTR: C7N1T7 Predicted transcriptional regulator; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67460"
FT                   /db_xref="GOA:E1QYJ6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYJ6"
FT                   /protein_id="ADK67460.1"
FT                   /translation="MSFRDNLQHLRATRGMTQEQLAMMVGVSRQSVTKWESERAYPEMD
FT                   KLLKICQVFDCTIDDLVQGDLTTRAGEPKRAMPQEAGDSIGYEEHCRSHALRLAVSVGL
FT                   FVGGSGAGMLVGALMQAMAASTNDEASSIAIGVGVLIFVAAGLALLIPTTTGHNAFRRE
FT                   HPYVIDFYSAKERGKNERLRARELAAGISNVLLGAIVAMVLGDSFDNGSWQESLVMSLM
FT                   MILIAIGVGVIVHAGALWDMTNIEKYNTEALCSLSQKEFESAMEDLDEGERRRMVRERQ
FT                   KSKATGTSCALVMLGATIIALPLLFVTKVYWFWAPWPIGGVACGIIGTWVNRKD"
FT   gene            372950..373351
FT                   /locus_tag="Olsu_0337"
FT   CDS_pept        372950..373351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0337"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dal:Dalk_0129 succinate CoA transferase; SPTR:
FT                   C4DJL0 Response regulator containing a CheY-like receiver
FT                   domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67461"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYJ7"
FT                   /protein_id="ADK67461.1"
FT                   /translation="MVATHSSMLGMGVFRPFPIYLVPEVLELMGSPESGMSGFAAHGPV
FT                   RSVPGPIAENALVLSLRLPFALRKSGASECSAASQALRPSGGVGAMASVHRGLAAAESD
FT                   MDEHGTAESDMVIQIAKAFIQTAANRLIF"
FT   gene            complement(373830..375008)
FT                   /locus_tag="Olsu_0338"
FT   CDS_pept        complement(373830..375008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0338"
FT                   /product="IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /note="COGs: COG0138 AICAR transformylase/IMP
FT                   cyclohydrolase PurH (only IMP cyclohydrolase domain in
FT                   Aful); InterPro IPR013982; KEGG: shi:Shel_23860 AICAR
FT                   transformylase/IMP cyclohydrolase PurH; PFAM:
FT                   AICARFT/IMPCHase bienzyme formylation region; PRIAM: IMP
FT                   cyclohydrolase; SMART: AICARFT/IMPCHase bienzyme
FT                   formylation region; SPTR: C7N1V4 AICAR transformylase/IMP
FT                   cyclohydrolase PurH; PFAM: AICARFT/IMPCHase bienzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67462"
FT                   /db_xref="GOA:E1QYJ8"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024050"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYJ8"
FT                   /protein_id="ADK67462.1"
FT                   /translation="MNELELKYGCNPNQRPSRIYMKDGSDLPVTVLSGTPGYINFLDAL
FT                   NSWQLVRELRGATGLPAAASFKHVSPAGAAVGLPLSDVDRRICFVDDEGELSPIACAYI
FT                   RARGADRMSSYGDWAALSDPCDARTARYLKHEVSDGIIAPGYTDEALEILRAKKGGRYN
FT                   VVQIDPDYRCAPVETKDVFGISFEQGHNFFKIDRALLANVVTANREIPEPAQRDMLVSL
FT                   ITLKYTQSNSVCYVKDGQAIGVGAGQQSRVHCTRLAGDKADTWYLRQHPKVLGLRFVEG
FT                   IRRANRDNAIDVYIGDEHDDVLRDGEWQKWFAERPEVLTREEKAAWLATQAGVTLGSDA
FT                   FFPFGDNVERAHKSGVSYIAEPGGSIRDDNVIATADKYGMAMCFTGMRLFHH"
FT   gene            complement(375018..375686)
FT                   /locus_tag="Olsu_0339"
FT   CDS_pept        complement(375018..375686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0339"
FT                   /product="Inosine monophosphate cyclohydrolase"
FT                   /note="COGs: COG3363 IMP cyclohydrolase; InterPro
FT                   IPR020600; KEGG: shi:Shel_23870 IMP cyclohydrolase; PFAM:
FT                   Inosine monophosphate cyclohydrolase-like; SPTR: C7N1V5 IMP
FT                   cyclohydrolase; PFAM: IMP cyclohydrolase-like protein;
FT                   TIGRFAM: IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67463"
FT                   /db_xref="GOA:E1QYJ9"
FT                   /db_xref="InterPro:IPR020600"
FT                   /db_xref="InterPro:IPR036795"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYJ9"
FT                   /protein_id="ADK67463.1"
FT                   /translation="MQDLLELLRTNPYPGRGIVVGTDRSGRPAVYYWIMGRSSNSRNRV
FT                   FVATEDGIRTEAHDPSRLEDPSLIIYHPVRAMGDALVVTNGDQTDTIVERGSLHAGCME
FT                   RSYEPDSPNFTPRISAIVQADGSFELSLLKRQGGNDPAASDRCVREFFAYEGADARTGY
FT                   FISTYQGDGNPLPSFSGEPVEVALPAADKIWGALDADNKVSLYANVGGKVRLYNKNLGD
FT                   "
FT   gene            complement(376101..376667)
FT                   /locus_tag="Olsu_0340"
FT   CDS_pept        complement(376101..376667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0340"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="InterPro IPR018486:IPR001845:IPR011991; KEGG:
FT                   bad:BAD_0218 transcription regulator ArsR; PFAM: regulatory
FT                   protein ArsR; SMART: regulatory protein ArsR; SPTR: C4FGX9
FT                   Putative uncharacterized protein; PFAM: Bacterial
FT                   regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67464"
FT                   /db_xref="GOA:E1QYK0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYK0"
FT                   /protein_id="ADK67464.1"
FT                   /translation="MREGVERITDLSSLRVLSNPDRMRVLALLRNQGEQTVGEICEAIG
FT                   LAPGSASYHLRRLAEVGLAEKLDEKHADKRQSWWQATSAATLIDGGAKDDTSRDVQVGL
FT                   RQATARSYAEAYSRYLSACAEIGEEWMRCEVGFDSVLRMTPEEARSMGDELSAVVDRWC
FT                   KRCANRSEADGRKVLVTIQGYPWIP"
FT   gene            376802..377596
FT                   /locus_tag="Olsu_0341"
FT   CDS_pept        376802..377596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0341"
FT                   /product="Methyltransferase type 12"
FT                   /note="InterPro IPR013217; KEGG: bcu:BCAH820_2111
FT                   hypothetical protein; PFAM: Methyltransferase type 12;
FT                   SPTR: B7JKR8 Putative uncharacterized protein; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67465"
FT                   /db_xref="GOA:E1QYK1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYK1"
FT                   /protein_id="ADK67465.1"
FT                   /translation="MEVGCADPYELFSSVYDSFKADDNYSELYSILKGIRAQCSFPLTC
FT                   PLAWDVGTGTGLFAELLAKDGYVTTATDICPTMIEQAKMRCSSVRYSVADAREEHPAES
FT                   YFDLVTAIDDVFNCIDSLSGLRAIFKNIHLALKGGGLFQFDLVCKKAFLEYMGSVQFRG
FT                   NESVKFLSYPSSPARDEEHQFSMGVFTLRRSASKNSWYPTLVEFKEYYYEPQTVYRELQ
FT                   HVGFEFVRVDALGDEGLIENYSPCLGESANKILFLCRKGGAL"
FT   gene            377705..378742
FT                   /locus_tag="Olsu_0342"
FT   CDS_pept        377705..378742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0342"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="COGs: COG1179 Dinucleotide-utilizing protein
FT                   involved in molybdopterin and thiamine biosynthesis family
FT                   1; InterPro IPR000594:IPR009036:IPR016040; KEGG:
FT                   plu:plu1515 hypothetical protein; PFAM: UBA/THIF-type
FT                   NAD/FAD binding protein; SPTR: Q7N6N1 Similar to MccB
FT                   protein of Escherichia coli; PFAM: ThiF family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67466"
FT                   /db_xref="GOA:E1QYK2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYK2"
FT                   /protein_id="ADK67466.1"
FT                   /translation="MKRLRSGVDYFESCDKTRLVIFPTFGKHSYSIPSPYGEALRVLDC
FT                   LSDRRRGDGGDDADLQGLLGNVELSDFVNYLDDEGLLIDESCEMGLSDEARTRFCRQMA
FT                   YFEQSSAFPDNVETLQLNLGKRSVAVVGCGGVGAPVAELLSATGVGRILLIDDDVVELG
FT                   NLGRQIAYSEQDIGVPKVSALAKRIGLINPQTSVTVMQERIDVENYARLLLESDFVVVG
FT                   ADTPMPELLYWLDDLVDKRGIAYICMSNCPPVFRVGPVFAQPGGMRYKAYHERLETKWR
FT                   DAARYECYSNTAQASKVTTVWVCYAAAAISVGNIVQYLLTGNCALLGQAYLFDMESLSG
FT                   WWGTG"
FT   gene            378739..379938
FT                   /locus_tag="Olsu_0343"
FT   CDS_pept        378739..379938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0343"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701:IPR016196; KEGG: sgr:SGR_5462
FT                   major facilitator superfamily permease; PFAM: major
FT                   facilitator superfamily MFS_1; SPTR: B1W0N1 Putative
FT                   permease of the major facilitator superfamily; PFAM: Major
FT                   Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67467"
FT                   /db_xref="GOA:E1QYK3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYK3"
FT                   /protein_id="ADK67467.1"
FT                   /translation="MIQSSLRGNGPRGAFLVSYGMGVVADQVFYVALSWYALVATDSDI
FT                   ATGAIVSLGALPRALLLLPGGMLADRLGHRVSSVISGLVRAAVLAVAAALCGASGPSVA
FT                   ALSAMAVAFGAIEALYLPGTQSIVADVAAPDELERTQGLFSAVQKAGTVLAPALAGWAV
FT                   RVLEPRTLLWCVCLIALASSLTLAVGPRREEAVGGPVPQVSTRAALGGILRDPVIARCL
FT                   ALILVAEFAAAGITGTGYALLSAQKGWDAAQMGSVLSLYGAGAAVSALAVAAARPRRTS
FT                   AWIGSSTAVCGVAFAVSGVSGLPAARFAALVAGLGGGVSSTLLLATYLSRIRDGLVATA
FT                   LSVMSLAAFGTTSLSYVLFGAVSSSTTPSVAFAVFGCALAASGLAFWKSTATLGRGTHR
FT                   "
FT   gene            complement(380072..380284)
FT                   /locus_tag="Olsu_0344"
FT   CDS_pept        complement(380072..380284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0344"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A2605 OM receptor TonB; SPTR: A2SJ20
FT                   OM receptor TonB"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67468"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYK4"
FT                   /protein_id="ADK67468.1"
FT                   /translation="MIVGYHGGAARANDMPTVWACASLAGCLAPLWQAPRECAARERKA
FT                   MQDLLELLRTNPYPGRGITPALGPP"
FT   sig_peptide     complement(380219..380284)
FT                   /locus_tag="Olsu_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(380415..380624)
FT                   /locus_tag="Olsu_0345"
FT   CDS_pept        complement(380415..380624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0345"
FT                   /product="response regulator receiver protein"
FT                   /note="InterPro IPR007492; KEGG: bad:BAD_1594 two-component
FT                   response regulator; PFAM: LytTr DNA-binding region; SPTR:
FT                   C9KA11 Response regulator of the LytR/AlgR family; PFAM:
FT                   LytTr DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67469"
FT                   /db_xref="GOA:E1QYK5"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYK5"
FT                   /protein_id="ADK67469.1"
FT                   /translation="MRGTLSRTAAELGDKGFVKTSASHIVNMAQVVHIRQGAVVMVDGS
FT                   EIFFSRSQRKPALERLAGFVDRTI"
FT   gene            complement(380681..380959)
FT                   /locus_tag="Olsu_0346"
FT   CDS_pept        complement(380681..380959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0346"
FT                   /product="response regulator receiver and SARP domain
FT                   protein"
FT                   /note="InterPro IPR001789; KEGG: ere:EUBREC_3120
FT                   two-component response regulator; PFAM: response regulator
FT                   receiver; SPTR: C6L9K0 Putative response regulator receiver
FT                   domain protein; PFAM: Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67470"
FT                   /db_xref="GOA:E1QYK6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYK6"
FT                   /protein_id="ADK67470.1"
FT                   /translation="MPPLGLSYHGAKEVAWHIAFSWSRTPPAEADRLRAHLARYATEKG
FT                   TSFSVEVLSTAVEFMNSQRTADLIFMDIALPGINGTEAAEELRTLST"
FT   gene            complement(380998..381615)
FT                   /locus_tag="Olsu_0347"
FT   CDS_pept        complement(380998..381615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0347"
FT                   /product="putative transcriptional regulator, RpiR family"
FT                   /note="KEGG: similar to ankyrin repeat protein, putative;
FT                   SPTR: B6GDB9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67471"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYK7"
FT                   /protein_id="ADK67471.1"
FT                   /translation="MSEIGFDITPKSTLTEGERAALRQHYLTYVRAERDEGRQLRADLG
FT                   EIYAIIDKLADGLDMADLISRMGESSHIVIFATESSVLALREFQQAMLSEGKVVRLVSE
FT                   NSTEVNGIRALGPSDLLIVVTTSNGFARRQRELIGRSGAQKVVLTASRDDELHALFGDV
FT                   LRIGDGAEEGGALHRIYATFGVTYFFDRLFTQYARAYDPTLR"
FT   gene            381796..382950
FT                   /locus_tag="Olsu_0348"
FT   CDS_pept        381796..382950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0348"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="COGs: COG0523 Putative GTPase (G3E family); InterPro
FT                   IPR003495:IPR011629; KEGG: apv:Apar_0294 cobalamin
FT                   synthesis protein P47K; PFAM: cobalamin synthesis protein
FT                   P47K; cobalamin synthesis CobW domain protein; SPTR: A4E850
FT                   Putative uncharacterized protein; PFAM: Cobalamin synthesis
FT                   protein cobW C-terminal domain; CobW/HypB/UreG,
FT                   nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67472"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYK8"
FT                   /protein_id="ADK67472.1"
FT                   /translation="MSHSAEKPVKIVLLTGYLGAGKTTLLNHILANDEGIRAAVIVNDI
FT                   GEVNVDASLIRDGGLSETDDLIPMTNGCICCTLSDDLSRQLAGIARSGHFDYIVIEASG
FT                   ICEPIPIAYTISSFCDQGESGGRAPLALDNIVAVVDAKRMFDEFDGGRDLLRDDIGEDD
FT                   IESLLIQQIEFCSTLVLNKCDLVTPPQLAELHALARSLQRDAVIVEAAKGDVPMAELLD
FT                   TGRFDFERAYGSAAWLDAMEHPEEHEDPEVLEYDITTFVYKRRRPFDANALSDYVSTWG
FT                   SDVIRSKGCVWADRDPDMCYLFEQAGRQVRLTENGLFVDSAPEAEKRRILRDNPQLLDD
FT                   WDDSCGDRMTKICFIGRHMDRGALTAGLDACLTDWEDLDARCGE"
FT   gene            383020..384834
FT                   /locus_tag="Olsu_0349"
FT   CDS_pept        383020..384834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0349"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components;
FT                   InterProIPR017871:IPR001140:IPR003439:IPR003593:IPR
FT                   011527:IPR017940; KEGG: ele:Elen_1463 ABC transporter
FT                   related; PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; SPTR: A4E9V5
FT                   Putative uncharacterized protein; PFAM: ABC transporter
FT                   transmembrane region; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67473"
FT                   /db_xref="GOA:E1QYK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYK9"
FT                   /protein_id="ADK67473.1"
FT                   /translation="MALRSTTDRNDRSTIRRTLHYFWGVTRQKPGAFALSIVSSVGYTA
FT                   LLTFANTYVMGLIVDRVQAAPVAPGQVFSVFGPYVVALLLVNALGQTLSKLQDYSVYKL
FT                   EINGDYQLSRLCFDTLSNQSMTFHNSRFGGSLVSQTSRFVSGYSGLVDVVTYSLYPTLA
FT                   SIVLTVGMLLPIAPTFVAILMAMLVLYVALAYGMYKRILPLSAQASAAQNRLSGVLSDA
FT                   VTNILAVKTYGREDYERSLFTDADCKAMTAANANMRATMRRGFTTSFLITVIMLVASIF
FT                   VSGGNAWFGISAGSLVMMFTYTYNLTMRFNYFNSMMQRINRSLGDAAEMTRVLDEPTLV
FT                   ADDAGARPLEVREGRIDFEHLGFRYADAQKDDKVFEDLSLHIPAGQRVGLVGRSGSGKT
FT                   TLTKLLLRLDDVQEGRVLVDGQDVSRCTQQSLRRQVAYVPQEALLFHRSIRENISYGRP
FT                   GATEEEIRAAAAEANALEFIDRLPQGFDTMVGERGVKLSGGQRQRVAIARAILVDAPIL
FT                   VLDEATSALDSESEALVQGALENLMRGRTSIVVAHRLSTVASLDRIVVLSDGRIVEDGT
FT                   HHDLVEAGGEYAGLWDRQTGGFLEGDVE"
FT   sig_peptide     383020..383121
FT                   /locus_tag="Olsu_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            384872..385534
FT                   /locus_tag="Olsu_0350"
FT   CDS_pept        384872..385534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0350"
FT                   /product="membrane-bound metal-dependent hydrolase"
FT                   /note="InterPro IPR007404; KEGG: cac:CAC1083
FT                   membrane-associated metal-binding protein; PFAM:
FT                   membrane-bound metal-dependent hydrolase; SPTR: C8NKS7
FT                   Transposase; PFAM: Predicted membrane-bound metal-dependent
FT                   hydrolase (DUF457)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67474"
FT                   /db_xref="GOA:E1QYL0"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYL0"
FT                   /protein_id="ADK67474.1"
FT                   /translation="MVGRTHIAAGVAASLALVPLSGGPVACLPAVIGGALGGLACDTDV
FT                   GSSEGSRQLRRAWVALAAIVAASLVADRALDAGVCAYALRHLGMEQLAGMALLVAVLAC
FT                   GRASGHRGFSHSLLGLVVAVAAVRLAYPPLVTYFAMGYVSHVLLDLLNKRPVRLFWPVG
FT                   RGVSLGACKAGGVLDNVLCALGVLVAVGLIAWHAGVRLPMGLPLPPSLPFALPFPMP"
FT   sig_peptide     384872..384991
FT                   /locus_tag="Olsu_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(385524..386336)
FT                   /locus_tag="Olsu_0351"
FT   CDS_pept        complement(385524..386336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0351"
FT                   /product="Cof-like hydrolase"
FT                   /note="COGs: COG0561 hydrolase of the HAD superfamily;
FT                   InterPro IPR000150:IPR013200:IPR006379; KEGG: lhe:lhv_2081
FT                   hypothetical protein; PFAM: Haloacid dehalogenase domain
FT                   protein hydrolase type 3; SPTR: C0EYZ2 Putative
FT                   uncharacterized protein; TIGRFAM: Cof-like hydrolase;
FT                   HAD-superfamily hydrolase, subfamily IIB; PFAM: haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: Cof subfamily of IIB
FT                   subfamily of haloacid dehalogenase superfamily;
FT                   HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67475"
FT                   /db_xref="GOA:E1QYL1"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYL1"
FT                   /protein_id="ADK67475.1"
FT                   /translation="MFERSHRWKAVFSDIDGTLLCSDHTMSQTTRETLEACIHAGIHVT
FT                   LASSRSPQGIETVRGSCGLRTAVIAFGGALAFDEQGDKVLERGLSVAQATAVVSYLEQS
FT                   HLDASWNVFTPARWIVASRRDPRIAHEEEVVKVTAQEGTTAELADDACVGKVLLMCEAG
FT                   QSQPLARQLSAAFPQLSVCTSSPILVEVNAMGVSKADALRALCAHWGIGTEDTLALGDG
FT                   DNDLEMLRAAGLGVAMGNASAEVRRAAGFVTEDNDHDGAAHALQALMA"
FT   gene            386571..387359
FT                   /locus_tag="Olsu_0352"
FT   CDS_pept        386571..387359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0352"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011663:IPR011991; KEGG: gwc:GWCH70_2215
FT                   transcriptional regulator, GntR family; PFAM: UbiC
FT                   transcription regulator-associated domain protein;
FT                   regulatory protein GntR HTH; SMART: regulatory protein GntR
FT                   HTH; SPTR: C5D3K9 Transcriptional regulator, GntR family;
FT                   PFAM: Bacterial regulatory proteins, gntR family; UTRA
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67476"
FT                   /db_xref="GOA:E1QYL2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYL2"
FT                   /protein_id="ADK67476.1"
FT                   /translation="MDILVLIARDPLDPSSKVPLWRQLKHRLQQLMASGVAGEGDALPP
FT                   ERNMADALGLSRTTVRRCLDALADEGRIVRTRGRGTFVARPLGLGAARDRYAYSFTAEA
FT                   EASGREPSTRVLSFGQSPATVALAERLELEEGEGLWEIRRLRLADGEPLAYHRVYVPVR
FT                   CCPELTRGDAEHSILSALAAKGGIYPSSMDGSYEAIALDSSEARLLRQRAGSPALRLVR
FT                   TNFATNGMPYEVALTIFRADRYQLRVRSDDGVDSFRKVML"
FT   gene            387647..388066
FT                   /locus_tag="Olsu_0353"
FT   CDS_pept        387647..388066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0353"
FT                   /product="formylmethionine deformylase"
FT                   /note="COGs: COG0242 N-formylmethionyl-tRNA deformylase;
FT                   InterPro IPR000181; KEGG: ele:Elen_0761 formylmethionine
FT                   deformylase; PFAM: formylmethionine deformylase; SPTR:
FT                   B6G869 Peptide deformylase; PFAM: Polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67477"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYL3"
FT                   /protein_id="ADK67477.1"
FT                   /translation="MIKELCKDEAVLSQRCERATAEDAVVAWDLIDTMDSLEDVGCLAA
FT                   NQIGVAKQVIAYRDDDQVVHVMYNPRIMMGLGASKLEEGCLTREGTVRVTRYAKVKVSF
FT                   DELVEGSLKARRRDYTGWVAEMIQHMCDHCNGKLV"
FT   gene            complement(388078..388446)
FT                   /locus_tag="Olsu_0354"
FT   CDS_pept        complement(388078..388446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0354"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="COGs: COG0640 transcriptional regulator protein;
FT                   InterPro IPR001845:IPR011991; KEGG: shi:Shel_05920
FT                   transcriptional regulator, ArsR family; PFAM: regulatory
FT                   protein ArsR; SMART: regulatory protein ArsR; SPTR: C2D8Y4
FT                   Transcriptional repressor; PFAM: Bacterial regulatory
FT                   protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67478"
FT                   /db_xref="GOA:E1QYL4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYL4"
FT                   /protein_id="ADK67478.1"
FT                   /translation="MAARSHAGMGTSANACADIEGTDHAPFEMPDEEILYDLADLFKIF
FT                   SDTTRIKILFALLERDLSVSDIADEVSMSQSAVSHQLRILKQGRLVKFRRDGKQAIYSL
FT                   SDDHVHTMLSQGMSHICE"
FT   gene            complement(388614..389492)
FT                   /locus_tag="Olsu_0355"
FT   CDS_pept        complement(388614..389492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0355"
FT                   /product="protein of unknown function DUF1113"
FT                   /note="COGs: COG4905 membrane protein; InterPro IPR010540;
FT                   KEGG: bad:BAD_0916 hypothetical protein; PFAM: protein of
FT                   unknown function DUF1113; SPTR: A1A1W4 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1113)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67479"
FT                   /db_xref="GOA:E1QYL5"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYL5"
FT                   /protein_id="ADK67479.1"
FT                   /translation="MPSPLDLLFTWWIYFVAYSVGGWAMESTYCSIGERRLVNRGFLNG
FT                   PYCPIYGAGGVACAPLCPLFSTPSARGALAVFLVGGAVSCLLEFVTSVAMERAYHARWW
FT                   DYSDKPLNLQGRVWAGGFAEFGLCCVLIVFVVQPVLGAWVASLGPRNRTLITLVTLAVF
FT                   LADFVVTNLGLTSFSSKMDDLRTGTLERLGALRESLPDVQARAGLERLLGDVRVWGRLG
FT                   GTRTRLHELRDAMPSMPPVSSLSELAESFAGRLTSQERRIMRAFPTLRPTGYRELLNDF
FT                   RDRIRTELGRR"
FT   gene            complement(389495..390082)
FT                   /locus_tag="Olsu_0356"
FT   CDS_pept        complement(389495..390082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0356"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="InterPro IPR006674; KEGG: bad:BAD_0917 hypothetical
FT                   protein; PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SPTR: C0BTT1 Putative uncharacterized protein;
FT                   PFAM: HD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67480"
FT                   /db_xref="GOA:E1QYL6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYL6"
FT                   /protein_id="ADK67480.1"
FT                   /translation="MPERSQRPPKRPSRPTERPPQLAESPTRLPIPSGTTPRELIGRHG
FT                   ADILASDGMEIERGCMQHGTTSVFEHSLAVTAQATLIAQALRIPVAERELVRGSLLHDY
FT                   FLYDWHVGDPSHRLHGFRHPGFACANAERDFGINDIERDMIRHHMFPLTPVPPTCREGA
FT                   ILCIADKVVATRETVSGIALRLFRPVRTPGRD"
FT   gene            complement(390104..390934)
FT                   /locus_tag="Olsu_0357"
FT   CDS_pept        complement(390104..390934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0357"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="COGs: COG0561 hydrolase of the HAD superfamily;
FT                   InterPro IPR013200:IPR006379; KEGG: sub:SUB0315 haloacid
FT                   dehalogenase-like hydrolase; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; SPTR: A7VF40 Putative
FT                   uncharacterized protein; TIGRFAM: HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: haloacid dehalogenase-like
FT                   hydrolase; TIGRFAM: Cof subfamily of IIB subfamily of
FT                   haloacid dehalogenase superfamily; HAD-superfamily
FT                   hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67481"
FT                   /db_xref="GOA:E1QYL7"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYL7"
FT                   /protein_id="ADK67481.1"
FT                   /translation="MSAPTSAFDLAAVDMDGTLLHDDKTLDSAAPSALAEAVGAGRTVA
FT                   LCTGRCVSEIRPYLPQLPMVRYAIAEVGALLYDLREKRVVARHALPREVIDAVVSFVCS
FT                   EDVMVQGVSAGQAYATASMVPRMAAYNMAPYIPLYEQTATLAPRMTDLLEDPTRTWEKL
FT                   NLFHRSTQARERTRERLGGLPAVESYSEVTSLEVTPLGIDKGSGIRALCELLDIDASRA
FT                   LAIGDSDNDLAAFRDAGMGVAVANASERALGAADALVSAHDKGGVAEAVRRYLM"
FT   gene            complement(390953..392164)
FT                   /locus_tag="Olsu_0358"
FT   CDS_pept        complement(390953..392164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0358"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /note="COGs: COG0538 Isocitrate dehydrogenase; InterPro
FT                   IPR004790:IPR019818:IPR001804; KEGG: shi:Shel_06080
FT                   isocitrate dehydrogenase, NADP-dependent; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase; PRIAM: Isocitrate
FT                   dehydrogenase (NADP(+)); SPTR: B0P3Z3 Putative
FT                   uncharacterized protein; TIGRFAM: isocitrate dehydrogenase,
FT                   NADP-dependent; PFAM: Isocitrate/isopropylmalate
FT                   dehydrogenase; TIGRFAM: isocitrate dehydrogenase,
FT                   NADP-dependent, eukaryotic type"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67482"
FT                   /db_xref="GOA:E1QYL8"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYL8"
FT                   /protein_id="ADK67482.1"
FT                   /translation="MSRIKMKTPLVEMDGDEMTRIIWRMIKDDLICPFVDLRSEYFDLG
FT                   LEMRDETGDQVTVDSAEATKRYGVAVKCATITPNAARVEEYGLRQMWKSPNGTIRAMLD
FT                   GTVFRAPIVVKGVEPVVRSWKRPITIARHAYGDVYKNAEIRVPGAGRAELVFTSADGSE
FT                   TREPIHEFTGAGVIQGIHNLDSSIESFARSCFEYALSTRQDLWFATKDTISKTYDHRFK
FT                   DVFAELYDKEYRGRFEAAGIKYFYTLIDDAVARVMKAEGGFIWACKNYDGDVMSDMLSS
FT                   AFGSLAMMTSVLVSPHGYFEYEAAHGTVQRHYYKHLRGERTSTNSVATIFAWSGALRKR
FT                   GELDSLPHLANFADRLEEATVSTIEGGQMTGDLARITTLENVTTLDTEDFIHAVAERLR
FT                   ALLA"
FT   gene            complement(392456..394378)
FT                   /locus_tag="Olsu_0359"
FT   CDS_pept        complement(392456..394378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apv:Apar_0288 hypothetical protein; SPTR:
FT                   C4F9E2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67483"
FT                   /db_xref="InterPro:IPR024437"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYL9"
FT                   /protein_id="ADK67483.1"
FT                   /translation="MPKITPGNRLYLYRLFSREIGCGRQELIGRFGEVLTRDGILPEDL
FT                   DCTDVTQLLGELPDLIKLRIFRKGRVYATLLQRPELDEILARDAQAAEKGAGAAGGARS
FT                   WRHKKGKGDPKPTKPHHRRSKAQPTDEPLTAGATATTERAANVDKRPMPTDEPAAPTVP
FT                   AIQDEATDAATTVETSPGAAAISPATSTERRPPISLTITYDPHEGAGTSPQPDLPKRFS
FT                   TDVHCRDEALRTLYQLLPYGTDVMGVLDEDWTLARSTGTAAGTRGRITFPLRYRDGTGL
FT                   PLTVTLLRQPRSVSGKRWSLDCMDGNAAMGHAHEDPEAEGTSLADQGAWSDLVTGRTVT
FT                   PDASPDPVRELASFAILGAWEDFLGPLAAMAEPECWDYPAGGASGNQGTDEGDPYGVLR
FT                   EYVALTFHRIMGQGKLAVADDGSLAAFDTGLVDADAQSILACLVPSGDAVIAWRLAGVC
FT                   VAGSGDLGVRALALLASPPARASYIEDPSDALPPEEGRPITLDADEIVGHQLGRLPRAF
FT                   LDSQIGADASDGTLADLERAVSADPGRFDRIGRALDDACAHSLRRVRASWRACTPIYDP
FT                   TADATKLLVPLCLADKRHADRALVLSRQASGSCLASVILTLPRARTLARVVSGELPSWL
FT                   VGDAR"
FT   gene            complement(394519..395535)
FT                   /locus_tag="Olsu_0360"
FT   CDS_pept        complement(394519..395535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0360"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="COGs: COG0657 Esterase/lipase; InterPro IPR013094;
FT                   KEGG: ckr:CKR_2289 hypothetical protein; PFAM: Alpha/beta
FT                   hydrolase fold-3 domain protein; SPTR: B9E4B5 Putative
FT                   uncharacterized protein; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67484"
FT                   /db_xref="GOA:E1QYM0"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYM0"
FT                   /protein_id="ADK67484.1"
FT                   /translation="MGKTGKRVLTAAGTLAGIAAIGAGFSAWSRMRFGRSGTATAAEGL
FT                   IRASGARKPFLGRDLGLFEDAVEHRREENEREYSLPSWLRLKSLVFEETCDGMKTFHLG
FT                   TTGMNSRAILYLHGGSYISQISVWHWLFLDKLCQATGAEVVVPIYPLAPAHDYDEAYSL
FT                   LTDLYEALCNRYGADSITLMGDSAGGGLAAGLAESFEHYDLPQPGRLVLISPELDITMR
FT                   NPDISDYFDVDPMLAPWGLAQAGDLWADGDDPSGFRLSPVNGDVTPLHNVTIYVGTREI
FT                   FYPDCIKFDQRLAQAGVSHSLVVGQNLNHVWPLYPIPEARRAVRDIAGIVLGTPQHV"
FT   sig_peptide     complement(395413..395535)
FT                   /locus_tag="Olsu_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(396118..397407)
FT                   /locus_tag="Olsu_0361"
FT   CDS_pept        complement(396118..397407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0361"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="COGs: COG0148 Enolase; InterPro
FT                   IPR000941:IPR020809:IPR020811:IPR020810; KEGG:
FT                   apv:Apar_0358 enolase; PFAM: Enolase-like; PRIAM:
FT                   Phosphopyruvate hydratase; SPTR: C2D7H3 Enolase; TIGRFAM:
FT                   enolase; PFAM: Enolase, N-terminal domain; Enolase,
FT                   C-terminal TIM barrel domain; TIGRFAM: phosphopyruvate
FT                   hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67485"
FT                   /db_xref="GOA:E1QYM1"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYM1"
FT                   /protein_id="ADK67485.1"
FT                   /translation="MSKIARVYGREVLDSRGNPTVEVEVTLEDGSFGRAIVPSGASTGE
FT                   FEAVELRDGDGERYLGKGVLDAVAHVNGEIKDLLIGREAGDQRGADLAMIDLDGTPNKG
FT                   RLGANAILGASLAIARAAAASAGQPLYAYLGGANAHTLPVPMMNVLNGGVHADNNVDFQ
FT                   EFMIMPVGAPDFKTALRWCAQVYHTLKGVLKSAGLSTGVGDEGGFAPDLKTNAEPFEYL
FT                   MDAVQKAGFEPGRDFMFAMDPATSEVYNKETGKYELKGEGRELTSDQMVDYWAELVEKY
FT                   PIISIEDGLDEEDWEGWKKLTERLGKKVQLVGDDLFVTNTARLKKGIETGAANAILIKV
FT                   NQIGTLTETLDAIECAKRAGYTAVVSHRSGETEDTTIADLAVATNAGQIKTGAPARTDR
FT                   VAKYNQLLRIEDALGDSAEYLGKAAFYNLA"
FT   gene            complement(397498..398364)
FT                   /locus_tag="Olsu_0362"
FT   CDS_pept        complement(397498..398364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0362"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="COGs: COG0220 S-adenosylmethionine-dependent
FT                   methyltransferase; InterPro IPR003358; KEGG: shi:Shel_07010
FT                   predicted S-adenosylmethionine-dependent methyltransferase;
FT                   PFAM: putative methyltransferase; SPTR: C7N4C5 Predicted
FT                   S-adenosylmethionine-dependent methyltransferase; PFAM:
FT                   Putative methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N(7)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67486"
FT                   /db_xref="GOA:E1QYM2"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYM2"
FT                   /protein_id="ADK67486.1"
FT                   /translation="MHALHARLPKNFVLEERLERYADGIEASPASYAGRWAEACFPVGE
FT                   AQGAEGAHGTRTRFDEVRLDMGCGKGAFTVQAAAAERNVLFVGVDSEPICIAYAAQRAV
FT                   ESGLDNVVFAPGLGKDVCRFFSAGELSRIYLNFPTPFPRKKEATQRLTHLDQLMRYRTV
FT                   LASGGSVILKTDSYPLRGFSRTQFELAGYDLLWESDDARSERPDDPMSWYEERLGRQGA
FT                   TVFALEATPGPAPKRVEQTASLSLVDYLPPELDQMAYVPHGMEGTVTNLRNLRKKARMR
FT                   NRGARNG"
FT   gene            398561..399490
FT                   /locus_tag="Olsu_0363"
FT   CDS_pept        398561..399490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0363"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="COGs: COG1105 Fructose-1-phosphate kinase and
FT                   related fructose-6-phosphate kinase (PfkB); InterPro
FT                   IPR002173:IPR011611:IPR017583; KEGG: apv:Apar_1252
FT                   1-phosphofructokinase; PFAM: PfkB domain protein; PRIAM:
FT                   1-phosphofructokinase; SPTR: B9CLC0 1-phosphofructokinase;
FT                   TIGRFAM: 1-phosphofructokinase; PFAM: pfkB family
FT                   carbohydrate kinase; TIGRFAM: 1-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67487"
FT                   /db_xref="GOA:E1QYM3"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYM3"
FT                   /protein_id="ADK67487.1"
FT                   /translation="MIHTVTLNPALDKTAQAPNFKLDAVTRITELRQDPGGKGINVSKV
FT                   IRQLGGTSTAWAVLGGNTGRYIRETLAEQGIECRAFEVEGETRTNLKVIDPEGGTHTDI
FT                   NEPGPQVSDDMLDAMLARLVAELDAGDIVVLAGSVARGASDDTYFGWVEACRGAGAKVF
FT                   LDADGEKLVAGIRACPFLIKPNEIELGSILGRTLDTDEKVANAARELVSRGLDNVVVSM
FT                   GGAGALFVSADHVVKGGSVRVPVGSTVGAGDSVVAALAYAEQQGLPLEDKVRLSMATGA
FT                   ANVMQSGTQAAPRELVDSLVDKVSVTWL"
FT   gene            complement(399506..400111)
FT                   /locus_tag="Olsu_0364"
FT   CDS_pept        complement(399506..400111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0364"
FT                   /product="metal dependent phosphohydrolase"
FT                   /EC_number="3.1.3.5"
FT                   /note="COGs: COG1896 hydrolase of HD superfamily; InterPro
FT                   IPR006674:IPR003607; KEGG: apv:Apar_0292 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; PRIAM: 5'-nucleotidase; SMART: metal-dependent
FT                   phosphohydrolase HD region; SPTR: B9CMX7 5'-nucleotidase
FT                   YfbR"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67488"
FT                   /db_xref="GOA:E1QYM4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYM4"
FT                   /protein_id="ADK67488.1"
FT                   /translation="MAQGSSFFALVSRMRYIERWALMRSSRPENLSEHSLDVAIIAHAL
FT                   CTLANVRHGWRLDAERAALVALFHDASEIITGDMPTPVKYANGTLRDAYKDVEAQAERT
FT                   LLDELPADLRPTYEDIFFPADDADPNEGHLRLLVKAADKLSALIKCVDEAQAGNAEFRT
FT                   AEAATRTKVDEMAATLPEVADFVREFLPDYGSTLDQLL"
FT   gene            complement(400146..401807)
FT                   /locus_tag="Olsu_0365"
FT   CDS_pept        complement(400146..401807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0365"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="COGs: COG1227 Inorganic
FT                   pyrophosphatase/exopolyphosphatase; InterPro
FT                   IPR000644:IPR010766:IPR004097; KEGG: apv:Apar_0296
FT                   inorganic diphosphatase; PFAM: DHHA2 domain protein; DRTGG
FT                   domain protein; CBS domain containing protein; PRIAM:
FT                   Inorganic diphosphatase; SPTR: C2D723 Possible inorganic
FT                   diphosphatase; PFAM: DRTGG domain; DHH family; DHHA2
FT                   domain; CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67489"
FT                   /db_xref="GOA:E1QYM5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYM5"
FT                   /protein_id="ADK67489.1"
FT                   /translation="MPEVIRKVNVIGHLHPDTDSICSAIAYAYLKNQIGDTQYEARRAG
FT                   AINRETAFALKHFGFEEPQLITTVTPQIKDIEISRQRGIDGEMSLYAAWNLMRDTKTGT
FT                   LCVVDQGGNLLGLVAVKDIASANMDIFDTAVLSSSKTRYSNLLTTLDGEMVCGDPEGSI
FT                   ERGDIRVGTTPEMMDGNVEQDDIVLVTNRYETQRFAVEAGAGCLIICNGAQVSHVVVEA
FT                   AQANGCTVITTPYDTYAAARLVSMSIPVRARMLSAENVLRFSVNTSIDEAQKVMARSQH
FT                   RFFPVMDEGGAYCGVVSSPNMVNVKKKHVILVDHNERSQAVDGLEQAEIMEIIDHHRIG
FT                   SIETSGPVLFRNMPVGCTSTIIYDIYQENGVEIPADIAGLMLSAILSDTLAFRSPTCTP
FT                   RDKYVGEQLARICGEDIDSYADAMFDAGADLTGRTAEEVFNSDFKVFSRGSVRFGVGQG
FT                   SFMTESSRKAAEALVGPYLKAAAAANEIPMVFYMFTDVKTQTTEMLYWGQDTEEIVSRT
FT                   FGATPKDDIAVLPGVVSRKKQVIPPLMATLQEMEQE"
FT   gene            complement(402017..402916)
FT                   /locus_tag="Olsu_0366"
FT   CDS_pept        complement(402017..402916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0366"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR005829:IPR000620; KEGG: shi:Shel_05230
FT                   predicted permease, DMT superfamily; PFAM: protein of
FT                   unknown function DUF6 transmembrane; SPTR: A4E833 Putative
FT                   uncharacterized protein; PFAM: EamA-like transporter
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67490"
FT                   /db_xref="GOA:E1QYM6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYM6"
FT                   /protein_id="ADK67490.1"
FT                   /translation="MSRDGAKYLAALLLFGSNGIVASSIALPSHQIVLLRTFLGALSLA
FT                   ALVVLGRGAGPIFQHPRQAGALAVSGAALGVGWLFLFEAYRLAGVGVASLAYYCGPVIV
FT                   MILSPFLFAERLGAAKVAGIVSAVCGASLVVAQGGGKMDALGLLLGALSAVMYAAMVTF
FT                   SRRSPDIQGLAAASVQLVASFAVVAAYQLVRTLLSPAEAGETLSCLAQVDWGAVLTLGL
FT                   VNTGLGCYLYFSSIGTLPVHRVAIWGYLEPLSAVALSAVALGEAVTMGRVLGAMLIVGG
FT                   AVASELVGRRRGVLVAAS"
FT   sig_peptide     complement(402845..402916)
FT                   /locus_tag="Olsu_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            403076..403996
FT                   /locus_tag="Olsu_0367"
FT   CDS_pept        403076..403996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0367"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847:IPR005119:IPR011991; KEGG: pjd:Pjdr2_3730
FT                   transcriptional regulator, LysR family; PFAM: LysR
FT                   substrate-binding; regulatory protein LysR; SPTR: C3X8Z1
FT                   Transcriptional regulator; PFAM: LysR substrate binding
FT                   domain; Bacterial regulatory helix-turn-helix protein, lysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67491"
FT                   /db_xref="GOA:E1QYM7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYM7"
FT                   /protein_id="ADK67491.1"
FT                   /translation="MDTNILKYQAFLECVQRGSITAAARALSYSQSGVSRMIADLEREW
FT                   GVVLLDRGRGGARLTSDGECLLSTVKEICEAHRRLRMQVDDLNGLRTGSIRMGVFSSVA
FT                   THWLPHAISAFRADYPDIDYELLTGDYAEIERWVAEGRVDLGFLPHRPTSRGLSFEELA
FT                   SDELLAVLPKGHPLAGRGSVEVAALCDEPFILLEKGGDDEVTSIFSAAGLEARVCFTTW
FT                   DDYAIMSMVESGLGISILPALILRRAPYRIEARRLDPCVRRHIGVVRRAGGPLALAAER
FT                   FLPYLARGVAYEVDVTDCPGTRQLA"
FT   gene            404055..405335
FT                   /locus_tag="Olsu_0368"
FT   CDS_pept        404055..405335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0368"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /note="COGs: COG0014 Gamma-glutamyl phosphate reductase;
FT                   InterProIPR012134:IPR020593:IPR000965:IPR016161:IPR
FT                   016162:IPR016163; KEGG: shi:Shel_19350
FT                   glutamate-5-semialdehyde dehydrogenase; PRIAM:
FT                   Glutamate-5-semialdehyde dehydrogenase; SPTR: C7N7R6
FT                   Glutamate-5-semialdehyde dehydrogenase; TIGRFAM:
FT                   gamma-glutamyl phosphate reductase; PFAM: Aldehyde
FT                   dehydrogenase family; TIGRFAM: gamma-glutamyl phosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67492"
FT                   /db_xref="GOA:E1QYM8"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYM8"
FT                   /protein_id="ADK67492.1"
FT                   /translation="MADVREVAAHMKLESPEMASASLECRNEALARIRRGLVEAKGAIF
FT                   AANARDLASARERGVAAAVAGRLRFDEHKLADVCAGLDSLADLPDPVGRVLLRRELDEG
FT                   LELTRVSCPIGVIGVIFEARPDALVQISSLCIKSGNCAILKGGSETARTNRAIFDVVIS
FT                   SARAAGLPASCLFQVEAHSEIDELLGCFGLVDLLVPRGSNAFVRHIMDNTRIPVMGHAD
FT                   GICHIYVDEAADVGRGVPICVDAKCQYTAACNSVETILVHEGIAASFLPRLAEAYAAAG
FT                   VAMRGDAQTRDVIACEAATEEDWDTEYLAPIVSLRVVDGEDEAIEHINRHGSHHTDAIL
FT                   TEDDAAAERFMRLVDSAGVYQNASTRFADGFRYGFGAEVGISTGKLHARGPVGLEGLVT
FT                   YKYRLRGQGHLVADYAEGRSRFCFRDL"
FT   gene            complement(405417..406505)
FT                   /locus_tag="Olsu_0369"
FT   CDS_pept        complement(405417..406505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0369"
FT                   /product="asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="COGs: COG0252 L-asparaginase/ Glu-tRNAGln
FT                   amidotransferase subunit D; InterPro
FT                   IPR020827:IPR006034:IPR006033; KEGG: ele:Elen_0759
FT                   L-asparaginase, type I; PFAM: Asparaginase/glutaminase;
FT                   SPTR: C4FA92 Putative uncharacterized protein; TIGRFAM:
FT                   L-asparaginase, type I; PFAM: Asparaginase; TIGRFAM:
FT                   L-asparaginases, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67493"
FT                   /db_xref="GOA:E1QYM9"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYM9"
FT                   /protein_id="ADK67493.1"
FT                   /translation="MGPGGGDVLKHILIVATGGTIASTPQGGGLAPGLSGRQVADYVPQ
FT                   ASEVARVDVVQPLNIDSTNMSPADWLLIASTIAGAYEDYDGFVVLHGTDTMAYTAAALS
FT                   YLIQGSPKPIVLTGSQQPMGSPFTDARLNLYQSILYAADDLSSDVSIVFGGQVIVGTRA
FT                   HKQRTMSFNAFNSVNFPLPAIIRADRIVRDGGMGMSITGVPTAQATPDGAAPAHGSLKP
FT                   PTLYDRLCERVGVLRLTPGLDPAILSLLEGNFDAVILETYGIGGIPQGTDASWERAIFD
FT                   WVEGGHTIALTTQVSEEGLDLGVYEVGRAYAEHPDILKGDDMTTEALVAKLMWALGQTR
FT                   DRQRIRELFYRPVNHDRVPRQA"
FT   gene            406610..408292
FT                   /locus_tag="Olsu_0370"
FT   CDS_pept        406610..408292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0370"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG0488 ATPase components of ABC transporter
FT                   with duplicated ATPase domains; InterPro
FT                   IPR017871:IPR003439:IPR003593; KEGG: apv:Apar_0300 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: C8W9E3 ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67494"
FT                   /db_xref="GOA:E1QYN0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYN0"
FT                   /protein_id="ADK67494.1"
FT                   /translation="MAEFIYQMYKVRKAHGDKVVLDDVTMGFFPGAKIGVVGPNGMGKS
FT                   TLLKIMAGIEDISNGEARLAPGYSVGMLMQEPPLDEGRTVRENIEVAFSGLLAKIERFN
FT                   RIGEEMGEPDADFDALMAEMGDLQNEIDAANGWDLDSQLSQAMDALQCPDPDEPVSHLS
FT                   GGERRRVALCKLLLEAPDLLLLDEPTNHLDAESVLWLEQFLKNYQGAVLAVTHDRYFLD
FT                   NVAEWICEVDRGTLYPYEGNYSTYLETKARRLEMESKQNARRAKKMKSELEWVRSSQKA
FT                   RQAKSKARLAAYEEMEARAARADAKVDYADIHIPVGPRLGTKVLEAKRLRKTFGERVLI
FT                   DDLSFSLPRNGIVGVIGPNGVGKSTLFKMIVGQEPVSSGSLELGETVSLSYVDQGREGL
FT                   DGEKSVWEVVSGGNDHIVVGRQEIPSRAYVSAFGFKGTDQQKAAGVLSGGERNRLNLAL
FT                   TLKQGGNLLLLDEPTNDLDTETLEALEEALLEFPGCCVITSHDRWFMDRICTHILAWEG
FT                   TDENPGSWHWFEGNFEDYQKDRVARLGAEAARPHRLHRKLTRD"
FT   gene            complement(408438..409298)
FT                   /locus_tag="Olsu_0371"
FT   CDS_pept        complement(408438..409298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shi:Shel_04260 putative cell wall binding
FT                   protein; SPTR: A4ED23 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67495"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYN1"
FT                   /protein_id="ADK67495.1"
FT                   /translation="MRRRMPVIVSTIVAALSLCMLLVGCSAGGAGGGAKPADKSLFTGT
FT                   WDLVRMSGDKPDDNLGEDDVELMRSMGFDVFLNLNEDDTMELALFGSTMRGSWKVKSAA
FT                   EIEVTLEGQSVSATLSGEELTLSQEGTSMMFKKGKENKKAPDGTIGNPDESVANALTEA
FT                   ESDTDTIKPIEAVTIADDEHCTITVTGIGTDWSGDPGYAMTVTNKSDRAIDFSSKMGTF
FT                   SVNGKMIDAYVYETIQPGKYVECFMYFSKSDLGGGTEALSSVEGTLYIYDDASYEDIAE
FT                   YAFNM"
FT   sig_peptide     complement(409203..409298)
FT                   /locus_tag="Olsu_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            409496..410116
FT                   /locus_tag="Olsu_0372"
FT   CDS_pept        409496..410116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0372"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterProIPR001789:IPR000792:IPR011006:IPR016032:IPR 011991;
FT                   KEGG: shi:Shel_19260 response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   PFAM: response regulator receiver; regulatory protein LuxR;
FT                   SMART: response regulator receiver; regulatory protein
FT                   LuxR; SPTR: B1SBC7 Putative uncharacterized protein; PFAM:
FT                   Response regulator receiver domain; Bacterial regulatory
FT                   proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67496"
FT                   /db_xref="GOA:E1QYN2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYN2"
FT                   /protein_id="ADK67496.1"
FT                   /translation="MIRVMIVDDQAMLRDSLRVAIGQEHDMAVVASLSDASEAPAVVER
FT                   LGPDLVLMDVCTEGGQSGIAAVRRIKAAHPTVRCIVMTGMPEVTFVKQARESGADGFVY
FT                   KNVGTRELLALLRSTMAGYQTFPNAPAQDQLVSGLTSDEMGVLRLVCEAKSRREIAEEL
FT                   FLSEGTVKRRISEILAKTGYDSIMRLAVDVVSRGYVVPRLRGE"
FT   gene            410294..411028
FT                   /locus_tag="Olsu_0373"
FT   CDS_pept        410294..411028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shi:Shel_09730 hypothetical protein; SPTR:
FT                   A4ED19 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67497"
FT                   /db_xref="InterPro:IPR027872"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYN3"
FT                   /protein_id="ADK67497.1"
FT                   /translation="MGIFGNLFEKKTCAICGGEIGLLGNRKLEDGNLCKACAAKLSPFF
FT                   SDRRRSTVEQIREQLDYREANKAAVTALNVTRTLGDRTKILLDEDAQRFVVTPSGGRWR
FT                   DSNPDVMSFSQVTGCNVDVRTTREELYREGPDGERVSYDPPRYDTDYDIYVIINVNTPY
FT                   FDEIEFRINSMRIESPGSPDYQSAMDQAREIKEALTSVRENVRAAVAEAAAPKAAVVCP
FT                   HCGATTMPDANGRCEYCGGAVA"
FT   gene            411069..412274
FT                   /locus_tag="Olsu_0374"
FT   CDS_pept        411069..412274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4260 Putative virion core protein (lumpy
FT                   skin disease virus); InterPro IPR013032; KEGG:
FT                   ele:Elen_2535 hypothetical protein; SPTR: A4ED21 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67498"
FT                   /db_xref="InterPro:IPR033880"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYN4"
FT                   /protein_id="ADK67498.1"
FT                   /translation="MGLLKAGIGALSGVLSDSWRDYFYCESLAADVLAAKGEKRASGRG
FT                   SNVSGEANIISDGSIVNVSDGQCMMIVESGAVVEVCAEPGEFVYDASSEPSIFTGKLGE
FT                   SIAATFSQAGRRFTFGGSPAKDQRVYFFNTKEVMGNKYGTPSPVPFRVVDANIGLDVDI
FT                   SVSCNGEYSYRLTDPLLFYKNVCGNVKTAFTRDKIDSQLKSELLTALQPAFARISAMGI
FT                   RYSAVPGHTAELAQALNDVLSDTWSGLRGISVASFGMNSISASPEDERMIKDLQRAAVM
FT                   RDPTMAAANIAAAQSDAMRTAAANENGAMAGFMGMGMAGAMGGLNAQQLYQVGQPAGPA
FT                   PSPASVPSPDAWTCSCGETNTGRFCGGCGSPKPQPASEWFCPECGTRNAGRFCQNCGHP
FT                   RG"
FT   gene            412377..414146
FT                   /locus_tag="Olsu_0375"
FT   CDS_pept        412377..414146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0375"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shi:Shel_19280 hypothetical protein; SPTR:
FT                   A4ED26 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67499"
FT                   /db_xref="GOA:E1QYN5"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYN5"
FT                   /protein_id="ADK67499.1"
FT                   /translation="MATRYACRHGWQGPAVAAALVVPALLSLRSWGPSVVPVVPYPHES
FT                   PLGTSALMVVALPLLSLWGISVSHRCADAVVRRRLLLIDILLVTWNIDALVKYTAVSDA
FT                   VVELCWYLYYIPIVYLPLLLVLAALRVSGLEGCPWATIVRRGAVLVGAALFGAVATNGL
FT                   HGLAFVFDRLDPAWDVNYAYGPVYAAVHVWTAVMLLAFLALIVIHARKALRRVVLLVAL
FT                   VFVLGIAYSLLYALRVPLAYLTNYCLLYTSISVIVVEASLDLGLLPSYRGVARLFEDLP
FT                   LDIKILSPEGATAFASRSATPLTERAWRALAGLELPRGRMTSFRLPLHLVCHAFGIPGG
FT                   MAVLTEDIAELDDLRRALDLRREDLERHNRAIERARGVREELLARRIERDLVADVEPLL
FT                   SESVDLMHDILSSLPDAGDETSRERRRRRLVLVKLLVAYCKRRGALALAGDGVDPLGAE
FT                   HLHLLLDEIVADVRSAGMVCAMSVDVSGNLSNACMGQLYDCIHDLLMLVSKDEGATLIV
FT                   HLGEGRAGHIELRAAVDVGDEEACEALGRQLRGDPAHGLAASAVDVDDTVLHVHMTVSR
FT                   GTVMSQGEVGEAC"
FT   gene            414140..415672
FT                   /locus_tag="Olsu_0376"
FT   CDS_pept        414140..415672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0376"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="COGs: COG4585 Signal transduction histidine kinase;
FT                   InterPro IPR003594; KEGG: shi:Shel_19270 histidine kinase;
FT                   PFAM: ATP-binding region ATPase domain protein; SPTR:
FT                   C7N7Q8 Histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67500"
FT                   /db_xref="GOA:E1QYN6"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYN6"
FT                   /protein_id="ADK67500.1"
FT                   /translation="MLGGPPHPALLVCELLVVLFCLESVLQTIYVASLFSRQDLPLGSI
FT                   HLAHELSLAGALVVTAILCVEMTEGPVVLVVEFGVLGVPVDAMAAVGYACFALGALRVV
FT                   GPSSGMVPSVPPSEAEVGAGRPGPLLGTRLGVALESVLVLLATTHASLVVGEHWFVCLV
FT                   LLAAAMLYRTVSLVRWAHDRLNGSLTCLSPLQTLSELPEGVLCVTRDGRVLFMNDCMRR
FT                   CLATLGLTADLGDLSGAWEKIAAAAMAHDGGRVSDGGVRVGVTSDEVRYLMRHDMVALG
FT                   SGSVCILALDITEEERLRQGAQAVNQSLEGARRRLVDSLANVEETARIEARLTMRARVH
FT                   DVIGQRLSILHRCLEDGDVSDETVEHLQVLLDDITSDLRDPHEANPCRSLDTLVAAFGL
FT                   AGVDVRVTGSLPAGRPVAAFFVNTLREACTNAVRHGQACRVWVHLDQTEELLRLRVTND
FT                   GVCPVDGKIDERGGLGGMRHAAAALGATVRVTARPRFVVSVEVPLDPRPVSR"
FT   gene            complement(415629..417635)
FT                   /locus_tag="Olsu_0377"
FT   CDS_pept        complement(415629..417635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0377"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="COGs: COG2217 Cation transport ATPase;
FT                   InterProIPR018303:IPR008250:IPR005834:IPR001757:IPR
FT                   000695:IPR006404:IPR006416; KEGG: apv:Apar_0290 heavy metal
FT                   translocating P-type ATPase; PFAM: E1-E2 ATPase-associated
FT                   domain protein; Haloacid dehalogenase domain protein
FT                   hydrolase; SPTR: B9CMX9 Cadmium-translocating P-type
FT                   ATPase; TIGRFAM: heavy metal translocating P-type ATPase;
FT                   cadmium-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase; haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   heavy metal translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; heavy
FT                   metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67501"
FT                   /db_xref="GOA:E1QYN7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYN7"
FT                   /protein_id="ADK67501.1"
FT                   /translation="MSCHCCNHAAHHSHRHDEGHDEPGVSCHSHDADQDEDPKARLRKI
FT                   VVAAALLLAASVLQRLVELPLWLQLLAFLPSYAVAGASTLREAAENIGRGDPFDEDFLM
FT                   SVATIGALVIGFIPGGEPMFAEAVFVMLFFEVGELFEEMAEDNSRKSVAKLMDIRPDTA
FT                   SVERAGAVEVVDPGSVGPGETIVIRPGERVPLDGVVLEGASSLDTVALTGESLPRDVTV
FT                   GSEVVSGCVNVSGVLRVRVTRSFGESTASKILRLIEDAGQNKSRSEGFIRRFARAYTPV
FT                   VVCLAIVVALLPPIASGDFGANFATWLLRALTFLVVSCPCALVLSVPLTFFAGIGGASS
FT                   RGILIKGSNFMEALATADTVVFDKTGTLTQGSFEVGGVHPSLVDEDQLLHLAAHVERNS
FT                   THPIAAALRQAYPDEADDCSITDVSEIAGRGVVASVNGRRVAVGSTRLMDQVGAAWTLC
FT                   EGHVDDGTVIHVAIDGSYAGHVVIADRVKPDAAEAIRSIRAEGVRRIVMLTGDRREVAT
FT                   HVAKELGIDECRSGLLPADKVDDVERLLAERGEGASLAFVGDGINDAPVLARADVGIAM
FT                   GAMGSDAAIEAADVVLMDDRPSKIATAIRVARHTLAIARQNIAFAIAVKVAILILATMG
FT                   LAPMWLAVFGDVGVMVLCVLNATRALGQAAPRR"
FT   gene            complement(417777..418949)
FT                   /locus_tag="Olsu_0378"
FT   CDS_pept        complement(417777..418949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0378"
FT                   /product="glycoside hydrolase family 25"
FT                   /note="COGs: COG3757 Lyzozyme M1 (1
FT                   4-beta-N-acetylmuramidase); InterPro
FT                   IPR002053:IPR017853:IPR013781; KEGG: ccu:Ccur_13500
FT                   lysozyme M1 (1,4-beta-N-acetylmuramidase); PFAM: glycoside
FT                   hydrolase family 25; SPTR: B9CMM6 Lysozyme M1; PFAM:
FT                   Glycosyl hydrolases family 25"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67502"
FT                   /db_xref="GOA:E1QYN8"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYN8"
FT                   /protein_id="ADK67502.1"
FT                   /translation="MNDRKPTKRQAPTARGRGGATRSSSHSHTSRATSPHPSRGARASH
FT                   AERGVSRELRGSREDHSNRNRMHPARTTRAQTMTQKRTGAAREYSNSRARRAASATKPR
FT                   AAFLKPVIGIVAILLLLSMLRLVLCSSQDRQWAESMAQQSKVRVTTGLDSSTDLYHSPF
FT                   SWSNLVKNGDHYSYVVNGETLSRLGVDVSEHNASIDWSKVAADGIEFAYIRAGYRGTVE
FT                   GNIAPDATFDANLSGAQAAGLDVGVYFYSQAINEDEAAEEAGFVIRRLNGTPTTYPIAF
FT                   DLEPGASGTDRVSSLSQDQLTKVAAAFCRTCEAGGYHAVVYGSQVDLAHYNLEDLTSYG
FT                   FWYAEYESHPTMGLNFALWQYSSKGSVDGINGKVDLDLDLTPVTTAKKSQ"
FT   gene            complement(419157..420311)
FT                   /locus_tag="Olsu_0379"
FT   CDS_pept        complement(419157..420311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0379"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="COGs: COG0281 Malic enzyme; InterPro
FT                   IPR015884:IPR012301:IPR012302:IPR016040; KEGG: cbf:CLI_0318
FT                   malic enzyme; PFAM: malic protein NAD-binding; malic
FT                   protein domain protein; PRIAM: Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating); SPTR: C0CW49 Putative
FT                   uncharacterized protein; PFAM: Malic enzyme, NAD binding
FT                   domain; Malic enzyme, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67503"
FT                   /db_xref="GOA:E1QYN9"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYN9"
FT                   /protein_id="ADK67503.1"
FT                   /translation="MDDTSRRSLELHEQLHGKIEVISRRHVETRDDLSLLYTPGVAEPC
FT                   RQIQADYSKSWDLTRRGNMVAVITDGTAILGLGDIGPAAGMPVMEGKCALFKEFGDVDA
FT                   FPLCIDTHDVDEFVRTVYLISKSFGGINLEDIAAPRCFEIERRLKELCDIPVFHDDQHG
FT                   TAIVVAAAMINALKVTGKRMGQVKIVINGAGAAGCAIGALLAHMGFGNVVMCDVNGIVC
FT                   EGDEGLNSGQEAISHVTNADHERGTLADALRGADAFVGVSRPGLVTAEMVASMNEGIVF
FT                   PMANPTPEIMPDEALRGGAAVVGTGRSDFPNQINNVLVFPGIFKGALAARAREINEAME
FT                   VAAAQALASLVPDNQLSARNIIPSALDKSVADVVARAVADRARG"
FT   gene            complement(420315..421763)
FT                   /locus_tag="Olsu_0380"
FT   CDS_pept        complement(420315..421763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0380"
FT                   /product="fumarase"
FT                   /EC_number="4.2.1.2"
FT                   /note="COGs: COG0114 Fumarase;
FT                   InterProIPR020557:IPR000362:IPR018951:IPR003031:IPR
FT                   005677:IPR008948; KEGG: eat:EAT1b_0138 fumarate hydratase,
FT                   class II; PFAM: fumarate lyase; Fumarase C-like; SPTR:
FT                   C4G2U1 Putative uncharacterized protein; TIGRFAM: fumarate
FT                   hydratase, class II; PFAM: Lyase; Fumarase C C-terminus;
FT                   TIGRFAM: fumarate hydratase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67504"
FT                   /db_xref="GOA:E1QYP0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYP0"
FT                   /protein_id="ADK67504.1"
FT                   /translation="MCGETGEADGFRIEHDSMGEVRVPAAALWGAQTQRSLENFRIGTE
FT                   TMPGGIIRAFAILKKAAAQANAELGCLPAADARAIEAACDEILSGAHEREFPLKVWQTG
FT                   SGTQTNMNLNEVIARRANQIANRASPIVSQASRPADEHGVALERPIHPNDSVNRSQSSN
FT                   DTFPTAMHIAAVLAVKRRLIPAARELAQTFRLLEEKNTGIVKSGRTHLQDAVPIAFSQE
FT                   ISGWRGLVEAGIEQLEASLPGLCRLALGGTAVGTGLNAPAGFDALVARKIADITGEPFV
FT                   SDPNKFHALTGKDALVFSHGAMKALAANMMKVANDVRWLASGPRLGLGEITIPANEPGS
FT                   SIMPGKVNPTQCEAVTMVAVQVMGNDAAIGMAASQGNFELNVFMPVIAYDYLQSACLLA
FT                   DAIRSFDHNCAAGIRANRDRMSDNLHHSLMLVTCLNPYIGYENAARVAHKAFDESTSLR
FT                   TAAVALGYLTEAEFDKVFRPEEMV"
FT   gene            421977..422228
FT                   /locus_tag="Olsu_0381"
FT   CDS_pept        421977..422228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: TEF2; rhodanese-like Ca-sensing receptor;
FT                   SPTR: Q75T33 Calcium sensing receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67505"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYP1"
FT                   /protein_id="ADK67505.1"
FT                   /translation="MEGTTKSNSEVAARHAQELSSQFSPGVVEVVGNDNTLAESGVHSS
FT                   ADELARAMRGLVQALGADADAIGSAAATFDEWDEGQTY"
FT   gene            422300..423730
FT                   /locus_tag="Olsu_0382"
FT   CDS_pept        422300..423730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cja:CJA_3351 DNA repair protein RecN; SPTR:
FT                   C0C6A6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67506"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYP2"
FT                   /protein_id="ADK67506.1"
FT                   /translation="MIQIRPSAVQAQIEGKYGVMSALSDECERIGRAAQSFADEEALTG
FT                   PGWDAAKSRIAAYSKLTAAMVYACGIIGIADRHVFSALSSRFGSTSAVDEEEWLQMQQE
FT                   ARHMLAQAESILSSSTSRGTGQDGALGEYASAIPGYLERIRRAGEVLSKIYSYCEETNG
FT                   LYSDDELSGLCNLVARGTRALASSGFDGQTCSWSAWDDGWVGELDVVVQGIAACDPMSE
FT                   TGAVDTDEVSRALYMMRAFPEGSAPYESAKRMLEAALGKIMEMDEGVRRAALACFAQSG
FT                   LVTGARDEYGYLSPQCSDELGTILQETGTSWDVFLADAGYDEHEGADDLDVADTAIGTV
FT                   VSGLFEASMWSYGLEELAKGFSTIGGVTSATFLLAETMHSYQDAYDDAFYLDERSRRIH
FT                   ARSELDNTLVTGAGSIVICGFIGSGIGGAAGAAIGAFGGAALSVGMSVVGADKEVHGML
FT                   DPMFDDYAAWLNDSEREL"
FT   gene            423730..424422
FT                   /locus_tag="Olsu_0383"
FT   CDS_pept        423730..424422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0383"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR020175; KEGG: cai:Caci_2358 adenine
FT                   phosphoribosyltransferase; SPTR: Q8UZH0 BKRF2"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67507"
FT                   /db_xref="GOA:E1QYP3"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYP3"
FT                   /protein_id="ADK67507.1"
FT                   /translation="MDVSSSGGRRIASTFVVDADFYRLYARHTMSKRVFAILLAVGVAA
FT                   VWASFLVLRLPHGSLRVHLRVIFIVISFWGFWQFSTTSIALVRSHHLQRVEIHMVGGKW
FT                   CEGVLVMAEVTDSSASVSRSATECGSGERPPSKRVRKMTEGRYRDFPLLEGTYSLDEVT
FT                   RVVWSEGYALLVVGGMARTLPSETYRAMGIREAPAIPVALGPLGEDGRRRLRALLDERG
FT                   IPVRRVRR"
FT   gene            424464..424829
FT                   /locus_tag="Olsu_0384"
FT   CDS_pept        424464..424829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4495 conserved hypothetical protein; KEGG:
FT                   csc:Csac_0796 hypothetical protein; SPTR: A4XHN0 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67508"
FT                   /db_xref="InterPro:IPR025233"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYP4"
FT                   /protein_id="ADK67508.1"
FT                   /translation="MQDGHARGVGADDWLPLGSVVTLRGARHQVMIYGRRQRVQGAVGA
FT                   DASDDATGVAPMDGREWDYVACPWPEGNMGPGHTYLFDAESIDTVWFLGYQNRDEFSMR
FT                   RRLGTEPSAEGRHGLAE"
FT   gene            424813..425211
FT                   /locus_tag="Olsu_0385"
FT   CDS_pept        424813..425211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0385"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to Amyloid-like protein 2 precursor
FT                   (Amyloid protein homolog) (APPH) (CDEI box-binding protein)
FT                   (CDEBP) ; K08117 amyloid beta (A4) precursor-like protein
FT                   2; SPTR: Q4RRD5 Chromosome 16 SCAF15002, whole genome
FT                   shotgun sequence. (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67509"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYP5"
FT                   /protein_id="ADK67509.1"
FT                   /translation="MGWQNNDGERYAEGAEDERYVARYRQCCLDIELREDGLRNRERRA
FT                   YEELDALELLHAESRRWVERYQSLTEGMPGEAASVAWMYEGLSADEQGLWRCHDRLDEQ
FT                   FAKERRRLEDERESVELGWRTHWRGRGA"
FT   gene            complement(425741..426784)
FT                   /locus_tag="Olsu_0386"
FT   CDS_pept        complement(425741..426784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0386"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ele:Elen_1303 hypothetical protein; SPTR:
FT                   C8WGN1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67510"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYP6"
FT                   /protein_id="ADK67510.1"
FT                   /translation="MRLYLGHMSALRAWRQVRQGRLPVPRRSACRSVADPATSAVELAH
FT                   CGLGPLADTTPPDEATCILRGCARDPSDGPQAPLGQLDVLVAKRSQRHRIKGVRHHLLT
FT                   GEFPEGSFFLLANGVYLPSPELLLTLLSSNLSPWELIALAYELCGSYCLDPSLEAGFAS
FT                   HLEPLTSVDAIKRFLMEAKGLRGSARVGEVLRHLRDGSASPRESDLAMLLGLSPKEGGY
FT                   WMGDFTLNADLLFQGEDAKLTGGTNRSPDILFCGTSVICEYDSRTFHANEEELERDKDR
FT                   ADGLRAIGYEVVTASSLHFRSQADMMRLMKRLSRCLRTSVESEDPEVRAARAKLLGWVR
FT                   TPNHQPM"
FT   sig_peptide     complement(426698..426784)
FT                   /locus_tag="Olsu_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(427393..427905)
FT                   /locus_tag="Olsu_0387"
FT   CDS_pept        complement(427393..427905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0387"
FT                   /product="nitroreductase"
FT                   /note="COGs: COG0778 Nitroreductase; InterPro IPR000415;
FT                   KEGG: fma:FMG_1345 nitroreductase family protein; PFAM:
FT                   nitroreductase; SPTR: A7VT32 Putative uncharacterized
FT                   protein; PFAM: Nitroreductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67511"
FT                   /db_xref="GOA:E1QYP7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYP7"
FT                   /protein_id="ADK67511.1"
FT                   /translation="MDFMQLARERYSCKKFDGRKVDESLLQQILEAGRLAPTAKNLQEQ
FT                   HVYILESADALAKFDGASPCRYGASTVLLVAFDSENVFTYPGNAHDSGVEDAAIVATHM
FT                   MLAAKSLGVDSCWVNFFDPDALAATLALPKGEIILMALDLGYPAEGTKPLANHGNRKAL
FT                   EETVTRL"
FT   gene            complement(427958..428122)
FT                   /locus_tag="Olsu_0388"
FT   CDS_pept        complement(427958..428122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0388"
FT                   /product="hydrogenase nickel incorporation protein HypB"
FT                   /note="InterPro IPR001849; KEGG: eel:EUBELI_00703
FT                   hydrogenase nickel incorporation protein HypB; SPTR: B9CL92
FT                   Hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67512"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYP8"
FT                   /protein_id="ADK67512.1"
FT                   /translation="MTPHFDSNLAEHEKSVRLRNRDRAIMPLSVTTDEDMEVWLQWLQE
FT                   AVADHLPDC"
FT   gene            428295..429017
FT                   /locus_tag="Olsu_0389"
FT   CDS_pept        428295..429017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0389"
FT                   /product="B3/4 domain protein"
FT                   /note="COGs: COG3382 conserved hypothetical protein;
FT                   InterPro IPR005146:IPR020825; KEGG: shi:Shel_14900
FT                   hypothetical protein; PFAM: B3/4 domain protein; SPTR:
FT                   C7N6H5 Uncharacterized conserved protein; PFAM: B3/4
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67513"
FT                   /db_xref="GOA:E1QYP9"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYP9"
FT                   /protein_id="ADK67513.1"
FT                   /translation="MGKFVVEDSFWKLLPEVEIGVVCVDGILPTDQISKEGAVRAAKLL
FT                   DVANNAAERWLTSTTISTNEVVAVWRQAYQKFKTKKGARCSVENLLKRVLKDNPVGHIN
FT                   PAVDVSNAISLKYALPIGAENLDAVEGTFRLAQTEGGDRFLPIGEEESDPTLPGEVAYL
FT                   DDGGAICRCWNWRDGQRTKVSGATPHCVFIMENVDPSRSADLHAAIDEVARLAEEILGG
FT                   TVTAKGFVTKDSPEMELV"
FT   gene            429032..429493
FT                   /locus_tag="Olsu_0390"
FT   CDS_pept        429032..429493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0390"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="COGs: COG3467 flavin-nucleotide-binding protein;
FT                   InterPro IPR011576:IPR009002:IPR012349; KEGG: pdi:BDI_0093
FT                   5-nitroimidazole antibiotic resistance protein; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding;
FT                   SPTR: A6L874 5-nitroimidazole antibiotic resistance
FT                   protein; PFAM: Pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67514"
FT                   /db_xref="GOA:E1QYQ0"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYQ0"
FT                   /protein_id="ADK67514.1"
FT                   /translation="MRRQDRVVPAERAREILEVGEYAVLALVDVDGEPYGVPLSYAVEG
FT                   DRAFFHGTTETSHKLDAIRANPRASLTVVMNTEVHGAQYSTAFDSVIAFGPIRPAHDDT
FT                   EKRMGLMALLGKYSSMVPPERAMRYLEAQLDRTSVIVMDLERVTGKHHA"
FT   gene            complement(429626..430141)
FT                   /locus_tag="Olsu_0391"
FT   CDS_pept        complement(429626..430141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0391"
FT                   /product="putative GAF sensor protein"
FT                   /note="COGs: COG1956 GAF domain-containing protein;
FT                   InterPro IPR000614; KEGG: apv:Apar_1203 putative GAF sensor
FT                   protein; SPTR: B9CNA2 GAF domain protein; PFAM: GAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67515"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYQ1"
FT                   /protein_id="ADK67515.1"
FT                   /translation="MPDYELLAAQILSLAEEDRHWSCVLSNASALVYAALNESVPDCRA
FT                   PGTCDPAVPTVNWAGFYLMRSGRLVLGPFQGKAACVHIDLGRGVCGTAAATDGTQLVKD
FT                   VHRFPGHIACDSASNSEIAVPLHACDSVVGILDIDSPLLSHFTETDARGLEAVARTIED
FT                   VTDFSDIV"
FT   gene            430515..431918
FT                   /locus_tag="Olsu_0392"
FT   CDS_pept        430515..431918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0392"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /note="COGs: COG0017 Aspartyl/asparaginyl-tRNA synthetase;
FT                   InterProIPR004365:IPR004364:IPR002312:IPR004522:IPR
FT                   016027:IPR012340:IPR006195; KEGG: apv:Apar_0370
FT                   asparaginyl-tRNA synthetase; PFAM: tRNA synthetase class II
FT                   (D K and N); nucleic acid binding OB-fold
FT                   tRNA/helicase-type; SPTR: C8W9L3 Asparaginyl-tRNA
FT                   synthetase; TIGRFAM: asparaginyl-tRNA synthetase; PFAM:
FT                   tRNA synthetases class II (D, K and N); OB-fold nucleic
FT                   acid binding domain; TIGRFAM: asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67516"
FT                   /db_xref="GOA:E1QYQ2"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYQ2"
FT                   /protein_id="ADK67516.1"
FT                   /translation="MDRTKVAQLFAQMDELGGSEVTVAGWVRSIRDMKNFGFVVLNDGS
FT                   CFKDVQVVMNREKVANYDQVTTLTVGSALVVTGTLALTPDRPQPFELQAAEVVIEGAAR
FT                   PDYPMQKKRQSREFLRTQQHLRSRTNLFRAVFRVRSVAAFAIHQFFQGRGFVYVNTPII
FT                   TASDAEGAGEMFRVTTIDPANPPLTEDGKVDYSRDFFGKATNLTVSGQLQGENFAMSFG
FT                   DVYTFGPTFRAENSNTRRHAAEFWMVEPEMAFCDLAGEMDVSEEMLKYVITYVMDRCPD
FT                   EIDMLNSFVDKGLRERLSHVASSDFARVSYTDAVSILQEAQAAGATFEYPVEWGVDLQT
FT                   EHERYLTERHFRRPTFVTDYPAAIKAFYMRQNDDGKTVAAADCLVPGIGEIIGGSQREE
FT                   RLDVLERRIAELGMDVGQYKYYLDLRRYGSCRHAGFGLGFERLVMYLTGVDNIRDVIPH
FT                   PRTVGNADF"
FT   gene            431940..432791
FT                   /locus_tag="Olsu_0393"
FT   CDS_pept        431940..432791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0393"
FT                   /product="Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /note="COGs: COG0561 hydrolase of the HAD superfamily;
FT                   InterPro IPR018130:IPR013200; KEGG: apv:Apar_0157
FT                   HAD-superfamily hydrolase, subfamily IIB; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase type 3; SPTR: A4E841
FT                   Putative uncharacterized protein; PFAM: haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: HAD-superfamily
FT                   hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67517"
FT                   /db_xref="GOA:E1QYQ3"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYQ3"
FT                   /protein_id="ADK67517.1"
FT                   /translation="MIRLVLTDLDDTLIPFGVGHTSARANRAIHALLDAGAHFGPVTGR
FT                   IPASMGTMFCEDEECYRTGAFANGQVVSIDGEVVQRTLIEGALLRRVAGLLDDLCANAW
FT                   LAIYDSDDLRNVNLVTAHPERIRANPPETWGVSVFGIVSDVEDRGYLKANLQCSCDRDE
FT                   MTYVRDRLRRSIPELRFVFPSMTAKVIDINPGDWEKGDSVRLIAARLGVSLDEVVVFGD
FT                   SENDLSMMRAVPNSVAVANADEAVAAAARWHIGDVRDDAVAIALEDIALACARGGVPSF
FT                   FD"
FT   gene            433052..435154
FT                   /locus_tag="Olsu_0394"
FT   CDS_pept        433052..435154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0394"
FT                   /product="transcriptional antiterminator, BglG"
FT                   /note="COGs: COG3711 Transcriptional antiterminator;
FT                   InterProIPR013196:IPR002178:IPR016152:IPR011608:IPR 013011;
FT                   KEGG: sak:SAK_0523 PTS system IIA domain-containing
FT                   protein; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; Helix-turn-helix type 11
FT                   domain protein; SPTR: B0MBK6 Putative uncharacterized
FT                   protein; PFAM: HTH domain; PTS system, Lactose/Cellobiose
FT                   specific IIB subunit; PRD domain;
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67518"
FT                   /db_xref="GOA:E1QYQ4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYQ4"
FT                   /protein_id="ADK67518.1"
FT                   /translation="MNKRTVHIVQKLSRTSSPCSLASLARHFEVSERTIRNDIKALNRF
FT                   LDKQSLGQISFGPKGVIVLPDGFAQVEGLLPVEDTFAYKMSSEERKDLGAAVLINATDY
FT                   MTLGEIAELFSVSRATILNDLDGIKGRITESGLEVVSKPSRGILVRGRESAKRTFLRDF
FT                   ITRKVPIVDQWLALPENASMRLDGVTVKKIMNEQCHAHGITMMDGPFRLATNHLCICVM
FT                   RNRRGARLEELGGRYHDCAQEDVGGFEREVVGLVSQYCLVDMGTDEALFFAALGQSLRF
FT                   QGGTQFSIDDMQVQKLSRMFIRDMSGEIGVDLNGDYDLFEYLSNHLESMFTTEPSHFPE
FT                   TPALMEVVNDQPEVLEAVERNVGQLERYAGREITPVEVTYIALHICAALERRKNRGVRP
FT                   RVVVVCDGGIGTSQLLAEELRGHFEIKVVKVMPAHDVPYIEAYHADLVISTVPLDSCPV
FT                   DHIVIKLPLKDSEYSLIHEKLASIESSIRMSASDLDDLSAQGLLDRIEPVIADRVPKDA
FT                   DLLNAIRIEVRRYFREAQHLEDQLVSPYLHQLLPPSHISLDVDCADWRDAIRKSAQPLL
FT                   DMGYIEERYVESMVHGVEKHGPYIVLAPGFAIPHSSPENGTIKMGMSLIRLRRPVRFGS
FT                   DENDPIEFVCTLSAVDRKTHLKAFADLLDMIVMPRNSFLDDMRKAADPLEAASLIERYE
FT                   YLVIQR"
FT   sig_peptide     433052..433123
FT                   /locus_tag="Olsu_0394"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            435415..435888
FT                   /locus_tag="Olsu_0395"
FT   CDS_pept        435415..435888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0395"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="COGs: COG1762 Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type); InterPro
FT                   IPR002178:IPR016152; KEGG: putative PTS IIA-like
FT                   nitrogen-regulatory protein PtsN; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2; SPTR: B0MFQ2 Putative uncharacterized
FT                   protein; PFAM: Phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67519"
FT                   /db_xref="GOA:E1QYQ5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYQ5"
FT                   /protein_id="ADK67519.1"
FT                   /translation="MLGKEIIMRDLTALDLDAKSCEQVFDIMGARFLEKGYVNERYLPT
FT                   IKEREAQYPTALPVEPYPIAIPHTMADAILKPFIAPVRLKNTVEWGDMSDPDNKFDVKL
FT                   VCMLGFKDPGEHIELLQILMHNFQKSEWVNPLFSAKTEDEFFEAFNSMEWAHE"
FT   gene            435955..436245
FT                   /locus_tag="Olsu_0396"
FT   CDS_pept        435955..436245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0396"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="InterPro IPR003501:IPR013011; KEGG: sak:SAK_0525 PTS
FT                   system, galactitol-specific IIB component, putative; PFAM:
FT                   phosphotransferase system lactose/cellobiose-specific IIB
FT                   subunit; SPTR: C2GF97 PTS family galactitol (Gat) porter
FT                   component IIB; PFAM: PTS system, Lactose/Cellobiose
FT                   specific IIB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67520"
FT                   /db_xref="GOA:E1QYQ6"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYQ6"
FT                   /protein_id="ADK67520.1"
FT                   /translation="MSVKVIVACGSGVATSQTVASKVNRLLAADKIDAKVEAVDLKSVD
FT                   RHLKDAAAYITIVRDKKTYDLPVIDGIAFLTGVGQKQQYEKLLDAIKSYRG"
FT   sig_peptide     435955..436038
FT                   /locus_tag="Olsu_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            436330..437718
FT                   /locus_tag="Olsu_0397"
FT   CDS_pept        436330..437718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0397"
FT                   /product="PTS system Galactitol-specific IIC component"
FT                   /note="COGs: COG3775 Phosphotransferase system
FT                   galactitol-specific IIC component; InterPro
FT                   IPR004703:IPR013014; KEGG: PTS system galactitol-specific
FT                   IIC component; PFAM: PTS system Galactitol-specific IIC
FT                   component; SPTR: A8R9X7 Putative uncharacterized protein;
FT                   PFAM: PTS system sugar-specific permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67521"
FT                   /db_xref="GOA:E1QYQ7"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYQ7"
FT                   /protein_id="ADK67521.1"
FT                   /translation="MDFAAASAWVNGFLSSVGAAVFVPIIMIVMGLVVRMKPKDAISSG
FT                   ILLGVAFTGMSMLISYMGEIISPVGEAMLKNIGINLPILDGGWTTMAAIAWSWPYAILM
FT                   FPLMIAINIIMLVANKTDTFNADLWNVWGKIFTAVGVVGLTGNIVLAFVIAAIQIVFEL
FT                   KTADLFSDEICELTGIPGVTCTHKMVFLSAIYYPIDKLLRKIPALNHKADAEALHEKVG
FT                   IFAENHVLGFILGCFFGILGQYDLGALLTLGVQCAMCLTLFPVISKYFMESLSPISEAV
FT                   SDYMHGKFEGRQLVVGLDWPFLGGSNEIWLAVIYGIPVTVLFAFILPQNQILPFAGIVN
FT                   IALAVPAYLVTKGNLPRMIILSTIGVPIFLLVGTAFAPFISELATSTGAVAADALGASG
FT                   LISNSSIDGPWFTYAFSQFLAVQNGNVLPLGMLIVWIGGYALMYHDLTKERKARKAAAE
FT                   AQAE"
FT   gene            437839..438507
FT                   /locus_tag="Olsu_0398"
FT   CDS_pept        437839..438507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0398"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="COGs: COG0235 Ribulose-5-phosphate 4-epimerase and
FT                   related epimerase and aldolase; InterPro IPR001303; KEGG:
FT                   cdf:CD2277 sugar phosphate aldolase; PFAM: class II
FT                   aldolase/adducin family protein; SPTR: B0MFP7 Putative
FT                   uncharacterized protein; PFAM: Class II Aldolase and
FT                   Adducin N-terminal domain; TIGRFAM: L-ribulose-5-phosphate
FT                   4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67522"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYQ8"
FT                   /protein_id="ADK67522.1"
FT                   /translation="MLEDLKLRVMNVAKQAQREGMCKHKSGNFSARDEETGLVVITPTS
FT                   VDREDLVVPDMVVMDLDANVVENQTGLRPTSESLMHLKIYQTRPDVRAIAHTHSQFATT
FT                   FAVLEKPIPAVVYEIANLNCSKARIPVAPYGRPGTPALADSVVDSVKEADVLLLQGHGS
FT                   VAVDEDNIDEAYLKVCYIEELAELYYHALTANGGQEPKSFPVEELQKWEYPKEIKFPNA
FT                   "
FT   gene            438611..439201
FT                   /locus_tag="Olsu_0399"
FT   CDS_pept        438611..439201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0399"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcg:BCG9842_B2176 lysine-specific permease;
FT                   SPTR: Q3EQM1 Lysine-specific permease"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67523"
FT                   /db_xref="GOA:E1QYQ9"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYQ9"
FT                   /protein_id="ADK67523.1"
FT                   /translation="MSKKNPRKKSAEGNAPNQTNRKGFSLPKVSERRHPEPVSAGSRVA
FT                   SLVELAAVCAVWVLAARVLFVGGTLLTTALVAVLYFVGALSMYVVRAALEAKRRYGRTD
FT                   KDALLYYNQMIKGDQKWSLYIGMSFFAVFVVMRWLFPSPNFDMVGIDIATAFYLGYIWT
FT                   AKYKGEEHLPFQYMETVYLFLTVITNYIVYFLG"
FT   gene            439215..440207
FT                   /locus_tag="Olsu_0400"
FT   CDS_pept        439215..440207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0400"
FT                   /product="dihydroxyacetone kinase DhaK subunit"
FT                   /EC_number="2.7.1.29"
FT                   /EC_number="2.7.1.121"
FT                   /note="COGs: COG2376 Dihydroxyacetone kinase; InterPro
FT                   IPR004006; KEGG: oan:Oant_4368 glycerone kinase; PFAM: Dak
FT                   kinase; PRIAM: Glycerone kinase; SPTR: A8RJ36 Putative
FT                   uncharacterized protein; PFAM: Dak1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67524"
FT                   /db_xref="GOA:E1QYR0"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYR0"
FT                   /protein_id="ADK67524.1"
FT                   /translation="MKKIINSSESYVDEMLSGIYAAHPDQVKYAANDLRCYCAAKKKEG
FT                   KVAIITGGGTGHLPLFLGYVGEGLLDGCGVGGVFQSPSAEQIYNIATEVEAGAGVLFLY
FT                   GNYTGDIMNFDMAAEMLEMDDIEARSIVGADDILSNKDPESRRGVAGIFFMYKAAGARA
FT                   DQMGTLGEVLAAAKKAGDNVRTVGFALTPCIVPEVGRANFELAEDEMAFGMGIHGEPGV
FT                   WNGPVKTADELAEESVDEILTDMPLTDGDEVALLVNGLGATSVEELYILNNSVRKQLET
FT                   KGISVYRSWTGEYATSMEMMGASISICKVDDELKGYFDYPIDTPFLCQK"
FT   gene            440262..440912
FT                   /locus_tag="Olsu_0401"
FT   CDS_pept        440262..440912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0401"
FT                   /product="Dak phosphatase"
FT                   /note="InterPro IPR004007; KEGG: oan:Oant_4367 Dak
FT                   phosphatase; PFAM: Dak phosphatase; SPTR: B0P8L1 Putative
FT                   uncharacterized protein; PFAM: DAK2 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67525"
FT                   /db_xref="GOA:E1QYR1"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYR1"
FT                   /protein_id="ADK67525.1"
FT                   /translation="MDKLTIENIPQMFDYVGILFAEKRDELCAMDAVMGDGDLGLTMSK
FT                   GYGALPAFLRDLTGEGDIGKMMLKGAMKMQNTVPSTMGTLMSSGIMEASKAFRGKTELV
FT                   PADMVTYVTQFAIGIRKRGKCELGDRTILDSVDAGAKRAAALVESDASASFLDVLTAAV
FT                   EGAEEGCEATKGMLPKFGKAAVHSAKAKGIVDQGALAGKYMLEGLKNYFADQQ"
FT   gene            440995..442707
FT                   /locus_tag="Olsu_0402"
FT   CDS_pept        440995..442707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0402"
FT                   /product="homodimeric dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /note="COGs: COG2376 Dihydroxyacetone kinase; InterPro
FT                   IPR004006:IPR004007; KEGG: msm:MSMEG_3271 dihydroxyacetone
FT                   kinase; PFAM: Dak kinase; Dak phosphatase; PRIAM: Glycerone
FT                   kinase; SPTR: A0QXE4 Dihydroxyacetone kinase; PFAM: DAK2
FT                   domain; Dak1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67526"
FT                   /db_xref="GOA:E1QYR2"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYR2"
FT                   /protein_id="ADK67526.1"
FT                   /translation="MLYNDPKTFREDMLRGYVAAYPDYVVEVPGGVARATKMPEGKIAV
FT                   INGGGSGHYPAFCGIVGDGFMDGTVVGNVFTSPSTEDVLGVARSVDNGRGIFIVGGNYA
FT                   GDKMNFNMARDRLVGEGVDCRSFYITDDVAAAKAEEKEKRRGNVGTFMVFKAAGAAAAA
FT                   GVSFDDLVRITEKANERTRTMSMGFRGCTLPGEAAPLFHVPEGKMEIGQGIHGEPGVGE
FT                   DDLRPAAEVARILVDRVLAEAPADDSKRIAVILDGLGSTKYEELFVVWGTVRGLLEDRG
FT                   YTLVEPLVGEYVTSLDMEGIALAVEFLDDELETFWSAPCDTASFRKGASSMAAGERKVY
FT                   AESVEAAETFEEGSEASNAAADGIVDAFARMQAAIVDAEDDLARIDGVAGDGDHGRGMV
FT                   KGSTFAADAAKAARERGAAAGSVLKEAGRAWAAKAGGTSGVLWGSALEAAGEVVGDQAE
FT                   SYDASLAAKAVKAAYERMLSLGGAHRGDKTMLDVLIPFGEELEAQAAEGRSLRDAWSVA
FT                   AEVAQKSAEETANLVPKVGRARPAAERSLGTPDAGAVSMALCIRAALGPGRPA"
FT   gene            442984..443715
FT                   /locus_tag="Olsu_0403"
FT   CDS_pept        442984..443715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0403"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011663:IPR011991; KEGG: ecc:c4276 putative
FT                   regulator; PFAM: UbiC transcription regulator-associated
FT                   domain protein; regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH; SPTR: Q8FCM7 Putative
FT                   regulator; PFAM: Bacterial regulatory proteins, gntR
FT                   family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67527"
FT                   /db_xref="GOA:E1QYR3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYR3"
FT                   /protein_id="ADK67527.1"
FT                   /translation="MQSNSTTPLHVQACNYIREKIYNHEWEVGKKIPTEFELCEQLGMS
FT                   RGSIKKGIKTLVDEGLLVQYRGRGTFVTESNRFSHPSGSTLLSFAESLRAQGIEFTTEV
FT                   LGKELIPADDFLSKKLGIAIGEPVFYMRRVRLVEDEPVMYIENRINRTVCPGIEEIDFE
FT                   TEPLFQSLERCSKHRLGFSRVKYAAKVAGEERGRVLKVSEDAPILHLEQHIFYDDDTPT
FT                   EWGNVWLKANRYVVGTVLLRT"
FT   gene            444058..444909
FT                   /locus_tag="Olsu_0404"
FT   CDS_pept        444058..444909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0404"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /EC_number="4.1.2.40"
FT                   /note="COGs: COG0191 Fructose/tagatose bisphosphate
FT                   aldolase; InterPro IPR000771:IPR013785; KEGG: elf:LF82_p538
FT                   fructose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II; PRIAM: Tagatose-bisphosphate aldolase;
FT                   SPTR: C8TYA4 Putative aldolase; TIGRFAM:
FT                   ketose-bisphosphate aldolase; PFAM: Fructose-bisphosphate
FT                   aldolase class-II; TIGRFAM: ketose-bisphosphate aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67528"
FT                   /db_xref="GOA:E1QYR4"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYR4"
FT                   /protein_id="ADK67528.1"
FT                   /translation="MPLINMGDLIKIAKKNDIMLPAYNTTDVEMTLGIMDAFDRAGMPG
FT                   IIQIAPTNVKVTGYDFIAETTRMAAENYVTPFALHLDHGKALEDVRQAVLAGFTSVMID
FT                   GAALPFEENIRLSREAVDFAHCYGVSVEAELGAIRGKEDDHVSEADSHTDPSQVAEFCE
FT                   RTGCDTLAVSIGNVHGLEERPKIDLSHLAKIAEVAPVPLVLHGGSGIPDETIRAMRRYG
FT                   MIKVNIASDLRRAFIRAIALRYETNHNEANLASVLLDARHAVTEVAYQKTMAMNASEMP
FT                   VV"
FT   gene            444980..445261
FT                   /locus_tag="Olsu_0405"
FT   CDS_pept        444980..445261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0405"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="COGs: COG3414 Phosphotransferase system
FT                   galactitol-specific IIB component; InterPro
FT                   IPR003501:IPR013011; KEGG: stm:STM3783 putative periplasmic
FT                   protein; PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; SPTR: Q8XGY8
FT                   Putative IIB component of PTS system; PFAM: PTS system,
FT                   Lactose/Cellobiose specific IIB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67529"
FT                   /db_xref="GOA:E1QYR5"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYR5"
FT                   /protein_id="ADK67529.1"
FT                   /translation="MTKKRVLFVCATGIATSTVVEEKVIEYCKDQGIEFDYDQRNVASV
FT                   PNIADDFDLIVATTNIPYKLDVPVMSGLPILTGWGSQEVLDQIADALR"
FT   gene            445319..446680
FT                   /locus_tag="Olsu_0406"
FT   CDS_pept        445319..446680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0406"
FT                   /product="PTS system Galactitol-specific IIC component"
FT                   /note="COGs: COG3775 Phosphotransferase system
FT                   galactitol-specific IIC component; InterPro
FT                   IPR004703:IPR013014; KEGG: eoh:ECO103_4205 putative
FT                   phosphotransferase system enzyme IIC; PFAM: PTS system
FT                   Galactitol-specific IIC component; SPTR: C8TYA1 Putative
FT                   phosphotransferase system enzyme IIC; PFAM: PTS system
FT                   sugar-specific permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67530"
FT                   /db_xref="GOA:E1QYR6"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYR6"
FT                   /protein_id="ADK67530.1"
FT                   /translation="MDGLTQTLYDIVQYILGFGATVMLPLVIFVLALVFRIKPAKAFRS
FT                   ALVVGIGFVGVFAIFSLMGEQIGPAAQAIVERTGLSLPAVDLGWAPLSAITWGSPIAPF
FT                   AIVLTLLINLVMLAVKWTKTIDIDIWNYWHFAFAGCLVYVATGNFALGLLGSAIAAVII
FT                   IKIADWCAPLVQKYCNLPGISLPTLSSAVFFPIGLLGNWILDKVPGINKLHADPETIQK
FT                   RFGIFGEPMMVGFMLGMLLGLLAGYDFKGVLALAINLGAVMYILPRMVRILMDGLIPIS
FT                   DGVKDFMARRFPDRADFYIGLDIAVAIGNPAIISTGLLLTPIAILLAFLVPGNQTLPVA
FT                   DLSNMAVFCSMIVVACNQNIVRAVIIAIPCLIGDLLVCSAAAPLITQLATSVGYDTSAS
FT                   GSLVTAFLDGGNPFRYLIYQVFSGNIVAAVVAVIVAVLVAFTWRVTHRQAYMEG"
FT   sig_peptide     445319..445444
FT                   /locus_tag="Olsu_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            446766..448271
FT                   /locus_tag="Olsu_0407"
FT   CDS_pept        446766..448271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0407"
FT                   /product="Carbohydrate kinase, FGGY"
FT                   /note="COGs: COG1070 Sugar (pentulose and hexulose) kinase;
FT                   InterPro IPR018484:IPR018485; KEGG: carbohydrate kinase
FT                   FGGY; PFAM: Carbohydrate kinase, FGGY-like; SPTR: C4C836
FT                   Pentulose/hexulose kinase; PFAM: FGGY family of
FT                   carbohydrate kinases, N-terminal domain; FGGY family of
FT                   carbohydrate kinases, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67531"
FT                   /db_xref="GOA:E1QYR7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYR7"
FT                   /protein_id="ADK67531.1"
FT                   /translation="MPYAIGIDVGTTNSKVVLCDLSSCVVMDTEKFESPRTVEGEHVDY
FT                   DINVLMERIVGSLRHCTKRLGASSRDVRFVSIASVGESGVLVHRDGSFDGRSIFWYDRR
FT                   GETYSNAVCREGYARRMYGITGLPVHPNSALFKILWLRDNGADIGDAVWLPLADFVAWY
FT                   LCGEQGQDQTLASRTAVLDMKSATVSDEILDRFSLPHTFFPAVKRSGVSRGTVLADISK
FT                   VTGLPTACEVCVAGHDHMVGSMACGVMSEGSILNSTGTSEGILSLGKEPKLGDEAFDRN
FT                   LSNGRYVLDGAYSFYTSVPAAGFSFQWGLSVLGMNPDDFFGRGQFDLYDRYVKCRPVDN
FT                   RPIDSDVLFVPHLRGSGPPHRNPKSRGVFYGLSETTKRDDLVYSLHLGVCMEFNRLFRC
FT                   MSDESIRAASNIKVIGPAVKNPLWMQMKADVLGVPVIGCDVQEAVALGAVLVAARQRGL
FT                   SCELSFDSSLYEPDSHRHERLQDVYENRYVPLCDSIRAFEDRL"
FT   gene            complement(448600..449223)
FT                   /locus_tag="Olsu_0408"
FT   CDS_pept        complement(448600..449223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0408"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="COGs: COG0406 Fructose-2 6-bisphosphatase; InterPro
FT                   IPR013078; KEGG: cth:Cthe_2449 phosphoglycerate mutase;
FT                   PFAM: Phosphoglycerate mutase; SPTR: A3DI72
FT                   Phosphoglycerate mutase; PFAM: Phosphoglycerate mutase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67532"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYR8"
FT                   /protein_id="ADK67532.1"
FT                   /translation="MGCKVILIRHGLTYWNARKMMQGQVNIPLNDVGVRQARGLARQIS
FT                   PFPLDVCYASPLGRSLKTAQLALEDRNIPIIKDERLIEHGYGLLESTSYRRTPWFRLTS
FT                   QAYNYECRPERYRAPIGGETFEDVYARARSFIDEVLLPEAERHDGILVAGHGGVNCAIM
FT                   GCLFDIPLKDFWSVKQANCGYTVIDVDNGTPAIEYSTPVEVNAR"
FT   gene            complement(449417..449857)
FT                   /locus_tag="Olsu_0409"
FT   CDS_pept        complement(449417..449857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0409"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="COGs: COG1990 conserved hypothetical protein;
FT                   InterPro IPR002833; KEGG: apv:Apar_0308 protein of unknown
FT                   function UPF0099; PFAM: protein of unknown function
FT                   UPF0099; SPTR: B9CMM9 Putative uncharacterized protein;
FT                   PFAM: Peptidyl-tRNA hydrolase PTH2; TIGRFAM: conserved
FT                   hypothetical protein TIGR00283"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67533"
FT                   /db_xref="GOA:E1QYR9"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYR9"
FT                   /protein_id="ADK67533.1"
FT                   /translation="MTVSSYKSKQMIVMRRDLKMRKGKIAAQSGHACVEATLMALAREG
FT                   RLGQVRVTDDQSWVYLDDEGTEPTPLSDWFDAGVAKVCVYVDGEDALLDVAHQGREQGF
FT                   AVALVRDAGLTEFHGETTYTCLAFEPLPASKIDPITGSLPLY"
FT   gene            complement(449910..450341)
FT                   /locus_tag="Olsu_0410"
FT   CDS_pept        complement(449910..450341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0410"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="COGs: COG1047 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase 2; InterPro IPR001179; KEGG: apv:Apar_1074
FT                   peptidylprolyl isomerase FKBP-type; PFAM: peptidylprolyl
FT                   isomerase FKBP-type; SPTR: C8W7R1 Peptidylprolyl isomerase
FT                   FKBP-type; PFAM: FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67534"
FT                   /db_xref="GOA:E1QYS0"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYS0"
FT                   /protein_id="ADK67534.1"
FT                   /translation="MSNEGKRVKVHYVGTLDDGTKFDSSRDRGEPLAFTCMAGQMIPGF
FT                   DQAVRGMEVGQTLTVHLEPAEAYGEHHDELVREFPMTQVPEHMRGISVGEKLFLRSPQG
FT                   APIPATVRRVTPEALYLDMNHEMAGKALNFEIELLEVEG"
FT   gene            450556..451329
FT                   /locus_tag="Olsu_0411"
FT   CDS_pept        450556..451329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0411"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="COGs: COG0796 Glutamate racemase; InterPro
FT                   IPR018187:IPR015942:IPR004391:IPR001920; KEGG:
FT                   ccu:Ccur_06670 glutamate racemase; PFAM: Asp/Glu/hydantoin
FT                   racemase; PRIAM: Glutamate racemase; SPTR: C2D8Q0 Glutamate
FT                   racemase; TIGRFAM: glutamate racemase; PFAM:
FT                   Asp/Glu/Hydantoin racemase; TIGRFAM: glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67535"
FT                   /db_xref="GOA:E1QYS1"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYS1"
FT                   /protein_id="ADK67535.1"
FT                   /translation="MADKSSFVGVFDSGVGGISVLRHLVDELPHEDFCYFGDSANNPYG
FT                   GKTPDEILSLSRGIVDDMAARGAKAVVIACNTATSVAAARLRLEYPDLPIVGVEPAIRP
FT                   ATRAPRHERILVMATQVTLALDKYHRLAEECGSSSQILGEPCVGLAHRIEQGNLDAPDL
FT                   HGLIETLVGRYRGTVDSVVLGCTHYPFVRAQIRDVVGDVPLFDGGTGAARRLRSLLAER
FT                   DLLAEGDAPGSVAFASSLRGPGQLDLYERFFRLEV"
FT   gene            complement(451439..452323)
FT                   /locus_tag="Olsu_0412"
FT   CDS_pept        complement(451439..452323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0412"
FT                   /product="degV family protein"
FT                   /note="COGs: COG1307 conserved hypothetical protein;
FT                   InterPro IPR003797; KEGG: apv:Apar_1121 DegV family
FT                   protein; PFAM: DegV family protein; SPTR: B9CNX0 DegV
FT                   family protein; TIGRFAM: degV family protein; PFAM:
FT                   Uncharacterised protein, DegV family COG1307; TIGRFAM: EDD
FT                   domain protein, DegV family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67536"
FT                   /db_xref="GOA:E1QYS2"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYS2"
FT                   /protein_id="ADK67536.1"
FT                   /translation="MPNYTLCCCSTADVTEDFLKERDIRYVFFNYELDGEQCKDDFGLT
FT                   HSPTDLFARMEAGAQTKTSQVSVGDYMAFWRPMLASGQDVLHVTLSSGISGTYNSACTA
FT                   RDEIASEFPDRRVVVVDSLAASSGYGLLMDKLSELRRAGMDLDGLAAWAEAHRREVQHW
FT                   FFSSDLTFFIRGGRISKTAGFFGNMLKICPVMDVEPDGSLAVREKVRTKRRAERRVLEL
FT                   MRELAQGGDGYGGKVFISNSACLGDAQDVARMIEGEFPQMDGPVQHFDIGATIGCHTGP
FT                   GTVATFFWGKERA"
FT   gene            452686..453204
FT                   /locus_tag="Olsu_0413"
FT   CDS_pept        452686..453204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0413"
FT                   /product="PTS system, glucose subfamily, IIA subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="COGs: COG2190 Phosphotransferase system IIA
FT                   components; InterPro IPR001127:IPR011055; KEGG:
FT                   apv:Apar_0904 PTS system, glucose subfamily, IIA subunit;
FT                   PFAM: sugar-specific permease EIIA 1 domain; SPTR: C8W794
FT                   PTS system, glucose subfamily, IIA subunit; TIGRFAM: PTS
FT                   system, glucose subfamily, IIA subunit; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 1; TIGRFAM: PTS system, glucose subfamily, IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67537"
FT                   /db_xref="GOA:E1QYS3"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYS3"
FT                   /protein_id="ADK67537.1"
FT                   /translation="MGFFDRFKRPAKPEALGVTPSEGVVLAPVSGEEIRLEDSSDPVFS
FT                   CLALGKGCAIKPGASVVYAPVSGTLTAAGAPNFHAIGITSDDGVEVLIHVGVDTVEMHG
FT                   EGFEVFVEKDAHVRAGEPLLRFSAEKIRAAGHDDAVLMAITNTDDYSSVEPAELGEVSA
FT                   GSPALIVRR"
FT   gene            complement(453409..454422)
FT                   /locus_tag="Olsu_0414"
FT   CDS_pept        complement(453409..454422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cac:CAC2564 hypothetical protein; SPTR: A4EB16
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67538"
FT                   /db_xref="InterPro:IPR025964"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYS4"
FT                   /protein_id="ADK67538.1"
FT                   /translation="MAVTFEGYERRIDKINKALAEYGIADLEEALKLCTDRGFNPYDIT
FT                   KGVQSIAFENAAWAYTLGCAIALRKAERGEVTNASEAAAAIGEGLQAFCVPGSVAEDRK
FT                   VGLGHGNLGAMLLGEDTECFAFLAGHESFAAAEGAIGIANNANKARKKPLRVILNGLGK
FT                   DAAQIIARINGFTYVKTKFDYYTGELTVVETIPYSDGPRAAVNCYGADDVREGVAIMWH
FT                   ENVDISITGNSTNPTRFQHPVAGTYFKERTLAGKKYFSVASGGGTGRTLHPDNMGAGPA
FT                   SYGMTDTMGRMHSSAQFAGSSSVPAHVDMMGLIGMGNNPMVGCTVACAVAVEEAIA"
FT   gene            complement(454442..455134)
FT                   /locus_tag="Olsu_0415"
FT   CDS_pept        complement(454442..455134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0415"
FT                   /product="NifU-like domain-containing protein"
FT                   /note="COGs: COG0822 NifU homolog involved in Fe-S cluster
FT                   formation; KEGG: cac:CAC2565 NifU-like domain-containing
FT                   protein; SPTR: A4EB17 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67539"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYS5"
FT                   /protein_id="ADK67539.1"
FT                   /translation="MQYSAEVEKMCPVAKGAYHGPAPIPEEGKWVQAKEISDISGYTHG
FT                   VGWCAPQQGACKLSLNVKEGVIEEALIETIGCSGMTHSAAMAAEILPGKTILEALNTDL
FT                   VCDAINVAMRELFLQIVYGRTQTAFSEDGLPVGAGLDDLGKGLRSMVGTTYGTKEKGAR
FT                   YLELAQGYVTHLALNDKDEIIGFEFLNLGKFTDALKAGTDPKQAVDDAMGRYGQWDNPA
FT                   KVIDPREE"
FT   gene            455317..458556
FT                   /locus_tag="Olsu_0416"
FT   CDS_pept        455317..458556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0416"
FT                   /product="SNF2-related protein"
FT                   /note="COGs: COG0553 Superfamily II DNA/RNA helicase SNF2
FT                   family; InterProIPR007527:IPR013663:IPR000330:IPR001650:IPR
FT                   014001:IPR014021; KEGG: shi:Shel_14860 DNA/RNA helicase,
FT                   superfamily II, SNF2 family; PFAM: SNF2-related protein;
FT                   zinc finger SWIM domain protein; SNF2 helicase associated
FT                   domain protein ; helicase domain protein; SMART: DEAD-like
FT                   helicase ; helicase domain protein; SPTR: C7N6H1 DNA/RNA
FT                   helicase, superfamily II, SNF2 family; PFAM: Helicase
FT                   conserved C-terminal domain; Bacterial SNF2 helicase
FT                   associated; SNF2 family N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67540"
FT                   /db_xref="GOA:E1QYS6"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR013663"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYS6"
FT                   /protein_id="ADK67540.1"
FT                   /translation="MISEAALRRSCRPAVLGRAQTIVQRGGHIWQRDCRHDGPVTHLSA
FT                   NVDGSSGHDVSYHATISFDEIAERVCGFSCTCPAAVRFPGPCKHSVALALDYNRGARGF
FT                   AGYDALVHASTSPALSNLLDRSAQPVRTRLSSAPEERAGSVSLKLTLVHDLELFARFDL
FT                   RGSRGSYVVRSISDLVSDVAEGAWHEYGKRLAFTHTVDAFDGPSRAVVRFLTRCVRNRR
FT                   SFASERLYGHVYGTPSPSQVSVGREMRLSSPEADELIGLYMGREIDLDDVRMGFRGPLR
FT                   VAEGNPSVSLSVESVGDGAYELVRGGDVAFFSTDEALYACQGGRLLRCDDRLARVAPFL
FT                   TGVYCSPTPRLLLSERDAPRFAATLLPALEEALPVNVAPAVERLRPAPCRLEFRLDRTR
FT                   SDVTCEADAVYGEERHALLGHTLGEQLDPARDASREADARQLVGRYFAVGRTGVATIAE
FT                   KDSDALARLLFEGLGELRRMGEVLSTDAFDALVATAVPRVRVGLSVRANLIDLKVSADD
FT                   LPLSELHALLGSYRAHRRFHRLRDGSFVDLAGADLSEAARLADELGLTARELSRGEVQI
FT                   PSYKAFLLDAIASDEEKDASFVEYVDNFRSVDPSCYEPPACLASVLRPYQVSGYQWLSA
FT                   LVDMGFGGILADEMGLGKSVQLISLLLARRGRGATLVVCPASLVYNWEAEFAKFAPQLD
FT                   VAVVAGSADERARIRGECGHEVLITSYDLLRRDIEGYARLDFWCEALDEAQYIKNHETL
FT                   VARATKAVHARHRFALTGTPIENRLSELWSIFDYLMPGLLGSYDRFRERYEQPVLDGDE
FT                   EVGACLRAATGPFVLRRLKRDVLNDLPEKLEQVVYARLAGEQRRLYQAHEQALRVSLSR
FT                   QTDEAFGRGKIQVLAELMRLRQLCCDPRLLYDDYEGGSAKLATVMDLVGSVVDSSHKML
FT                   LFSQFTSYLSLIASELDARGVRYYTITGATPKHRRLELADAFNADETPVFLISLKAGGT
FT                   GLNLVGASVVVHADPWWNAAAQDQATDRAHRIGQTRDVSVYKVIAKDTIEDRILALQEV
FT                   KSDLAEQVIGVGGGAGLSALRKEDLIALLGE"
FT   gene            458811..459086
FT                   /locus_tag="Olsu_0417"
FT   CDS_pept        458811..459086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0417"
FT                   /product="acetyltransferase"
FT                   /note="InterPro IPR016181; KEGG: lwe:lwe0116
FT                   acetyltransferase; SPTR: C2D8Q2 Putative uncharacterized
FT                   protein; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67541"
FT                   /db_xref="GOA:E1QYS7"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYS7"
FT                   /protein_id="ADK67541.1"
FT                   /translation="MVFQTNDNEILFLGDNGAVKGRVSFPDVGEGLVDITETFVAPTER
FT                   GMGLAGRLMGRAATHIRSQGKKARLSCSYAQDWFGKHPEYADLVVE"
FT   gene            459723..460439
FT                   /locus_tag="Olsu_0418"
FT   CDS_pept        459723..460439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0418"
FT                   /product="protein of unknown function DUF554"
FT                   /note="COGs: COG1811 Uncharacterized membrane protein
FT                   possible Na+ channel or pump; InterPro IPR007563; KEGG:
FT                   cdl:CDR20291_1891 hypothetical protein; PFAM: protein of
FT                   unknown function DUF554; SPTR: C2D8Q3 Possible transporter;
FT                   PFAM: Protein of unknown function (DUF554)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67542"
FT                   /db_xref="GOA:E1QYS8"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYS8"
FT                   /protein_id="ADK67542.1"
FT                   /translation="MVLLGALLNGLEAFLGGVIGLLFKSHVSDDLGDFLLKGQGLCVVL
FT                   VGVQGMTSGGSVVVVTAAMALGCLVGYLIDFDGLVRRLGNWVQRRLSTTFSGSERLGSF
FT                   SEGFVAATLFCCTGAMAIVGSLQSGLQLDHATLVAKGLIDLVVCIPLAATLGVGVPFAG
FT                   VSLLVYEGILSLLASALGGVLTEAVIAEVSVTGSLLLLAVGTNLLKVTDLKVANMLPAA
FT                   FMPIALVPLTSAMGLL"
FT   gene            complement(460514..461431)
FT                   /locus_tag="Olsu_0419"
FT   CDS_pept        complement(460514..461431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0419"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="COGs: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain; InterPro
FT                   IPR018313:IPR001638:IPR001320:IPR006311; KEGG:
FT                   apv:Apar_0429 extracellular solute-binding protein family
FT                   3; PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3;
FT                   ionotropic glutamate receptor; SPTR: C8W9S2 Extracellular
FT                   solute-binding protein family 3; PFAM: Bacterial
FT                   extracellular solute-binding proteins, family 3; TIGRFAM:
FT                   Tat (twin-arginine translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67543"
FT                   /db_xref="GOA:E1QYS9"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYS9"
FT                   /protein_id="ADK67543.1"
FT                   /translation="MTVGGRTDDGRTKQIGTETIMYDTTRRNFLTMCGLGLAAVGLAGC
FT                   GSQSDSSRSDGTQTGGAASSDTTTQAGYTLVEDGRLTLISNFYFPPFVSMDEKTGDYEG
FT                   FDVDLYKAICAKLGLEPNILPTVQFDTIVPTIKQGGKADVSLGAITITDEREQEIDFSD
FT                   PYLDSNQALVVKAASAATDAAALDVSGTQVAVQSGTTGEAWARENIPNATIVPLDDIIQ
FT                   CLTGVQSGLYQASVCDLPVASYEIGIAYTDLRTAMEIPTGEQYGVVVSKDNPKLTEAIN
FT                   QALKDLKEDGTVDGLEQRWFGTTL"
FT   gene            462094..462333
FT                   /pseudo
FT                   /locus_tag="Olsu_0420"
FT   gene            complement(462720..462845)
FT                   /pseudo
FT                   /locus_tag="Olsu_0421"
FT   gene            463035..463631
FT                   /locus_tag="Olsu_0422"
FT   CDS_pept        463035..463631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0422"
FT                   /product="methylated-DNA/protein-cysteinemethyltransferase"
FT                   /note="COGs: COG0350 Methylated DNA-protein cysteine
FT                   methyltransferase; InterPro IPR001497:IPR014048:IPR011991;
FT                   KEGG: ele:Elen_2401
FT                   methylated-DNA/protein-cysteinemethyltransferase; PFAM:
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase DNA
FT                   binding; SPTR: B3JKY7 Putative uncharacterized protein;
FT                   TIGRFAM: methylated-DNA/protein-cysteine methyltransferase;
FT                   PFAM: 6-O-methylguanine DNA methyltransferase, DNA binding
FT                   domain; TIGRFAM: O-6-methylguanine DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67544"
FT                   /db_xref="GOA:E1QYT0"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYT0"
FT                   /protein_id="ADK67544.1"
FT                   /translation="MDYVHHYDSPLGGITIASDGVALVGLWFDGQKHFPDPLVLGALAE
FT                   GSAESDPPVSAQTDAWLDAYFAGSDPGPTPPLAPRGTAFRREVWEILLQIPYGRTTTYG
FT                   DIAAQLARRCGLGHFSAQAVGGAVGHNPISVIIPCHRVLGSDGSLTGYAGGLERKAALL
FT                   ALERTGGMRSGAPLPELPSHGGAGRRELRASRRPR"
FT   gene            complement(463628..464381)
FT                   /pseudo
FT                   /locus_tag="Olsu_0423"
FT   gene            complement(464396..465106)
FT                   /locus_tag="Olsu_0424"
FT   CDS_pept        complement(464396..465106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0424"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="COGs: COG0274 Deoxyribose-phosphate aldolase;
FT                   InterPro IPR011343:IPR002915:IPR013785; KEGG: lac:LBA0391
FT                   deoxyribose-p aldolase; PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase;
FT                   PRIAM: Deoxyribose-phosphate aldolase; SPTR: C2ER41
FT                   Deoxyribose-p aldolase; TIGRFAM: deoxyribose-phosphate
FT                   aldolase; PFAM: DeoC/LacD family aldolase; TIGRFAM:
FT                   deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67545"
FT                   /db_xref="GOA:E1QYT1"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYT1"
FT                   /protein_id="ADK67545.1"
FT                   /translation="MARYTIDQLARMVDHTNVRPNATHEDMVRLCSEAKAYHFKMVAVT
FT                   ALQSEVCSRELVGTDIDTGAAIAFPFGQATVATKVFETKDALANGANEIDYSINLTEVK
FT                   AHDWDYVKDEMAQIVAACNEAGAISKVILETYFLTDEEIMEICNIASEVKPTFVKTSSG
FT                   TVAGGATVKDVALMRKAVDPAVKVKASGGIRRADDFAAMVAAGAERIGCSQGIPIIEEF
FT                   RRRMAEAGADYIEI"
FT   gene            465434..465808
FT                   /locus_tag="Olsu_0425"
FT   CDS_pept        465434..465808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0425"
FT                   /product="PTS system mannose/fructose/sorbose family IID
FT                   component"
FT                   /note="InterPro IPR004704; KEGG: lcb:LCABL_06300
FT                   fructose/mannose phosphotransferase system IID component;
FT                   PFAM: PTS system mannose/fructose/sorbose family IID
FT                   component; SPTR: B3W828 Fructose/mannose phosphotransferase
FT                   system IID component; PFAM: PTS system
FT                   mannose/fructose/sorbose family IID component"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67546"
FT                   /db_xref="GOA:E1QYT2"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYT2"
FT                   /protein_id="ADK67546.1"
FT                   /translation="MGASVTFAPASAGSSRNSAPRATCSHSPTSPALGADYGGVLNIGN
FT                   YSVGALAAGNIALATMLSIPNAGEWLPLQTTLDGISPRVLPLIAVLTTWWMINKKQFSP
FT                   TKVIIVFSVVVAIACLLSVF"
FT   sig_peptide     465434..465535
FT                   /locus_tag="Olsu_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            465978..466682
FT                   /locus_tag="Olsu_0426"
FT   CDS_pept        465978..466682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0426"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011663:IPR011991; KEGG: lcb:LCABL_06350
FT                   transcriptional regulator; PFAM: UbiC transcription
FT                   regulator-associated domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH; SPTR: B6FZF4
FT                   Putative uncharacterized protein; PFAM: Bacterial
FT                   regulatory proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67547"
FT                   /db_xref="GOA:E1QYT3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYT3"
FT                   /protein_id="ADK67547.1"
FT                   /translation="MALHNEIRDDIYGKISDGTYREGDSIPSEIDLASSYGVSRSTIRQ
FT                   ALQALVHEGYLERRKRRGTIVTRPKVDQFAAMGIRSFEEEQANVGRKIRTTVINFKRQR
FT                   ANAEVARALELSAAAEVWHLVRLRYVDDRANVFVESYVPCELYPGFDEYDFATTRLYGA
FT                   MADKGRPVVRAHRRLGVIKADSAMGALLDVSARDPLILMHTVGRDEDGNAVEYSVATYR
FT                   GENNVFEFDVAK"
FT   gene            467437..468144
FT                   /locus_tag="Olsu_0427"
FT   CDS_pept        467437..468144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0427"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pag:PLES_54621 putative chemotaxis transducer;
FT                   SPTR: Q9HUB1 Probable chemotaxis transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67548"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYT4"
FT                   /protein_id="ADK67548.1"
FT                   /translation="MLSGSELQGESYSAFRDRVRSLRLPLVEAHRAAFDVMYACNEENV
FT                   AKVSTLPETSPGISDTDEAQAKIERLQELNQAYMRLIDADPPGTSNDAVRSVEGAIRVN
FT                   EDLIASLRDVIYQIEDYAARSVGIYARARSAVDVLREAGASVKSCLVGNGYGDLSWADG
FT                   FTEGDDELVAERLGVSKEDFVTMQRDQFGFNAETVETMWDIYAALYRRYPDLSQEKIAR
FT                   RPPHTSRPIVQTL"
FT   gene            468227..468931
FT                   /locus_tag="Olsu_0428"
FT   CDS_pept        468227..468931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0428"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647:IPR009057; KEGG: apv:Apar_0148
FT                   putative transcriptional regulator, TetR family; PFAM:
FT                   regulatory protein TetR; SPTR: C8W8Z6 Putative
FT                   transcriptional regulator, TetR family; PFAM: Bacterial
FT                   regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67549"
FT                   /db_xref="GOA:E1QYT5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYT5"
FT                   /protein_id="ADK67549.1"
FT                   /translation="MQQVLRGVSSPPARTDPRSVRTRRALRDALAAEILSTGDLSQVTV
FT                   TAVSNRAGVTRRTFYSHFKDIPDLVDQVERETVDGSRALVERIASTHLDELQRSIENLK
FT                   PCPGSVELLEYFRARGGYLGALLGDGGDPAFAERLKHMVRETVASRALEGIDLLAIGAF
FT                   FDYYLTFAISAEVGVLVRWLTSGMRESSEAMARVMTALMFVRPGDLYGKKIEFDIPSLG
FT                   LALLTMRENDDD"
FT   sig_peptide     468227..468319
FT                   /locus_tag="Olsu_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            468924..473705
FT                   /locus_tag="Olsu_0429"
FT   CDS_pept        468924..473705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0429"
FT                   /product="CoA-substrate-specific enzyme activase"
FT                   /note="COGs: COG3581 conserved hypothetical protein;
FT                   InterPro IPR002731:IPR018709:IPR008275; KEGG: apv:Apar_0149
FT                   CoA-substrate-specific enzyme activase; PFAM: Protein of
FT                   unknown function DUF2229, CoA enzyme activase; ATPase
FT                   BadF/BadG/BcrA/BcrD type; SPTR: C8W8Z7
FT                   CoA-substrate-specific enzyme activase; TIGRFAM:
FT                   CoA-substrate-specific enzyme activase; PFAM:
FT                   2-hydroxyglutaryl-CoA dehydratase, D-component;
FT                   BadF/BadG/BcrA/BcrD ATPase family; CoA enzyme activase
FT                   uncharacterised domain (DUF2229); TIGRFAM:
FT                   CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67550"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYT6"
FT                   /protein_id="ADK67550.1"
FT                   /translation="MTNHMESTAAQVRARQPIELVQFEAELRPKNPIDLSHAHLRLGID
FT                   VGSTTVKLAVIDDNDNLVYANYERHHTDVKATAAQVFAKARSVVGDVPMRVSITGSGGM
FT                   LLSQWLNVEFVQEVIASKHAVEALIPQTDCAIELGGEDAKIIYFDNGIEQRMNGTCAGG
FT                   TGAFIDQMASLMETDATGLNELAKGASHIYPIASRCGVFAKSDVQPLLNEGAAREDVAA
FT                   SIFQAVANQTVSGLACGHPIRGYVAFLGGPLQYLSELRHRFYETLRLDEQHRVIPENAH
FT                   LFVATGAALAGESDTYVTFSEVIDDLRNLGDTQGSEVARLDPLFATEDAYRSFKERHDQ
FT                   EVVAKGSLDGYHGRVFIGLDAGSTTMKAAVVGEDGELLYTWYDNNNGDVLGTARRIMDD
FT                   IYDHLGEGCTIGHVTTTGYGEGILIEALGADSGEIETVAHLRGARAFVPDVNFILDIGG
FT                   QDMKCLQVKNGIIEHISLNEACSSGCGSFIANFADSMGMDVRQFAAAAVKGERPVDLGS
FT                   RCTVFMNSRVKQAQKEGATIGDVAAGLSYSVIKNALFKVIKLRDYDEIGKYVVVQGGTF
FT                   MSDATLRAFELLTGREVIRPDIAGAMGAYGAALLARDRAGASGTSMLLSREKIDNLEVK
FT                   HTNAHCGRCSNNCLLTINSFGNGRRFITGNRCEKGSGKPKSQQSQAPNLFKFKSRLLFD
FT                   REVLPADEAPRGTVGIPRALNMYENYPFWHAFFTRLGFSVVLSDPTTRKTYEAGTESMP
FT                   SESVCYPAKLSHGHIMNLLEKDPDFIWMPCIRWERQEDDGATNHYNCPIVMSYPQALGL
FT                   NVDELSDPKVEYLDAYIPYDNKKELKRRLYELIQLQRRADAAAGRGRFRGADITRAEVD
FT                   AAVNEAWEADLAFKDAMHRKGDETLRWIEDNDAHGIVLAGRPYHNDGEINHAIPEMLQG
FT                   FGFAVLTEDAVAHKMRPERPIRVVDQWMYHSRLYRAARFVASRNDLDLIQLQSFGCGLD
FT                   ALTTDQVQEILENSGKIYTVLKIDEVSNLGAARIRVRSLMAALKEGRAELERETAAGIA
FT                   TEVAPVDVRRADGTLEHARQTDLSRRTPVYRSAKGSDFKKVRYTKEMQAEGYTILAPQM
FT                   APIHFDLVEPLLRGAGYNVVLLPSVDHAAVDTGLKYVNNDICYPSILVTGQIMEAVLSG
FT                   KYDLSRTAVLISQTGGGCRATNYIALIRKALKDSGHPDIPVISLSAAGNLDEKNPGFNI
FT                   LSDPQLLVRAVYALLYGDLIMQLLYRVRPYEVERGSADRLYDSFMSRAKTLIPRTDRKS
FT                   FYRLCQDTIDRFERLPLENDRSKPRVGVVGEILVKFHPTANNEVVRVIESEGCEADVPG
FT                   LVDFFLFGMSNQINMKRELGTKASSRLTHIAGIKAIDALRAPINKMLRRTTRFEPYGSI
FT                   FELAEKAEQVLSLCNTMGEGWLLTAEMVDLIEHGTPNIVVCSPFACLPNHVVGKSVIKR
FT                   LRQMHGESNIVAVDYDPGASEVNQLNRIKLMISVAKENFKNGGAFRIENANDPTTSVVM
FT                   PYVDETSSHRRHRGELGDSLVNEGAVVSGVYAAYGAPASEDGGATYGRGEGRIHLSPEQ
FT                   LDAIRQAKEKAGVR"
FT   gene            complement(474059..474742)
FT                   /locus_tag="Olsu_0430"
FT   CDS_pept        complement(474059..474742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0430"
FT                   /product="protein of unknown function DUF205"
FT                   /note="COGs: COG0344 membrane protein; InterPro IPR003811;
FT                   KEGG: lga:LGAS_0175 hypothetical protein; PFAM: protein of
FT                   unknown function DUF205; SPTR: C6LA65 Putative membrane
FT                   protein; PFAM: Domain of unknown function (DUF205);
FT                   TIGRFAM: conserved hypothetical integral membrane protein
FT                   TIGR00023"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67551"
FT                   /db_xref="GOA:E1QYT7"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYT7"
FT                   /protein_id="ADK67551.1"
FT                   /translation="MVARISSLLIGYAFGGLLTAEVVCRTLVHKSSFEVGQGNPGMANV
FT                   GHELGTKAALAVLAGDILKTLLAWMVARTVFADAAGGADAAGLWAGLGATLGHNYPFWH
FT                   RFHGGKGVTTTCSAIILTSPLWGIAASLLGFAVVVLSGYLCVGAVAICGAFFLFTLLVG
FT                   TSEQAAVALVLTLLMLRAHWGKIRGIADGTTRRATLSDKVWDRLRKKGGKDRGGKDGAK
FT                   GDAET"
FT   gene            475149..476498
FT                   /locus_tag="Olsu_0431"
FT   CDS_pept        475149..476498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0431"
FT                   /product="peptidase T"
FT                   /EC_number="3.4.11.4"
FT                   /note="COGs: COG2195 Di- and tripeptidase; InterPro
FT                   IPR001261:IPR002933:IPR011650:IPR010161; KEGG:
FT                   apv:Apar_0155 peptidase T; PFAM: peptidase dimerisation
FT                   domain protein; peptidase M20; PRIAM: Tripeptide
FT                   aminopeptidase; SPTR: C8W903 Peptidase T; TIGRFAM:
FT                   peptidase T; PFAM: Peptidase family M20/M25/M40; Peptidase
FT                   dimerisation domain; TIGRFAM: peptidase T"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67552"
FT                   /db_xref="GOA:E1QYT8"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYT8"
FT                   /protein_id="ADK67552.1"
FT                   /translation="MASATEHREPKHREPRPCEPRPCEPRPCEPRSYEPKPSDVLERFL
FT                   RYVQVDSQSDPDNESETPSTPAQHDMARVLGEELRALGCEDVVVDGHAYVTATVPASAG
FT                   AEGLPALGLCAHIDSTVDAPAAGVRPHVVHYEGGDLVAGVIDGTEVSTSSDQVPDLGQF
FT                   VGQDIVVSDGRTLLSADDKAGVAEICALVARLGDDPSLPHPTLKIAFVPDEEIGHGAAL
FT                   LDLDKFGAAWCYTVDGEALGEFNYETFNAAEATVRVRGVMVHPGSAKDVMVNAITVAGE
FT                   FERLVPAFERPEHTEGREGFYHPIQVRGTASEVTLTYIVRDHDASRFEGRQQVLRDIAA
FT                   FLNGRHGEGTVTVELREQYRNMSEAFGDCPFLIANALEAHREVGIEPKVVAVRGGTDGS
FT                   QLSLRGLPCPNIATGGYNAHSVREFVPVRSLELTVDLLERLVGKFSVPQS"
FT   gene            476753..477295
FT                   /locus_tag="Olsu_0432"
FT   CDS_pept        476753..477295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: apv:Apar_0156 hypothetical protein; SPTR:
FT                   B9CM53 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67553"
FT                   /db_xref="GOA:E1QYT9"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYT9"
FT                   /protein_id="ADK67553.1"
FT                   /translation="MTFGVGLLLTVVLPMVALLRASLMGPGLAERHHSHHDTYSVSSFL
FT                   LRSVVVAMLFMAVLGVIFGWLCEVDAFAADSDVVVAFFAAFELMAFFMWFCMVRYRVVT
FT                   YGDHMSVTPFVGPRVDVPYDAIECMEWTSSSSLVGYQSVRVRSRGRRRVTLWGTIDVDQ
FT                   VLMRIDRYDVLESRVHE"
FT   gene            complement(477340..478860)
FT                   /locus_tag="Olsu_0433"
FT   CDS_pept        complement(477340..478860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0433"
FT                   /product="Glycosyl hydrolase family 32 domain protein"
FT                   /note="COGs: COG1621 Beta-fructosidase
FT                   (levanase/invertase); InterPro
FT                   IPR013148:IPR013189:IPR001362:IPR008985; KEGG:
FT                   bhy:BHWA1_00077 beta-fructosidase (levanase/invertase);
FT                   PFAM: Glycosyl hydrolase family 32 domain protein; SMART:
FT                   glycoside hydrolase family 32; SPTR: B9CM48
FT                   Sucrose-6-phosphate hydrolase; PFAM: Glycosyl hydrolases
FT                   family 32 C terminal; Glycosyl hydrolases family 32
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67554"
FT                   /db_xref="GOA:E1QYU0"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYU0"
FT                   /protein_id="ADK67554.1"
FT                   /translation="MAIDYNANPKHNWRLRFHLQTQTGDITDPNGLCQLDGTYHFFHQH
FT                   RRLWPDAAHGWAHWASRDLVSWEWMGCPIMPDCDLDRNGSYSGSAVVHDGQMWCYYTGN
FT                   ALLPGDHDYDRSGRLANETLVVSDGVRFGEKRLVLGNEGYPSYCSCHVRDPKVWRQGGS
FT                   WHMLLGARTMDDRGAILLYGSPDGLAWELEGSATGTGAEPFGYMWECPNLVRVDGREFL
FT                   LVCPQGVSKRPFSFQNIHNSGYFPLEGSLVELMRGDGDLMGASGPYPCIDERSFVELDF
FT                   GFDFYAPQAFEDESGRTLLVGWAGLPDIETQYDNPTRAWTHTLTVPRELTTNAAGRICQ
FT                   WPAREIDGLRGKEVKLTAQDAHGLTGTVGTSPYDVFDLTGARGARFADGSCDLVIDDID
FT                   GEGRVLLGSELELLVCDQMLELCFHGAAGAHRGVRRLLASTLSAGRVESLRMLVDTSIV
FT                   EVFVNGGEVTLTTRWYPQDVSELCVTSTLPGEHRAWEMGCYGFAGMGA"
FT   gene            complement(478995..479945)
FT                   /locus_tag="Olsu_0434"
FT   CDS_pept        complement(478995..479945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0434"
FT                   /product="PfkB domain protein"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR002173:IPR011611; KEGG: ere:EUBREC_1413
FT                   PfkB-type carbohydrate kinase family protein; PFAM: PfkB
FT                   domain protein; SPTR: B9CM49 Fructokinase; PFAM: pfkB
FT                   family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67555"
FT                   /db_xref="GOA:E1QYU1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYU1"
FT                   /protein_id="ADK67555.1"
FT                   /translation="MFAVTALGELLIDFTDAGTSAAGQKLFERNPGGAPANVLVALERL
FT                   GMSCAFIGKVGDDMHGEFLRATLVANDVNCDGLVSDPEHFTTLAFVALSEDGERTFSFA
FT                   RKPGADTQLRPEEVDTRIIRNSKVFHVGSLSLTDEPARSATMAALEAAKAAGCVMSYDP
FT                   NYRSSLWPSAEVASGHMRSIVGYMDLIKISCEECELMCGTTDPQAAAQVLLDQGAKVVC
FT                   VTLDADGAYVATKDGGATVPSFRVEAVDTTGAGDSFWGGFLCAFVDSRTSPADVTLEDA
FT                   KGFARFGNAVASLCVRSRGAIPSMPTLAEVEKVLG"
FT   gene            complement(480049..482025)
FT                   /locus_tag="Olsu_0435"
FT   CDS_pept        complement(480049..482025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0435"
FT                   /product="PTS system, glucose subfamily, IIA subunit"
FT                   /note="COGs: COG1263 Phosphotransferase system IIC
FT                   components glucose/maltose/N-acetylglucosamine-specific;
FT                   InterProIPR018114:IPR001127:IPR018113:IPR003352:IPR
FT                   011535:IPR011055:IPR001996:IPR013013; KEGG: stc:str1734
FT                   sucrose-specific PTS permease, enzyme II; PFAM:
FT                   sugar-specific permease EIIA 1 domain; phosphotransferase
FT                   system EIIC; Phosphotransferase system EIIB/cysteine,
FT                   phosphorylation site; SPTR: B9CM50 Pts system
FT                   beta-glucoside-specific eiibca component; TIGRFAM: PTS
FT                   system, glucose subfamily, IIA subunit; PTS system,
FT                   glucose-like IIB subunint; PFAM: Phosphotransferase system,
FT                   EIIC; phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 1; phosphotransferase
FT                   system, EIIB; TIGRFAM: PTS system, glucose-like IIB
FT                   component; PTS system, glucose subfamily, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67556"
FT                   /db_xref="GOA:E1QYU2"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYU2"
FT                   /protein_id="ADK67556.1"
FT                   /translation="MALDHAQAAREILDAVGGAGNVVSAAHCATRLRLVIADDSKVDKA
FT                   KLDDCVGAKGNFQAAGQLQVIYGTGTVNKVFDAFIAQSGVSAASKDEAKEAAANKGNAL
FT                   QRAIKVLSDVFVPIIPAIVASGMLMGIMGAISYMGTPAPDGAGFFTLDTTTVWWRIAAL
FT                   VNACALANLQILLGFSAATVFGGNPYLGASLGALLISSDFVNAYNASSAIADGSMVTLS
FT                   VIPGLYSIDWVGYQGHVIPILVGVWILCFFEKRLHKLVPDMFDLFLTPLLSVSLAAYIT
FT                   ILFIGPVFVWLENSILGVLQFLLSVPLGLGYMAIGLIYSPSVVTGLHQMYTAIDVSMLA
FT                   NYGVTYWLPIASAANIAQGGACLAVSLRTKSDKTKALAVPSGISCLLGITEPAIFGVNL
FT                   PKIKPFVAGMIGSACGAFCCFLFNLAASGTGVTGIFGILLCIQQPIQYAIMFAVAFGVA
FT                   FGITSVIYRDDAVAAATKAETTEAVAEVSATANQAAAVATAVDNAAPVSIASETIVAPM
FT                   SGRAIAMTEVSDPVFASEAMGKGAAIEPSDGKVYSPVDGSVTLLAETGHALGLLSDAGA
FT                   EVLLHIGIDTVELKGEPFTAHVAAGDKVSKGQLLMDVDLSVIKAAGKPATTMVIVTNTD
FT                   SYGAVEGHTGSDVAAGDDLIDLT"
FT   gene            complement(482225..483211)
FT                   /locus_tag="Olsu_0436"
FT   CDS_pept        complement(482225..483211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0436"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843:IPR001761:IPR010982; KEGG: transcriptional
FT                   regulator, LacI family; PFAM: regulatory protein LacI;
FT                   periplasmic binding protein/LacI transcriptional regulator;
FT                   SMART: regulatory protein LacI; SPTR: B9CM51
FT                   Transcriptional regulator; PFAM: Bacterial regulatory
FT                   proteins, lacI family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67557"
FT                   /db_xref="GOA:E1QYU3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYU3"
FT                   /protein_id="ADK67557.1"
FT                   /translation="MDINTIARMAGVSRATVSRYLNDGYVSEEKRRLIKRVIDQTGYVP
FT                   SPQAQTLRTGKTRLVGVIIPKINSHSVSRMVAGLSVVFNEAGYQMLLANTDNDAKEEIR
FT                   FLQLFAERSQVDGVVLISTIVTPAHQRALDALKVPLVVLGQQMEGRSCVFQDDYRATLE
FT                   ITRLVAEKSAHPAFIGVREDDLSAGCHRHQGFLAACREAGLNVPDRAQVIGGFDVDSGY
FT                   TSCEGLLEAYPEVDAVVCATDSVAYGALTCLREYGHGVPDEVQVTGIGDGTLSQIISPS
FT                   LTTVHNYYKTSGIEAAKMLVAAMADVSDNVARQIMMGFELRRRRSTR"
FT   gene            483287..484735
FT                   /locus_tag="Olsu_0437"
FT   CDS_pept        483287..484735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0437"
FT                   /product="beta-fructofuranosidase"
FT                   /EC_number="3.2.1.26"
FT                   /note="COGs: COG1621 Beta-fructosidase
FT                   (levanase/invertase);
FT                   InterProIPR018053:IPR013148:IPR013189:IPR001362:IPR
FT                   006232:IPR008985; KEGG: bhy:BHWA1_00077 beta-fructosidase
FT                   (levanase/invertase); PFAM: Glycosyl hydrolase family 32
FT                   domain protein; SMART: glycoside hydrolase family 32; SPTR:
FT                   A6BIX3 Putative uncharacterized protein; TIGRFAM:
FT                   sucrose-6-phosphate hydrolase; PFAM: Glycosyl hydrolases
FT                   family 32 N-terminal domain; TIGRFAM: sucrose-6-phosphate
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67558"
FT                   /db_xref="GOA:E1QYU4"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYU4"
FT                   /protein_id="ADK67558.1"
FT                   /translation="MGNPLANDLETLRQAVERNARPGRFAQAFHLVPPVGWLNDPNGLC
FT                   CFDGAYHAFFQYSPFNSEGGVKMWGHSVSDDLMGWEYLGTALYPDQPFDVSGVYSGCAY
FT                   VEDGVMHVFYTGNVKREDADGYDYVNSGREANTVHVVSTDGMTFGNKHLVMTNGDYPQD
FT                   DTNHVRDPKVWRSADGYRMVQGARREDDRGEVLVFGSSDLDSWELVNRVSTEYPFGYMW
FT                   ECPDYFELADARRTGAGATVKVLSVSPQGLEGQDWDRRNVYQSGYFVLQGDIVGACRLH
FT                   PFALWDAGFDFYAPQTFESDDGRRILIGWMGMPDTDEYVNKTVEDGWQHCFTIPREVTA
FT                   ANGRVLQRPVRELDARHANERHGEDALSADGTRCFDLLVDEFPPSLDFAYVRIAEDLVL
FT                   TWGSGTFEMRFLDEGKDSVGAGRTCRYEHLDGLRNMRVVGDVSSIEVFLNDGELTFSTR
FT                   YYPESYGVRVDAPGASVTLWDVEA"
FT   gene            484804..486111
FT                   /locus_tag="Olsu_0438"
FT   CDS_pept        484804..486111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0438"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="COGs: COG0628 permease; InterPro IPR002549; KEGG:
FT                   lbu:LBUL_1218 permease; PFAM: protein of unknown function
FT                   UPF0118; SPTR: C4GD97 Putative uncharacterized protein;
FT                   PFAM: Domain of unknown function DUF20"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67559"
FT                   /db_xref="GOA:E1QYU5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYU5"
FT                   /protein_id="ADK67559.1"
FT                   /translation="MRRFRLDDDRYSTISRYVVATAAAIVAIVLAAVHLAEIADAVGTS
FT                   LAWVYAIVSPLIVGGLAAILLYPGVKWFARRLGRVPLLSGREKLRHVLGVLLVCVCFVL
FT                   ALSVLVALLLSVITGSIHRIRFENLESLAQYLAYGADGLYRWLIRLTTSLGVPPDDVNA
FT                   ALEHAETFVFGDGDGLGQTLTKGVTAVRNAASTMVFAAIFAVYLMVDAPHLASYWNGVL
FT                   RSLMGERGYGRFAEFRADVVFAFTGYMRGQFIDAVLVGLMVGVSLTVVGVDFAPVIGIA
FT                   TGIGNLIPYIGPIVSYVLTVAVCVVNGDIGRLVVAAAVLLVIQFVDGQVINPKILSDSV
FT                   EVHPILVLVALTAGGRLGGVLGMFIAVPCAALAKIYFEKFVAWRRRMRVGGGGGTGADA
FT                   GTSGDGGTGADAHERGGGTASCEDTSTAVDIKGDVP"
FT   sig_peptide     484804..484926
FT                   /locus_tag="Olsu_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            486144..486220
FT                   /locus_tag="Olsu_R0010"
FT   tRNA            486144..486220
FT                   /locus_tag="Olsu_R0010"
FT                   /product="tRNA-Met"
FT   gene            486640..487203
FT                   /locus_tag="Olsu_0439"
FT   CDS_pept        486640..487203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shi:Shel_18970 hypothetical protein; SPTR:
FT                   C7N7M8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67560"
FT                   /db_xref="GOA:E1QYU6"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYU6"
FT                   /protein_id="ADK67560.1"
FT                   /translation="MENVNAREDEEEGRVITLSEAGEILHALYATVLRLGTDGVLSASF
FT                   DQMLRSAGTVTMRDVVHGVWEAAILPIGCGVLSLTFILQLIRISQRMDGNASMPGVKEV
FT                   VFLLVFYAVFLFVLQHSFELMQSVYEVSRIAVSRVSDLFGTGSALDLQTVSITTTDDDV
FT                   AALLGMLVVALVKSGGWARDVMGG"
FT   gene            487315..487818
FT                   /locus_tag="Olsu_0440"
FT   CDS_pept        487315..487818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shi:Shel_18980 hypothetical protein; SPTR:
FT                   C7N7M9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67561"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYU7"
FT                   /protein_id="ADK67561.1"
FT                   /translation="MADERGQGKNVYLTLHENFVREDIAYTDRATGERKTFNQVRLPAG
FT                   TVIDGKDVGSCEFTPLFVDASRFKGPEWRDIPLLADREVWLKRSVLDPEGRPVTDADGK
FT                   RVKDVMKVMPQEIKDALTASRRAWAEEHGDDPRALADRGRAARDSAEAIDRSGRTRPDA
FT                   REIG"
FT   gene            487951..488487
FT                   /locus_tag="Olsu_0441"
FT   CDS_pept        487951..488487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0441"
FT                   /product="putative collagen-binding protein"
FT                   /note="InterPro IPR018201; KEGG: shi:Shel_18990 putative
FT                   collagen-binding protein; SPTR: C7N7N0 Putative
FT                   collagen-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67562"
FT                   /db_xref="InterPro:IPR041100"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYU8"
FT                   /protein_id="ADK67562.1"
FT                   /translation="MQTETIDADDGDHEAVADDSVTIVGTVSYTGPTPGKEYTLTGTLV
FT                   DRETGEPVRSDGKAVTSTVAFVTDTANGTQEVTFTFGGMELAGNALVAFESFALGGQEA
FT                   AAHAGVNDEGQTVRLVPPETPEAPTPGSKLPQTGDELPIAGICVLAAEGCAASVIGIAR
FT                   SIGTGHREEDEGEEA"
FT   gene            488747..488980
FT                   /locus_tag="Olsu_0442"
FT   CDS_pept        488747..488980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyn:Cyan7425_1532 N-acetylmuramyl-L-alanine
FT                   amidase, negative regulator of AmpC, AmpD; SPTR: B8HPP1
FT                   N-acetylmuramyl-L-alanine amidase, negative regulator of
FT                   AmpC, AmpD"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67563"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYU9"
FT                   /protein_id="ADK67563.1"
FT                   /translation="MEIRGELNLICLHACDDKSGRRWDSAAFNQDAYNALVFVLFYDRP
FT                   RIDSAIANGLERPIAMELYLAESSILFPDFCY"
FT   gene            complement(488997..490535)
FT                   /locus_tag="Olsu_0443"
FT   CDS_pept        complement(488997..490535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_4101 hypothetical protein; SPTR:
FT                   C7G879 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67564"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYV0"
FT                   /protein_id="ADK67564.1"
FT                   /translation="MKNESKKDPVHASTPHGIVAENATIPKMAELSGDSAARYQNVNLS
FT                   YEQERFHARQGHGFAAERANTLHDKLHGKDARILGDDNAKNGPDRIVNGEWIQSKYFQN
FT                   GRQAIDACFEDGGDGAFRYIGKHDSPMTIEVPKDENIYDQAVERMQEKIRNGQVEGVTD
FT                   PAEAKNIVKQGNYTYQQARNIAKAGNIDSLKYDATNGAVVAASAFGVSAVIAFCASVWS
FT                   GDSLDIAAKKAALCGVKVAGTSFFVSVLSQQLLKAGLNSAMVSGTEAIANALGPKACAA
FT                   IVNAFRSGSNIYGAAAMKSAAKLLRGNAVVAGLTVVALSSVDIYDIVRGRISSAQLAKN
FT                   LATTFGSVAGGTGGWIGGAALGTAIFPGPGTIVGGLVGSLGAGVAASKLIEVSVGYFVK
FT                   DDADQMLAIITEVMNDVCSEYLLCESEANEVVESIQDALSNGGTLKDMYASDNRREFAR
FT                   VLILPPTEEVVRNRIEIDGNIDEMLSNGLVAVLKEATEDGDGNGDDGAAPEESH"
FT   gene            490790..491458
FT                   /locus_tag="Olsu_0444"
FT   CDS_pept        490790..491458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_6654 hypothetical protein; SPTR:
FT                   Q8GFF2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67565"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYV1"
FT                   /protein_id="ADK67565.1"
FT                   /translation="MPIYRAYFGINSHPRTTTICAPAPEDDEPGTRTSEGSDYGEMAEW
FT                   AADFPQPSHGACESGRADSCRHGCRRVATRWRGPWPPRGLPARPTRAPGRTTGATRRAV
FT                   RGSPWPGRPARTRRGAATRPHRTRSPPPRPWTARGPRRDSRGRWRPATGTGTPCPRGAA
FT                   RLGRRPPRRGPPPCARRARGPATRARARRRPSLSSWPGARARRPPGRRRPWRGRPASGA
FT                   "
FT   gene            491839..492882
FT                   /locus_tag="Olsu_0445"
FT   CDS_pept        491839..492882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: B0N9R7 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67566"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYV2"
FT                   /protein_id="ADK67566.1"
FT                   /translation="MADEDDKNVDRNASFSEFGWEFQTNAAIVLFIQRIEDASSVRVEG
FT                   AHEDIEISLNDGTVVYAQAKARTGNEPGKGSTDRLDGALKTLADDIKQGNYRELIFVTN
FT                   DDYPFGKSHDVSDLHGGGTLRFDELPDGVQNYIREKGAAHGIGDDAYPVMAVSVIGFYG
FT                   DDRDTRHKHIRAAIQDLLSRLDLGRRGDVNDGLLRDQWGTMMQENAGTLDTDITLSKED
FT                   FVWPVIVMLCKVDTDDKDFERFDEEDVQDAVREYGSIINYHTQKFEFVTKVSTDFDRYL
FT                   ADNSGGRKEVRTRYIDERWGDYVDILGLGEIGDGETREIVAKLIMRKVLRREDVIKRVK
FT                   DGVNLGN"
FT   gene            492872..494350
FT                   /locus_tag="Olsu_0446"
FT   CDS_pept        492872..494350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0446"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dystonin, GAS (Growth-arrest-specific
FT                   protein), and related proteins; SPTR: C7V051 Predicted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67567"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYV3"
FT                   /protein_id="ADK67567.1"
FT                   /translation="MVIESLDIHEGMFVKSFAFGDGLTVISSNNVNNVGKTTLVRLVLY
FT                   ALGEEVSMTQGFDPQKLVTRLVITTDAGKRLELEREGNTITVTGDGEPQRFIPSLEARE
FT                   IKKCIYGIENGEIADNLLGAHYIDQDRGWTLLNRGKVIGDIRFSIEALLRGLSGGDYGR
FT                   QLLRLRELDAEIDKYKFFVEATGYKDRMVDIPDTKEMAPDKSRDRERLTQLRIQSASLK
FT                   KRIATIRRAQNGNKRFVDYIVDMGLRVRTDDGEVAITPDNLLYFTDNDRYLNGEVLELT
FT                   TEKKRVDERIEELKARLQEYEGALFPVPRVDTREFDRQIAGMKLDLPAYEAILKSLRDE
FT                   KAAIKRAMKQPFAVGNELFDSITTTIDDYCAELGIEEYFRKDSKGLLTKTLKRKSGTNY
FT                   HLLVFAFRLAYADAVRRICNVRLPLIIDSIRGREMSRENFEKCVALLEEHFSDYQIIIA
FT                   SISAEGISSGRTIVLTSKVMEGAEIDPALASESE"
FT   gene            494405..495361
FT                   /locus_tag="Olsu_0447"
FT   CDS_pept        494405..495361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1614 restriction endonuclease;
FT                   SPTR: A1BGV8 Restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67568"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYV4"
FT                   /protein_id="ADK67568.1"
FT                   /translation="MDELPPVDERIAEQMDILRELRHYYLHLHHAGLHPLDPDEYYERQ
FT                   IDRRAYREPRDKSRSQARKDAGVSLLLRVHALLSETAKAELEQRKTLADIKEQEYTAEH
FT                   ARMVEEDRAVYLKQQEQCNLQIDERRRAYLDGDPLEVMGYFETVLHNDSFTLEFPDRPQ
FT                   PYESCVQVVSYDQAKKTLFVRYRAPNADEICTIDSFTFNEKEWMVETKELPAQNSLRVR
FT                   ASVLHAIIVRTAALVFYSDAFHLVDSLTITGYLDYFDPAYGTNQTIDVLKTTVSEEEFL
FT                   KVDLERARLEDLFTRLFKSHVASGLYKKKPYELKGVT"
FT   gene            495441..495638
FT                   /locus_tag="Olsu_0448"
FT   CDS_pept        495441..495638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shi:Shel_14070 hypothetical protein; SPTR:
FT                   C7N693 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67569"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYV5"
FT                   /protein_id="ADK67569.1"
FT                   /translation="MFVSAMTEMQADMAGDNHDTETQEEPQASQHIGQQQAAQEQPQMS
FT                   GKDWEKAIAERDGRIAELEQ"
FT   gene            495639..495743
FT                   /locus_tag="Olsu_0449"
FT   CDS_pept        495639..495743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shi:Shel_14070 hypothetical protein; SPTR:
FT                   C7N693 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67570"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYV6"
FT                   /protein_id="ADK67570.1"
FT                   /translation="MTDAAKNAETAEQLRSQIAELKTQGESDRIDFEQ"
FT   gene            complement(495809..496576)
FT                   /locus_tag="Olsu_0450"
FT   CDS_pept        complement(495809..496576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0450"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="InterPro IPR002611; KEGG: car:cauri_2515 putative
FT                   transposase; PFAM: IstB domain protein ATP-binding protein;
FT                   SPTR: C0XQV6 AAA-superfamily ATP binding protein; PFAM:
FT                   IstB-like ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67571"
FT                   /db_xref="GOA:E1QYV7"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYV7"
FT                   /protein_id="ADK67571.1"
FT                   /translation="MSGVPAEGDFAESAAFRARAMGQGPREMREGESHDSWALEGKARG
FT                   TIDAGEAAGQARRVARPVRGARLREPAARVGGIVHMPERKSGKGRVARLAECPWAEDDE
FT                   ALAAISKTGRGKSLVAQAIGSAARGRLPPTRHARPADPCAGLDRARLAKGGAHLRLTGR
FT                   LRSIRPLIIDDSPTTPMETASSVDPFEIPEAREGRRATMIASQPGPNERYLRTGGEPIA
FT                   DPILGRVASACRYLDIDGPNMRKRIADNRPKRE"
FT   gene            complement(496578..498116)
FT                   /pseudo
FT                   /locus_tag="Olsu_0451"
FT   gene            complement(498609..499430)
FT                   /locus_tag="Olsu_0452"
FT   CDS_pept        complement(498609..499430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0452"
FT                   /product="KilA-N, DNA-binding domain protein"
FT                   /note="InterPro IPR018873; KEGG: wsu:WS1135 hypothetical
FT                   protein; PFAM: KilA-N, DNA-binding domain; SPTR: A4EBM9
FT                   Putative uncharacterized protein; PFAM: ORF6N domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67572"
FT                   /db_xref="GOA:E1QYV8"
FT                   /db_xref="InterPro:IPR018873"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYV8"
FT                   /protein_id="ADK67572.1"
FT                   /translation="MIYTVRGQQVMLDSDLAELYEVETGALNRAAKRNEDRFPEDFRFR
FT                   LTDDEHENLRCQIGISSDDLREFASGGRRYMPYVYTEQGVAMLSGVLRSKAAVDTSVRI
FT                   MRAFVEMRRFIADNAHMFEQIRSIDHRLDSLERSTDERFERVFDYMETHEAPSQKVFFE
FT                   GQVYDAFELLVSLVQRARREIVLVDGYVDTGTLNILAKKQPGVPVTVWTHPRTSLTARD
FT                   AATFNAQYPTLEVKHTTSFHDRFLILDGAEGYLVGGVAEGRRQEELRRRQA"
FT   gene            complement(499427..499792)
FT                   /locus_tag="Olsu_0453"
FT   CDS_pept        complement(499427..499792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0453"
FT                   /product="Domain of unknown function DUF1814"
FT                   /note="InterPro IPR014942; KEGG: ccu:Ccur_11430 protein of
FT                   unknown function (DUF1814); PFAM: Domain of unknown
FT                   function DUF1814; SPTR: C7MPJ2 Putative uncharacterized
FT                   protein; PFAM: Domain of unknown function (DUF1814)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67573"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYV9"
FT                   /protein_id="ADK67573.1"
FT                   /translation="MDIMSTDEFEPRTVDKVERLLDLLDEMERHPSLKGKLALHGGTAI
FT                   NLFMLDVPRLSVDIDVSYIGSVSCAGSSAPSRGGCEHALDRIASMVRGERLRPCPTKNL
FT                   PRLRHQSLSQATRRSGT"
FT   gene            complement(499780..500613)
FT                   /locus_tag="Olsu_0454"
FT   CDS_pept        complement(499780..500613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG5340 transcriptional regulator protein;
FT                   KEGG: ccu:Ccur_11420 hypothetical protein; SPTR: C7MPJ1
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67574"
FT                   /db_xref="GOA:E1QYW0"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYW0"
FT                   /protein_id="ADK67574.1"
FT                   /translation="MKYADLQFIIHGYGYILYPFLLYFVCMKFKDYIESHQAFTTGDVY
FT                   AIAAVEAAHTQLRRAVKSGKVERVRRGVYVSKTGKFTGEAPDPFLVARTADPEAVISYH
FT                   SALVAHGVAHNVGFECAFRSAKVRSPFEYGGIRYVPYDLGDSPRTQAMRSRSYGTASVT
FT                   TREQTIVDCLTSPGRAGGAEETVRSCSAFPYLDIDVLLEILGGAPAAVVARAGWLLDAK
FT                   QADWGVADETLLSLEERLGHGPSKLDPKAKENRGWSFRWKLYLPETEGEVLSWTS"
FT   gene            complement(500787..501199)
FT                   /pseudo
FT                   /locus_tag="Olsu_0455"
FT   gene            complement(501639..501911)
FT                   /locus_tag="Olsu_0456"
FT   CDS_pept        complement(501639..501911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fsu:Fisuc_0876 KilA-N, DNA-binding domain
FT                   protein; SPTR: A4EBM9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67575"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYW1"
FT                   /protein_id="ADK67575.1"
FT                   /translation="MLSAVLRSDTVIDVSVRIMDAFVEMRHFLTDNSELLAQVRNFDRR
FT                   LDSLERSTDDRFLPERNGGIPGWSLTRGGGAHYEMTERGRRGMGE"
FT   gene            complement(501986..502213)
FT                   /locus_tag="Olsu_0457"
FT   CDS_pept        complement(501986..502213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0457"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: wsu:WS1135 hypothetical protein; SPTR: C2FRT3
FT                   Putative uncharacterized protein; PFAM: ORF6N domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67576"
FT                   /db_xref="InterPro:IPR018873"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYW2"
FT                   /protein_id="ADK67576.1"
FT                   /translation="MQDMNEAAIIACDDVQIRDMIYTVRGKQVMLDSDLAELYKVETRT
FT                   LNQAVTRNPGRFPERFCLKLTSEESEILKS"
FT   gene            502517..503707
FT                   /locus_tag="Olsu_0458"
FT   CDS_pept        502517..503707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0458"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pgi:PG0079 abortive infection protein,
FT                   putative; SPTR: Q4CB70 Abortive infection protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67577"
FT                   /db_xref="GOA:E1QYW3"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYW3"
FT                   /protein_id="ADK67577.1"
FT                   /translation="MYKLVSLTVGNFRSFCDPQTLTLDGRSAHSVTAVFGPNAGGKSNI
FT                   AKALVALINCIRRSSDPNFRLPYEPFLLKAGMDERPSMLGMAFSLDGRRYEYSVSFLAH
FT                   KVTHELLREQSDKTNRMNKVLERTDDKLNPYARQYGFGKRLLDRTREDTLLITKGREDN
FT                   NAYSNIIFGLLDHISIVSPSPDAPTPLFVEMLKNDVSLRSKTLELLKRCDFSIRDIKFT
FT                   DVALPEDIFDQLPVQIPPDIRRAMIEQGTTTFTTVHAVRDEEQAIVGSRDLDFWAQESM
FT                   GTQKFFEVAVPIIDALENGKTIFIDEFGTYIHPMLTHAIVSLFGESSSDDAYMVLMTHG
FT                   TTMLRELTRDEVVLVEKSHTEESLIIPLTDLGVRDGEAFEKRYLAGLYGGVPIIEG"
FT   gene            503715..504311
FT                   /locus_tag="Olsu_0459"
FT   CDS_pept        503715..504311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aba:Acid345_2063 hypothetical protein; SPTR:
FT                   Q1IPY6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67578"
FT                   /db_xref="InterPro:IPR025591"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYW4"
FT                   /protein_id="ADK67578.1"
FT                   /translation="MVSKKNGRRYLLICCEGKTEREYFLILRRLYRISAAQVSVIGEKG
FT                   QHKALVDRTLEERDKLCEDMCIDQDEVECWAVCDDDNMPFSYAELKDYAEKRKVKLAFS
FT                   RPQFEAYLLQHFEQSSLHDQKGLYTRLSDLASGAAGQSEEYDKANLKWLDVAIDAKPKL
FT                   VDIALVNADQRTRQSGKVFLTVQNLVRRMKELGKH"
FT   gene            complement(504423..505235)
FT                   /locus_tag="Olsu_0460"
FT   CDS_pept        complement(504423..505235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: car:cauri_0898 hypothetical protein; SPTR:
FT                   C3PF91 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67579"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYW5"
FT                   /protein_id="ADK67579.1"
FT                   /translation="MNAAELDFKHLTIDGKSSIAGDISDVDARGIYVYKFEDGTCCVGK
FT                   SEDVRKRYVQHAHEYRHMEGSPKVAEMLFAHVSGDNPEVLDRAETDAIAWFGSHGWDLR
FT                   NIMKTDLPGGAGILWTVTALPSTARRTRAATLSCQNLEVLVIGRDGSGFINGKDVPDEK
FT                   LEECIKHDMAPMKRAGWRFRGNTIVALNGQSARRLARPAEYANADNVFSLEFENLDQLN
FT                   LLLRDPLTLLWSYRLVAELLRRGPSMYRKFNNPYLAAKVLHECPSIFL"
FT   gene            complement(505719..505802)
FT                   /pseudo
FT                   /locus_tag="Olsu_0461"
FT   gene            505875..506573
FT                   /locus_tag="Olsu_0462"
FT   CDS_pept        505875..506573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0462"
FT                   /product="transglutaminase domain protein"
FT                   /note="COGs: COG1305 Transglutaminase-like protein;
FT                   InterPro IPR002931; KEGG: dhd:Dhaf_1999 transglutaminase
FT                   domain protein; PFAM: transglutaminase domain protein;
FT                   SPTR: C8PTZ8 Transglutaminase domain protein; PFAM:
FT                   Transglutaminase-like superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67580"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYW6"
FT                   /protein_id="ADK67580.1"
FT                   /translation="MDRYLEATPLLDFHDRRIQGLLARRGWRTLSTPTCMRAIYDFVRD
FT                   EILFGYNEDDNIPASQVLLEGYGQCNTKATLCMALFRACGIPCRIHGFTIDKRLQKGVM
FT                   MGLVYRKAPAHVLHSWVEACLDGCWYQLEGLILDSAYLQKLQARFSGHGGPFCGFGVAT
FT                   ADLQHPQVDFDLCDTYIQRDGIDQDFGLYDSPDDLYAHHRQAMSPLKRCAYQHLGRRQM
FT                   NRKVRQIREG"
FT   gene            complement(506849..507628)
FT                   /locus_tag="Olsu_0463"
FT   CDS_pept        complement(506849..507628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0463"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011663:IPR011991; KEGG: dge:Dgeo_2509 GntR
FT                   family transcriptional regulator; PFAM: UbiC transcription
FT                   regulator-associated domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH; SPTR: A4EBY3
FT                   Putative uncharacterized protein; PFAM: Bacterial
FT                   regulatory proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67581"
FT                   /db_xref="GOA:E1QYW7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYW7"
FT                   /protein_id="ADK67581.1"
FT                   /translation="MAEVIAGARTTIARGGQGDAPVSTPDTDMPSYLRVRRALAERIER
FT                   GAYAVGAALPSENDLASEFGTTRLTIRNATDGLVDQGRVRRIQGKGTFVTPGLLDPEGT
FT                   SRGGFRETARILGRKPSVRVLSRRKRRAGEYYAWLFGIRPDDLLYSLRRLNSVDAEPLT
FT                   IENTLVPLSILPGVEDVDIQVFSLYETYRHLGHMVAQTQEKLDIVELGGRDAGLLGVAA
FT                   GSAALLLECVSYDALGQAIEYACSYTRGDRGGYAYDY"
FT   gene            complement(507613..508380)
FT                   /locus_tag="Olsu_0464"
FT   CDS_pept        complement(507613..508380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0464"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011663:IPR011991; KEGG: nml:Namu_0953
FT                   transcriptional regulator, GntR family; PFAM: UbiC
FT                   transcription regulator-associated domain protein;
FT                   regulatory protein GntR HTH; SMART: regulatory protein GntR
FT                   HTH; SPTR: C4F9G1 Putative uncharacterized protein; PFAM:
FT                   Bacterial regulatory proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67582"
FT                   /db_xref="GOA:E1QYW8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYW8"
FT                   /protein_id="ADK67582.1"
FT                   /translation="MRDPYAIPPKDRAVEGIEWLIHSQELGAGDRLPVERELSRRLGVS
FT                   RTALRAGIAILVSQHELESRQGSGTYVCARKPQSVFQCSGSFSDTVREAGMRPGSRVLE
FT                   ARITASDEGVANHLGIAAGAATFVLRRMRTADDEPVGIETARVNVALCPDIDRHDFSRE
FT                   SLYAVLEEEYGIIPVRGYQRVSITQVNEGEADVLGARVGEPAFFERSLARTEDGVTVEY
FT                   VTSVILPSRYRFASVEDETDDVHVEVNTAWLRS"
FT   gene            complement(508564..509709)
FT                   /locus_tag="Olsu_0465"
FT   CDS_pept        complement(508564..509709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0465"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="COGs: COG0449 Glucosamine 6-phosphate synthetase
FT                   contains amidotransferase and phosphosugar isomerase
FT                   domains; InterPro IPR001347; KEGG: lmo:lmo0035 hypothetical
FT                   protein; PFAM: sugar isomerase (SIS); SPTR: C4F9G5 Putative
FT                   uncharacterized protein; PFAM: SIS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67583"
FT                   /db_xref="GOA:E1QYW9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYW9"
FT                   /protein_id="ADK67583.1"
FT                   /translation="MTTEKHPTMLDYVHESPEALECALTNHETLCGPLVARYVAESSDG
FT                   TSTGNVVLVACGSSRNAAECAAPLMRRALGARVTVSTPGTCLVSETFPVRGTFHLVVTQ
FT                   SGCSTNALAVLDRLRGTGAPALALTANPEAEVHSHADAVFDFGCGEEQVGYVTKGVVTL
FT                   AQYLMLFALDAAVATGRMGNGERDATLAQMRLVPEAHRALQASADKFYRTHRRDLLGMG
FT                   PCYVLGFDQAWGVALEGALKLGETVKVPAFAYEAEEFNHGPNLQMTPAYTVFLVDDLAR
FT                   GHERMVALYRACRHVTDHAFLLTATATDGAAGTDGNVFPLPEERPADPLLLPLYLLPFF
FT                   QIIAYRATEEKGSWDELPLVAETEDLVPSKTNDILRFMPYL"
FT   gene            complement(509706..510314)
FT                   /locus_tag="Olsu_0466"
FT   CDS_pept        complement(509706..510314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0466"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yen:YE3122 putative multidrug transporter
FT                   membrane\ATP-binding components; SPTR: B9CN13 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67584"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYX0"
FT                   /protein_id="ADK67584.1"
FT                   /translation="MPMAAFGGKDPQRFFAGTNFTVDEVLYEPPALVPAPSIYLDRGHH
FT                   RWAVRLSGASPRIYSFEDVLACRVADDDGAAERTRIEREGSLASLVANPMRYSQANASK
FT                   RGDRCFSLGVVIAVHGADVTIQLPYITRPTRRSSPVYHELRAAADHVKETFDAMIVSAR
FT                   TAVSERSTEHGAAPDGGSSADKASSIRRNAQKKHGRSRL"
FT   gene            510586..511647
FT                   /locus_tag="Olsu_0467"
FT   CDS_pept        510586..511647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0467"
FT                   /product="putative glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /note="COGs: COG2222 phosphosugar isomerase; KEGG:
FT                   sec:SC4392 putative glucosamine-fructose-6-phosphate
FT                   aminotransferase; SPTR: C4F9F1 Putative uncharacterized
FT                   protein; PFAM: SIS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67585"
FT                   /db_xref="GOA:E1QYX1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYX1"
FT                   /protein_id="ADK67585.1"
FT                   /translation="MAVTENVEIMHFDQEGYLAGGAAAAAAGDVMEGFADRVAAEGYDA
FT                   IFLLGVGGTWDEFMQLEYFMNKYGDKDLECYLIHAAEFNVSGHRRMTNRSVVLTASESG
FT                   TTPEVLEAVRKLKDMGVRVFAMTKPDGKIGQAVGAENCLDMASDHADGGCEMGYYLADR
FT                   FGLKLLNLRGCFPKYHEFVEQTRGIWPAFLDIRKQFEPKAEAFARSYALAPYTMFIGSG
FT                   ALWGETILFAMCILEEMQWKRTRYISSADFFHGTLELVEPGVPVVLFKGEDECRKLDDR
FT                   VEAFLKTGRTGDADVTVIDTAEYALPGLDPDFRPLLSPWILSSIITDRLSAYYELVTKH
FT                   NLDYRRYYHQFDY"
FT   gene            511715..512569
FT                   /locus_tag="Olsu_0468"
FT   CDS_pept        511715..512569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0468"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="COGs: COG1082 Sugar phosphate isomerase/epimerase;
FT                   InterPro IPR012307:IPR013022; KEGG: smd:Smed_5464 xylose
FT                   isomerase domain-containing protein; PFAM: Xylose isomerase
FT                   domain protein TIM barrel; SPTR: A4EBY9 Putative
FT                   uncharacterized protein; PFAM: Xylose isomerase-like TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67586"
FT                   /db_xref="GOA:E1QYX2"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYX2"
FT                   /protein_id="ADK67586.1"
FT                   /translation="MPARLAAMNCSHRFFDLEEFFASADAAGFEGVELWTGPMHFFMDA
FT                   HGYDPVSRLVGLERRYDLPIIGVCPEQANPKPHNIAVRGETGRARTLAYFTNALEVARE
FT                   LGASQVVVTSGWGYLNEPVEVAWERSVTMLSAIARRAEAIGVPLAIEALQPDESNLAHT
FT                   AADLLRLVAEVDSPALGVCLDLGAMAVAGDTIEGYFATFAGRIIHVHFVDVGHGMTHLA
FT                   WGDGERDMTSDLAALARCGYEGWLSSETVDPERFAGPAAADAQTMAAFRTAQEQLRRGV
FT                   RHL"
FT   gene            512566..512988
FT                   /locus_tag="Olsu_0469"
FT   CDS_pept        512566..512988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0469"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="COGs: COG2893 Phosphotransferase system
FT                   mannose/fructose-specific component IIA; InterPro
FT                   IPR004701; KEGG: PTS system fructose subfamily IIA
FT                   component; PFAM: PTS system fructose subfamily IIA
FT                   component; SPTR: C4F9F0 Putative uncharacterized protein;
FT                   PFAM: PTS system fructose IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67587"
FT                   /db_xref="GOA:E1QYX3"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYX3"
FT                   /protein_id="ADK67587.1"
FT                   /translation="MRQIVIATHTHLAAGLAEAVTFLAGEHGNVRVLNLFVDGEDDVAA
FT                   AARRVIDQTPSGDDLVVCTDLLGGSVNNEFAKLAQIDPRILLVTNANLPVVLQLVLAAG
FT                   DEPTVELVRQVVSAEESRPVLVNDLLVAESDGEDEF"
FT   gene            513061..513537
FT                   /locus_tag="Olsu_0470"
FT   CDS_pept        513061..513537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0470"
FT                   /product="PTS system sorbose subfamily IIB component"
FT                   /note="COGs: COG3444 Phosphotransferase system
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB; InterPro IPR004720; KEGG: PTS system sorbose subfamily
FT                   IIB component; PFAM: PTS system sorbose subfamily IIB
FT                   component; SPTR: B9CN07 PTS system, IIB component; PFAM:
FT                   PTS system sorbose subfamily IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67588"
FT                   /db_xref="GOA:E1QYX4"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYX4"
FT                   /protein_id="ADK67588.1"
FT                   /translation="MILLTRVDHRLLHGQVAVSWVNGLKANCVFVVGDHVANDPVWKTT
FT                   LRLGKPAGCKLVVKDMARAIESLKSGVTDKYRMIICVGSIAEAKQLAEGYQKIRSINLG
FT                   NTKESPTTRTLTKQVFVEPDEEQMLRDMAADGIELEYRALADDPKVDVAKLLDE"
FT   gene            513634..514407
FT                   /locus_tag="Olsu_0471"
FT   CDS_pept        513634..514407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0471"
FT                   /product="phosphotransferase system PTS sorbose-specific
FT                   IIC subunit"
FT                   /note="COGs: COG3715 Phosphotransferase system
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC; InterPro IPR004700; KEGG: kpn:KPN_04804 putative PTS
FT                   permease; PFAM: phosphotransferase system PTS
FT                   sorbose-specific IIC subunit; SPTR: C4F9F3 Putative
FT                   uncharacterized protein; PFAM: PTS system sorbose-specific
FT                   iic component"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67589"
FT                   /db_xref="GOA:E1QYX5"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYX5"
FT                   /protein_id="ADK67589.1"
FT                   /translation="MLGTSLMLGIVYWTFAYFDYQLGTLYAFRPIVVAPVVGALLGDVQ
FT                   TGLAIGASLELLFMGSVSIGAYVPPDATASAVLCTAYVILTGIEPAVAVGLAMPVGTLL
FT                   GALENLLQPLQNWLLAFIPKFAREGASRKIMALHWAVGLVTAPIYIAAITASVYFGSDA
FT                   VNWLVEVIPAFVLDGFACAANILPVMGFAMLARMILTKQLVPFYFLGFLLTAYLNVPVL
FT                   GVALLAIIIAIEKLDLFNNNPEPALAVEGDDDDDF"
FT   gene            514397..515227
FT                   /locus_tag="Olsu_0472"
FT   CDS_pept        514397..515227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0472"
FT                   /product="PTS system IID component, Man family (TC 4.A.6)"
FT                   /note="COGs: COG3716 Phosphotransferase system
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID; InterPro IPR004704; KEGG: PTS system
FT                   mannose/fructose/sorbose family IID component; PFAM: PTS
FT                   system mannose/fructose/sorbose family IID component; SPTR:
FT                   C4F9F2 Putative uncharacterized protein; PFAM: PTS system
FT                   mannose/fructose/sorbose family IID component"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67590"
FT                   /db_xref="GOA:E1QYX6"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYX6"
FT                   /protein_id="ADK67590.1"
FT                   /translation="MTSDRKSDFGITKNDLVKTSLNVGSLGMEFSWTYVNQMGLAFCVM
FT                   IMNCLKKIWGEGTEGYKQALERNAAFFNITVQLAPFVGGITIAMEEGVAKGKVDPKAIN
FT                   DVKAALMGPLSGIGDSIFLTTLRVIAAGVGISMCQAGNLAGPLVFLLIYNIPAFWLRVV
FT                   GIRYGYEMGTSLLDRAEKSGIMEKVLAAAGIVGIMVIGSMTKDMFGAELAIGFGAGDDA
FT                   TTLQAVLDGIMPGMVGLGFMWLYYWLLGKKISPSVLVLGTMLLGVILVYFGIMA"
FT   gene            515380..516582
FT                   /locus_tag="Olsu_0473"
FT   CDS_pept        515380..516582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0473"
FT                   /product="Ig domain protein group 2 domain protein"
FT                   /note="InterPro IPR003343:IPR008964; KEGG: dae:Dtox_1961 Ig
FT                   domain protein group 2 domain protein; PFAM: Ig domain
FT                   protein group 2 domain protein; SPTR: C0EHK7 Putative
FT                   uncharacterized protein; PFAM: Bacterial Ig-like domain
FT                   (group 2)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67591"
FT                   /db_xref="GOA:E1QYX7"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYX7"
FT                   /protein_id="ADK67591.1"
FT                   /translation="MDKKNGSRLPWLVIAIMSAIVAIMCAVGQPGAGAEDDEGIWDLHR
FT                   AYGDLYVNLGDTVTFAVDVVDYDTAEVIGDNATEVIAESADAEGEGDQAAEGESEAEPR
FT                   EQSEDGKGDGEEKPEDGEIDLSQFKFQWYWCQHNDETGEIMYEPIEGANEPTYTIDRVS
FT                   EVDLYDNNELEFVCALFPADATDLSYGNRINVSSIWFSLSLMPDDYVQTGTTQHVTVNP
FT                   EGQDSKGGYVAFVTNEAGTFDFQVSGVSDAATSPSVYVAAIQGDCVVAEYESDKTSFSL
FT                   ACDPAYTYVISWSADATKPVSFDYTISGEASEPAYVDLNESLEPTDEGLNVYVDAVTLR
FT                   EDGEYQLTVANPWVDADYSIDNESVATVSDDGKIWAVGPGEATITVTQGDETAAVAVNV
FT                   G"
FT   sig_peptide     515380..515481
FT                   /locus_tag="Olsu_0473"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            517318..517551
FT                   /pseudo
FT                   /locus_tag="Olsu_0474"
FT   gene            complement(517569..519934)
FT                   /pseudo
FT                   /locus_tag="Olsu_0475"
FT   gene            519964..520494
FT                   /locus_tag="Olsu_0476"
FT   CDS_pept        519964..520494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shi:Shel_02720 hypothetical protein; SPTR:
FT                   C7N234 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67592"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYX8"
FT                   /protein_id="ADK67592.1"
FT                   /translation="MTKFDDIYEEAVDSHGLITSARAAELGVTNNELVQYARRGRLERV
FT                   GHGLYRLARRVPEDNDPYALAVALAGPGAYLFGESVIAMLGLAPTNPSRLHVAVPGRIR
FT                   RRLPDGLVVERGDGMGTTAYDGISSQTAEAAIRACRGRMMPERLVQAAGAARREGYVDE
FT                   VEYGRLIEEVEGS"
FT   gene            520491..521285
FT                   /locus_tag="Olsu_0477"
FT   CDS_pept        520491..521285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0477"
FT                   /product="Domain of unknown function DUF1814"
FT                   /note="InterPro IPR014942; KEGG: shi:Shel_02710 protein of
FT                   unknown function (DUF1814); PFAM: Domain of unknown
FT                   function DUF1814; SPTR: C7N233 Putative uncharacterized
FT                   protein; PFAM: Domain of unknown function (DUF1814)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67593"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYX9"
FT                   /protein_id="ADK67593.1"
FT                   /translation="MKKPNSRRNLDVAIERAFGRGRSFTRARATIANVIVGQMLPDGAV
FT                   KGGSSIKLRLGEGATRYTTDLDVARASDLEDWIARLRSSLAEGWEGFTGRVVTREPASP
FT                   EGVPAAYVMQPFAVKLDYNGKPWVTVDLEVGHNEIGDADEPDLCLPRFVVEMFESIGLP
FT                   SPGPVPLMPVSHQIAQKLHGLSEPGSRRAHDLIDLQLLVAGCDVDYAKTRSVCERLFAY
FT                   RQMQSWPPKIDGSADWNDLYREQSGELDVVDDVELAVTYMTI"
FT   sig_peptide     520491..520577
FT                   /locus_tag="Olsu_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(521270..522094)
FT                   /pseudo
FT                   /locus_tag="Olsu_0478"
FT   gene            complement(522165..522353)
FT                   /locus_tag="Olsu_0479"
FT   CDS_pept        complement(522165..522353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67594"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYY0"
FT                   /protein_id="ADK67594.1"
FT                   /translation="MLTEASYAASRSSAYSSMSLCNDLIEVMLLSARPNARKSDWTFLA
FT                   SLFLPSLLSISSGTFLR"
FT   gene            complement(522691..523698)
FT                   /locus_tag="Olsu_0480"
FT   CDS_pept        complement(522691..523698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0480"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG2207 AraC-type DNA-binding
FT                   domain-containing protein;
FT                   InterProIPR018062:IPR000005:IPR018060:IPR009057:IPR 012287;
FT                   KEGG: ele:Elen_1482 transcriptional regulator, AraC family;
FT                   PFAM: helix-turn-helix- domain containing protein AraC
FT                   type; SMART: Helix-turn-helix, AraC domain; SPTR: C8WH60
FT                   Transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67595"
FT                   /db_xref="GOA:E1QYY1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYY1"
FT                   /protein_id="ADK67595.1"
FT                   /translation="MHRVRSQMSDPDVPGGSWAGSLFTAPLANVGLVPSHENPRGCGVF
FT                   FAGDGEASEGWYHAWSLDRDLVVASCDFRLLKRVPFAFDFTNYFAIRHESAGIFPPAQV
FT                   MAFLETRPRTGRVVMPTGTHVAYTEIEYYDGYFEKAFGSGCSESLAHLSACLGAMRGEG
FT                   MWDPQIPRLLEAIGGTEAHGRAAELLFAGIANEVMGRMLAMEDRFSEAVDDGDRRAIVL
FT                   VADHIRANIDAPPRLGELADMAQMGTTKFKRLFRQLTGTTTTEFIATERVERAKRLLAS
FT                   SELSVGQIARMCGFARATSFSALFSKRVGTPPRTFRKLARVAFSDDPVRAVELR"
FT   gene            523805..524542
FT                   /locus_tag="Olsu_0481"
FT   CDS_pept        523805..524542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0481"
FT                   /product="cobalt transport protein"
FT                   /note="COGs: COG0619 ABC-type cobalt transport system
FT                   permease component CbiQ and related transporter; InterPro
FT                   IPR003339; KEGG: ele:Elen_1483 cobalt transport protein;
FT                   PFAM: cobalt transport protein; SPTR: C8WH59 Cobalt
FT                   transport protein; PFAM: Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67596"
FT                   /db_xref="GOA:E1QYY2"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYY2"
FT                   /protein_id="ADK67596.1"
FT                   /translation="MALTDDNGLCSRLDVRTKLAVLLALIVTGAFVKDFAWGSMVFAFA
FT                   CMLTFAIGRRKMALSFAASYVLIMLVFWVTLSLPRSVSGAMGSAVLLARTCMPVFLFAA
FT                   AFVSSTKIGDLTAALYGLRLPRALVVPLAVCVRFFPTLGQEAGAVLTSMHLRGLGLSPR
FT                   NVVAHPVLTFESLLVPLMLRCAKIADELAASAVARGIDRPGLRTSYSPIRITAADVAVL
FT                   ASTVAWCAGVAAAKAYFEGGLVV"
FT   sig_peptide     523805..523918
FT                   /locus_tag="Olsu_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            524539..525957
FT                   /locus_tag="Olsu_0482"
FT   CDS_pept        524539..525957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0482"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1123 ATPase components of various ABC-type
FT                   transport systems contain duplicated ATPase; InterPro
FT                   IPR003439:IPR003593; KEGG: ele:Elen_1484 ABC transporter
FT                   related; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: C8WH61 ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67597"
FT                   /db_xref="GOA:E1QYY3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYY3"
FT                   /protein_id="ADK67597.1"
FT                   /translation="MSVPVIEFEGVSFTYAGADEASVKKVSLAVEAGECVVLCGRSGCG
FT                   KTTLTRLANGLAGGFWEGRRTGAVRVEGRNVDEFEEWQLAEHIGSVFQNPRTQFFNLDT
FT                   TGEIAFALENLGVPRDEMHARVARVADELGATDLLDRSIFKLSGGQMQSIAFASVSVCE
FT                   PRAYVLDEPSSNLDPVGMERLAALIAKAKAAGSAVLVAEHRLAYLSDAADTYVLIEEGR
FT                   VAHAWTPSEFEALSALERTRMGLRSPAPPRTADLVARLRIGATSAFPALEARGVVAEYD
FT                   RDDEVLRNVTAGFEAGHVTGVVAPNGTGKSTLFKCLAGVHPEVLGHVRIDGAVTIPRKR
FT                   ADNVFLVMQDPDYQLFRPTVRDELTTLPRVEGGIDPARADAMLERFGLASVADRHPASL
FT                   SGGQKQRVACALAALSDARALLFDEPTSGLDLDNMRRLARTMRELADEGRAVVVATHDP
FT                   ELLSEACDRIITLG"
FT   gene            526018..526623
FT                   /locus_tag="Olsu_0483"
FT   CDS_pept        526018..526623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011733; KEGG: ele:Elen_1485 hypothetical
FT                   protein; PFAM: Conserved hypothetical CHP02185 integral
FT                   membrane family protein; SPTR: C8WH62 Putative
FT                   uncharacterized protein; TIGRFAM: conserved hypothetical
FT                   protein; PFAM: Hypothetical bacterial integral membrane
FT                   protein (Trep_Strep); TIGRFAM: conserved hypothetical
FT                   integral membrane protein TIGR02185"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67598"
FT                   /db_xref="GOA:E1QYY4"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYY4"
FT                   /protein_id="ADK67598.1"
FT                   /translation="MEANVEERKLTSRDLIALGVFSLLFMIVSMLVVGLTSISVIAYCG
FT                   CCAIAAIPAGIVWTYMHVRIPRAGTSLVMAAVFAIVVFAVGSGWPVALGLLIGGGVSEL
FT                   VRKAVGRRRFSGIAVGYALFETCWAAGIFVPMFADQDYYRALMGSNNIDPSYMESMLSF
FT                   VTPQTFAAIAAVTIVGALIGAFLGRAVFKKHFERAGIA"
FT   sig_peptide     526018..526167
FT                   /locus_tag="Olsu_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            526638..530405
FT                   /locus_tag="Olsu_0484"
FT   CDS_pept        526638..530405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0484"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components;
FT                   InterProIPR017871:IPR001140:IPR003439:IPR003593:IPR
FT                   011527:IPR017940; KEGG: ele:Elen_1486 ABC transporter
FT                   related; PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; SPTR: C8WH63 ABC
FT                   transporter related; PFAM: ABC transporter transmembrane
FT                   region; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67599"
FT                   /db_xref="GOA:E1QYY5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYY5"
FT                   /protein_id="ADK67599.1"
FT                   /translation="MDRMKEQDAMQVEPAAGVAGKISAGSADGKGRQPKRPGVFTRCMA
FT                   FAGPRKPLIVLSMLLAALSLAASFVPYVAIYATISAIVSVYPDLSALDARQLSGYGMLA
FT                   LAGVVADVGCYLCALLCSHAAAFDTQYRIKIGIVDHLGKVPLGHVARLGTGRISKIMDE
FT                   AVDGIEQFIGHSIPDLAATAVAPVVLIVLLFVFDWRFGVATIVAVAVACIVQFSCYADK
FT                   RLMSQMGRYQQVKEEMGNAAVEYVRGMRVVKAFGQTARSFRKLAEAVKDYTGLALDVTF
FT                   FFQNSMPGFTALLNSAYLFVLPVGILLAPGADDWPAFVLSLVFYLLFVHSISSVFQKIL
FT                   YVSEDSMIAGASIGRIDSVLKLDGLSSAGEAQTPRDASVEFENVSFAYEEGGPQALENV
FT                   SFTVPAGSVCAVVGPSGSGKSTLANLLARFWDVDRGCIRIGGADVRSMGSDELMEQLSL
FT                   VFQDFHLFRESIADNIRRGRAGATDADVIAAAKAAQAHDFIERLPSGYDTVVGAAGIHL
FT                   SGGEGQRIALARAILSDAPVVVLDEATAFADPENEWLIQKAFEGLMDGKTVLMIAHRLS
FT                   TVVGADKIVVMDDGKVAEEGTHAELLASGGTYARMWERYEQSLAWGIGSDGGARIAAAP
FT                   PAAALPPEAVAAKSAAAATTTASAAAASADRDEDAPGKKQPWLKRLLSLSDEGYRSLAR
FT                   SSVACTLTDLSLMIPFMCTVAAFSILVGTLAGEPFEAGKLWAVFVCGIAGLVVTFIAAK
FT                   NDYRKTYVAAYTESESMRLSLAEHLRRLPMSFFNRRGIADVADRIMSDVTAQETMLSST
FT                   VPQLVAGCVSTVAICVLLAFFNWMLAFCVLVTLPIAALIVLASHRREKRLFERQQDARI
FT                   ESLACIQDYLEGLKDIRACHMVGEKSHEMNEALLSLKRMTMKVELAVDLSVSLANAILR
FT                   SGVGLTVFVGTALLAGGSVDFMTLLMFLLIASRVYGPILMLVSKLPSVLSLSTKTARLR
FT                   AIMDEPEACGDAEVLVDSHQIAFEDVRFAYEEKEVLHGVSFVAREGQVTALVGPSGSGK
FT                   STCAQLAARFWIPGGGRVTCGGRDIAGFYEESWLSHVSMVFQDVLLFDDTVAGNIRIGR
FT                   EDATDDEVRAAAETACCTEFIDRLPDGFDTMLGENGAALSGGERQRLSIARALLKDAPV
FT                   ILLDEATASLDPESETLVQQAVGRLCAGKTVIVIAHRMRTVAGADHIVVIDDGRVVEEG
FT                   SHGLLLERQGLYARLWELQHESAGWNVERR"
FT   gene            complement(530402..530662)
FT                   /locus_tag="Olsu_0485"
FT   CDS_pept        complement(530402..530662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GE18366 gene product from transcript
FT                   GE18366-RA; SPTR: B4NZM3 Protein Wnt"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67600"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYY6"
FT                   /protein_id="ADK67600.1"
FT                   /translation="MISFGVVSGVGSAIGILGNWYATHSLNVPSDGGGMTVAHALGDGG
FT                   GGPCVKEPKTSDSPRTIPPTGHTSSTLRLVRAGTVRRCEPR"
FT   sig_peptide     complement(530597..530662)
FT                   /locus_tag="Olsu_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(530717..531574)
FT                   /locus_tag="Olsu_0486"
FT   CDS_pept        complement(530717..531574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0486"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="COGs: COG1737 Transcriptional regulators; InterPro
FT                   IPR000281:IPR001347; KEGG: cbe:Cbei_0973 RpiR family
FT                   transcriptional regulator; PFAM: helix-turn-helix protein
FT                   RpiR; sugar isomerase (SIS); SPTR: B7CB00 Putative
FT                   uncharacterized protein; PFAM: Helix-turn-helix domain,
FT                   rpiR family; SIS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67601"
FT                   /db_xref="GOA:E1QYY7"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYY7"
FT                   /protein_id="ADK67601.1"
FT                   /translation="MIMDALKMKGSLTASEAKIADYLLVNAHDIRNLGISELARRTYSS
FT                   PATITRLCRKLGLSGYRDFRIVFAAELEEASRRKSVDANLPFSATDPLREVAFSMANLA
FT                   ASAMNNALQGFDYRRLEGVVERMASADSVNIYAVGVSATAALDFKQKMVRLGKQTNIEE
FT                   NSSLLPSYAFLGGKDSFDLLVSHSGETPAIVECVQILRSLGRRTLAITAHPQSTVARMA
FT                   DDTILTHVGEDSSFSTKIEGFASFNAVHFILDCLYCWVFQQNYETNVGRSKQNARRIAA
FT                   VRQR"
FT   gene            complement(531627..532481)
FT                   /locus_tag="Olsu_0487"
FT   CDS_pept        complement(531627..532481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0487"
FT                   /product="Phosphotransferase system EIIB/cysteine,
FT                   phosphorylation site"
FT                   /note="COGs: COG1264 Phosphotransferase system IIB
FT                   components; InterPro IPR018113:IPR001996; KEGG:
FT                   bpu:BPUM_0209 PTS family glucose/glucoside (glc) porter
FT                   component IIBCA; PFAM: Phosphotransferase system
FT                   EIIB/cysteine, phosphorylation site; SPTR: B7CB01 Putative
FT                   uncharacterized protein; PFAM: phosphotransferase system,
FT                   EIIB"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67602"
FT                   /db_xref="GOA:E1QYY8"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYY8"
FT                   /protein_id="ADK67602.1"
FT                   /translation="MEDYTELNRAIIEGVGGADNVVNVIHCATRLRFTLRDETKADRGA
FT                   LQALRGVIGTQSAAGTFQVLVGNRVDDVFRQLVELPELKERGIRESEAIGDPSAARIGL
FT                   FDRFTRMMSDVYAPYIPVLATGGIASGIIGLLANMGVVAPDSLTYMTFYAIFYALIYFF
FT                   PILLAFTAGKHFKCNPYVAATLGAAIMYPGVSDLLVTGASVILRDKRLIATMVVSGACG
FT                   GLVLGLGQVAATNFAFSGILSFGAWLGAKNFPMYCLGIAISLVASFASTAILLKSGGIR
FT                   DFG"
FT   gene            complement(532504..534387)
FT                   /locus_tag="Olsu_0488"
FT   CDS_pept        complement(532504..534387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0488"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="COGs: COG1902 NADH:flavin oxidoreductase Old Yellow
FT                   Enzyme family;
FT                   InterProIPR001155:IPR013027:IPR001327:IPR000103:IPR
FT                   013785:IPR016040; KEGG: cdl:CDR20291_2962 predicted enoate
FT                   reductase; PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; SPTR: B7CB02 Putative uncharacterized
FT                   protein; PFAM: Pyridine nucleotide-disulphide
FT                   oxidoreductase; NADH:flavin oxidoreductase / NADH oxidase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67603"
FT                   /db_xref="GOA:E1QYY9"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYY9"
FT                   /protein_id="ADK67603.1"
FT                   /translation="MFEQLLRPLNVNGMILRNRIIATPTGDAFDEKALGGAALVVAGHA
FT                   IVEPGRSSFASEDEPWPFAKYEREATRKRVLKVHQAGSKASIEIFHGGRESRVRDYAKG
FT                   PCSLTMPDGTKVRAMDEAMMQETLDWYSRTVASCRKIGFDAILLHFGHGWLPDQFLSPF
FT                   YNHRSDEYGGSIENRARFPLRILEAVRNAVGPHYPVEMRISAYEWVEGSIEFPDVLAFS
FT                   RMAERYVDMIQVSSGIDKNTVANVHCITTNLEPEMTNLGWARQVKRAVSIPVSVVGAFM
FT                   TPQVAEDALARNDVDAVAFGRTLIADPDWPRKAMEGRPEDIVPCLRCNNCYHIASDHWN
FT                   VGCSVNPHYHNESFVPKGIARANTGRNVVILGAGPGGMRAAITAFDRGHRVTLVEREDE
FT                   PGGMLRFIARESHKSEVARLLGHYRAQLAKRDIRVMLGCEATPELVRALEPEALGIAIG
FT                   ATERRPAIEGIDGPKVLLATEVIMRADELEGRIVILGGGSIGCELALELAERGRQVLVI
FT                   EMAHALAGNANALYREALRQKFELHPNIKAALGNSCTKVSAEHVEYADDAGRRQKAAYD
FT                   HMIVSVGLAPQTDLVERFHGIVPDTATIGDCVRPSSIMNANFEGHTFALNI"
FT   gene            534944..537625
FT                   /locus_tag="Olsu_0489"
FT   CDS_pept        534944..537625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0489"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="COGs: COG0474 Cation transport ATPase;
FT                   InterProIPR018303:IPR004014:IPR008250:IPR005834:IPR
FT                   006068:IPR001757:IPR000695; KEGG: apv:Apar_1038 ATPase,
FT                   P-type (transporting), HAD superfamily, subfamily IC; PFAM:
FT                   E1-E2 ATPase-associated domain protein; cation transporting
FT                   ATPase domain protein; Haloacid dehalogenase domain protein
FT                   hydrolase; SPTR: C8W7M6 ATPase, P-type (Transporting), HAD
FT                   superfamily, subfamily IC; TIGRFAM: ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase; Cation transporting ATPase, C-terminus; haloacid
FT                   dehalogenase-like hydrolase; Cation transporter/ATPase,
FT                   N-terminus; TIGRFAM: plasma-membrane calcium-translocating
FT                   P-type ATPase; ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; potassium and/or sodium efflux
FT                   P-type ATPase, fungal-type"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67604"
FT                   /db_xref="GOA:E1QYZ0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYZ0"
FT                   /protein_id="ADK67604.1"
FT                   /translation="MREYLVSASDVLEECATDAEQGLGAGVAEELLRQNGPNKLKEAER
FT                   TPLWIRFFQQMGDPMVIMLIVAAVISAATSVVQGEADFADVVIIMFVVILNSVLGVVQE
FT                   AKSEEALAALQEMAAATSKVIRDGKQVEVHSQDLVVGDVVILEAGDSVPADCRILESAS
FT                   MKVEEAALTGESVPVTKHADAISLPEGEDDVPLGDRKNMCYMGSTVVFGRGRAVVVATG
FT                   MQTEMGKIAGAIAEAQDEETPLQVKLDELSHILTILVVIICAVVFLTGFFKHGMGFVSN
FT                   LDLVLDTFMVAVALAVAAIPEGLVAVVTIVLSMGVTKMSQRHAIIRKLSAVETLGCTQI
FT                   ICSDKTGTLTQNRMTVVEHATENLTSHVRTMALASDAKWDEATGAALGEPTEAALVTDA
FT                   AKLGFTTSHLSQSRPRIGEAPFDSGRKMMSVVVRGRDGVMQHTKGGPDVVLARCTRYLA
FT                   EDGVVPMTDELRAQVMEQNKAMADRALRVMAAARRDWGDSEPESYDASYLEQDLTFVGL
FT                   SGMIDPVRPEVKAAIEEARSAGIRVVMITGDHVDTAVAIARELGLVEGRGQAITGAELD
FT                   RLSNEELTERIADFGVYARVQPEHKTRIVDAWKKEGEVVGMTGDGVNDAPSIKRADIGI
FT                   GMGITGTDVTKNVADMVLADDNFATIIGAVEEGRRIYDNIRKCIQFLLSSNLAEVIAVF
FT                   VASLVGFTILEPTHLLWINLITDSLPALAMATEGAEKDIMERRPRDAKDGIFAGGMGAD
FT                   TIFQGVVISLLTIAAYFIGISSVGASVADVVASDRAGLTGMTMAFLTLSMVEMFHSLNM
FT                   RSLRGSIFTLKGQNKWLWGSLAIALLLTFVVIETPLSVAFDFAELDLEHYAISMGLAIL
FT                   IIPIVELEKLVMRSIEKGERRG"
FT   gene            complement(538075..540357)
FT                   /locus_tag="Olsu_0490"
FT   CDS_pept        complement(538075..540357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0490"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="COGs: COG0058 Glucan phosphorylase; InterPro
FT                   IPR000811:IPR011833; KEGG: ere:EUBREC_2426
FT                   glycosyltransferase family 35 candidate glycogen
FT                   phosphorylase; PFAM: glycosyl transferase family 35; PRIAM:
FT                   Phosphorylase; SPTR: A8S9Z7 Phosphorylase; TIGRFAM:
FT                   glycogen/starch/alpha-glucan phosphorylase; PFAM:
FT                   Carbohydrate phosphorylase; TIGRFAM:
FT                   glycogen/starch/alpha-glucan phosphorylases"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67605"
FT                   /db_xref="GOA:E1QYZ1"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYZ1"
FT                   /protein_id="ADK67605.1"
FT                   /translation="MKIATLSSYTDKPLADCTDLELFNALLSLVADATRERGYNQGKKR
FT                   LYYISAEFLIGKLLSNNLINLGLYDSVRDELAACGRDLSALEEMELEPSLGNGGLGRLA
FT                   ACFLDSCATLGLPADGIGLAYHCGLFRQNFADNRQCESPDYWLRWGQDSWLRRTSRHFR
FT                   VSFGGFDVTSTLYEIDVTGYEGKSGKLRLFDVDSADERVIHSGISFDKDDVTKNLTLFL
FT                   YPDDSDDAGRLLRVYQEYFMVSNGAQLILDECQARGSNLHDLADYAAIQINDTHPTMVI
FT                   PELIRLLGEHGIAFDEAVSIARDVCAYTNHTILAEALETWPKHFIEQVAPQLIPIIDQL
FT                   DKLVRDSCEDPFVQVIDEHGNVHMANIDIHFSHSVNGVAALHTKILEDVELAPFYKLYP
FT                   EKFNNKTNGITFRRWCIECNPELAGLITQTIGDDWKHDATRLEDLLAHQDDDGLLDQLS
FT                   KIKRHNKERFAAWLRAHQGTEVDPDAIFDVQSKRLHEYKRQQLNLLWATNTYLQVKAGK
FT                   LPERKVCMLFGAKAAPAYTIAKDIIHAIICLGKVVAADPVASQYLQVVMIENYNVTAAE
FT                   RLIPAADVSEQISLASKEASGTSNMKFMLNGALTLGTMDGANVEIAELVGKGNIYTFGE
FT                   GSDEVIARYQRGDYDPRSYYEGDERLKEAVDFLRGPQMLEVGNAESLERLTEELLGKDW
FT                   FMTFPDFDSYLTEKARVLNDVADQHSWQRKALVNIAKAGFFSSDRTIEQYNRDIWHLGV
FT                   DSSRGCE"
FT   gene            540532..541419
FT                   /locus_tag="Olsu_0491"
FT   CDS_pept        540532..541419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0491"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG2207 AraC-type DNA-binding
FT                   domain-containing protein;
FT                   InterProIPR018062:IPR003313:IPR000005:IPR018060:IPR
FT                   020449:IPR009057:IPR014710:IPR012287; KEGG: ere:EUBREC_2427
FT                   L-rhamnose operon transcriptional activator; PFAM: AraC
FT                   protein arabinose-binding/dimerisation; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   Helix-turn-helix, AraC domain; SPTR: C7HA47 Putative
FT                   AraC-type DNA-binding domain-containing protein; PFAM:
FT                   AraC-like ligand binding domain; Bacterial regulatory
FT                   helix-turn-helix proteins, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67606"
FT                   /db_xref="GOA:E1QYZ2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYZ2"
FT                   /protein_id="ADK67606.1"
FT                   /translation="METGEYERYRERKLHERAGFAYDTYLCTIPQDFDRVPPHWHEQME
FT                   VIYVKRGSGAVSLNFERLPVVAGSIVVVCPGQIHAIEGDPGVRMEYENIIFSLSALDSA
FT                   AEEDWCRTNVLVPLRRGTLGIPNPLSPGSELHQEAARALDRADAASSERVAGNSLLVRS
FT                   AMLLFLHALYVHARRDEPVGPDMAIERLRPVFDEVRLHYDRPLDVAGAARLSGYSKAHF
FT                   MRIFKQETGQTFVGYLSDYRLSEAESLLRRTNESVTTVARGCGFDNLSYFTRRFRAKYG
FT                   MPPSAYRKHWMERT"
FT   gene            complement(541422..542213)
FT                   /locus_tag="Olsu_0492"
FT   CDS_pept        complement(541422..542213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1611 Rossmann fold nucleotide-binding
FT                   protein; InterPro IPR005269; KEGG: bln:Blon_1704 conserved
FT                   hypothetical protein 730; PFAM: conserved hypothetical
FT                   protein; SPTR: B9AUS0 Putative uncharacterized protein;
FT                   PFAM: Possible lysine decarboxylase; TIGRFAM: conserved
FT                   hypothetical protein, DprA/Smf-related, family 1; conserved
FT                   hypothetical protein, DprA/Smf-related, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67607"
FT                   /db_xref="GOA:E1QYZ3"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYZ3"
FT                   /protein_id="ADK67607.1"
FT                   /translation="MGRRSADQPLGPAYRRGPVLLRGKMIPEDSTNEHLLEPMQDTEWL
FT                   HSDPWRVLRIQSEFVDGFGALAELGPAVSVYGSARTSQDHPDYQAARQSGRLMAQRGVA
FT                   VITGGGPGIMEAANCGAAEMGGVSVGLGIELPFEEGVNKWVNLGMGFRYFFVRKTMFVK
FT                   YSQGAIIFPGGLGTMDEAFELLTLVQTHKSPAIPIVLFGSGYWQGLIDWIQGTMVERGM
FT                   MSPGDLHLVSMTDSVEEAVRIACSAIDAKRGGATGSCDVTA"
FT   gene            complement(542403..543662)
FT                   /locus_tag="Olsu_0493"
FT   CDS_pept        complement(542403..543662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0493"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="COGs: COG0205 6-phosphofructokinase; InterPro
FT                   IPR011404:IPR000023; KEGG: cpy:Cphy_3345
FT                   phosphofructokinase; PFAM: phosphofructokinase; SPTR:
FT                   A8S7T0 Putative uncharacterized protein; PFAM:
FT                   Phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67608"
FT                   /db_xref="GOA:E1QYZ4"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYZ4"
FT                   /protein_id="ADK67608.1"
FT                   /translation="MYGTPCDTHGTLRNVLVGQSGGPTAAINASLAGVVSAARRQGAHA
FT                   VGMRYGIEGFLAGRTVDLDAALPTSVELELLRHTPASWLGSCRYKLPDASEDAGTYERL
FT                   FSAFERQQVDAVLYIGGNDSMDTIAKLGAWGSRVGSGVRFVGIPKTIDNDLVGTDHTPG
FT                   YGSAAKYVATSIGELSCDSDVYDLKGVTVVEIMGRDAGWLAAAAALATQGGVPAADVIL
FT                   LPEAPLEVDALLGRLEGLLAEKSSVILAASEGARTPDGRLVAERTNAPGTRRDAFGHLA
FT                   ALSGTSRYLAQLVRERLGVKARAVEISTLQRCASHCASATDLDEAFALGAAGVEAAERG
FT                   GSERMCALRRSGDAPYGCSIETVDVHAVANRTKPVPTSWITADGMGLTVDFERYARPLI
FT                   AGEPSLAWEDGLPQRLAPLG"
FT   sig_peptide     complement(543552..543662)
FT                   /locus_tag="Olsu_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(543729..544523)
FT                   /locus_tag="Olsu_0494"
FT   CDS_pept        complement(543729..544523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0494"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1101 ABC-type uncharacterized transport
FT                   system ATPase component; InterPro
FT                   IPR017871:IPR003439:IPR003593; KEGG: ere:EUBREC_0186
FT                   ABC-type uncharacterized transport system, ATPase
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: C4F9X8 Putative uncharacterized protein;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67609"
FT                   /db_xref="GOA:E1QYZ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYZ5"
FT                   /protein_id="ADK67609.1"
FT                   /translation="MLVLKGVTKTFNKGTVNEKPALTGVDLHLEPGDFVTVIGGNGAGK
FT                   STLLNSIAGVFALDGGQVILDGRDVSRLPEHRRATDLGRVFQDPMRGTAADMQIVENLA
FT                   LAARRGESRGLSWGITRDERASYRERLAELDLGLEERLTSKVGLLSGGQRQALTLLMAI
FT                   LKKPKLLLLDEHTAALDPKTASKVLALTERLVGGHGLTTLMVTHNMNDAIRLGNRLIMM
FT                   HEGNVIFDARDDEKRRLRVHDLLQKFEEASGGELANDRMLLS"
FT   gene            complement(544517..545440)
FT                   /locus_tag="Olsu_0495"
FT   CDS_pept        complement(544517..545440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0495"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG4120 ABC-type uncharacterized transport
FT                   system permease component; InterPro IPR017441:IPR001851;
FT                   KEGG: bhy:BHWA1_00397 hypothetical protein; PFAM:
FT                   inner-membrane translocator; SPTR: B6GB53 Putative
FT                   uncharacterized protein; PFAM: Branched-chain amino acid
FT                   transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67610"
FT                   /db_xref="GOA:E1QYZ6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYZ6"
FT                   /protein_id="ADK67610.1"
FT                   /translation="MLLALSGAVSQGILWGIMVLGVFITYKMLDIADLTVDGSFALGGC
FT                   VAAVCSVGMGLDPLVAVLLGMLAGVVAGAVTGLLHTLFDIPAILAGILTQIALWSINLR
FT                   VMGKSNTPLLNADTVFTRVASLLHVTQGMAALVVGIVVAVLAIVLLYWFFGTEIGSALR
FT                   ATGQNEDMCRALGIDVRVAKLIALMLSNGLVGLSGALICQSQKYADIGMGTGAIVIGLA
FT                   AIVIGEVLGRLTPGKLQAFGSRLASAVVGSVVYFLIRAVVLQLGMDANDMKLLSAIIVA
FT                   LALVVPVVWERGRQRRAYAKGGERSC"
FT   gene            complement(545599..546576)
FT                   /locus_tag="Olsu_0496"
FT   CDS_pept        complement(545599..546576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0496"
FT                   /product="protein of unknown function DUF534"
FT                   /note="COGs: COG2984 ABC-type uncharacterized transport
FT                   system periplasmic component; InterPro IPR007487; KEGG:
FT                   bhy:BHWA1_00396 ABC-type uncharacterized transport system,
FT                   periplasmic component; PFAM: protein of unknown function
FT                   DUF534; SPTR: C0D980 Putative uncharacterized protein;
FT                   PFAM: ABC transporter substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67611"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYZ7"
FT                   /protein_id="ADK67611.1"
FT                   /translation="MSRNITRRDALAVFGGLAAFGIAACSDTGSDGSPSDHGQFKIGVL
FT                   QLTEHKALDAANAGFVQALDAAGLKYTIDQQNAQNDQSACQTIASKLVNDGNDLILAIA
FT                   TPACQAVAGATADIPIVGTAITDYAASGLVADNDAPGGNVTGTSDLTPVEEQFDLLRKL
FT                   LPNAKRVAVLYCTAESNSSVQAGMAHDAASARNLDAEDYTVSSSNEIQQVVESMIGKVD
FT                   VIYAPTDNTIAAGMQTVAMVATENKLPIICGESGMVGNGGLATYGIDYGKLGRKAGEMA
FT                   VRILNGEAKPAEMPIEHLDVSECTLTTNEEAAKTLGIDLSVLDA"
FT   sig_peptide     complement(546481..546576)
FT                   /locus_tag="Olsu_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            547003..548163
FT                   /locus_tag="Olsu_0497"
FT   CDS_pept        547003..548163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0497"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="COGs: COG1979 Uncharacterized oxidoreductase
FT                   Fe-dependent alcohol dehydrogenase family; InterPro
FT                   IPR018211:IPR001670; KEGG: ere:EUBREC_3047 NADH-dependent
FT                   butanol dehydrogenase A (BDH I); PFAM: iron-containing
FT                   alcohol dehydrogenase; SPTR: C4Z8E8 NADH-dependent butanol
FT                   dehydrogenase A (BDH I); PFAM: Iron-containing alcohol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67612"
FT                   /db_xref="GOA:E1QYZ8"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYZ8"
FT                   /protein_id="ADK67612.1"
FT                   /translation="MYDFMFHVPTKIYFGRGQISHLAELSDFGQKALLVYGGGSIKRNG
FT                   IYDEAIRILTHAGIEVVELSGVEPNPRIETVRRGVGLCAREGVDMVLAIGGGSTIDCAK
FT                   VVAAGARYDGDPWDLVLDGSKAASALPIFSVLTLSATGSEMDAFAVISDMSKNEKWGTG
FT                   AECMKPTMSVLDPSYTFSVSPKQTAAGTADMMSHTFESYFSMDEGAYVQKRLAEGLLGT
FT                   MIHFGPIALAHPDDYDARANLMWAASHAINGLVSDGCSPAWCVHPMEHELSAFYDITHG
FT                   EGLAILTPAWMEHVLDAQTAPLFAAYGCNVWGLSGVDDMKVAREAISRTRAFFVEAMHL
FT                   PATLREVGITDEKNFEVMARKAADGCKGSFVALSQDDIVEIYRAAL"
FT   gene            complement(548382..549431)
FT                   /locus_tag="Olsu_0498"
FT   CDS_pept        complement(548382..549431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0498"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR011335; KEGG: ele:Elen_1303 hypothetical
FT                   protein; SPTR: C8WGN1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67613"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E1QYZ9"
FT                   /protein_id="ADK67613.1"
FT                   /translation="MIVLSHESALEYYRLAASVDSGTYRELGEIADRWPRRDRLDSSGC
FT                   SALACLGALGSLERPLHLLLPDKNRVRSPEVAFHRWSARLPSDPFWRVSDDVWVSSPSF
FT                   TLLQLCSNVFRRDRRTGTSAEAMDDRRRLNRSPYSQLAGTIRLTLVAMELMGTYRLAPI
FT                   RGNTSFGTETLLSANELHGFVDAHEGHQGIQMLRRVTSHAMPNSYSPMETALALGLTLQ
FT                   RRYGGFQLPQPHLNELLELTGTGGRTVSYRPDLYWPERHLVVEYDSDLFHSADTKRSKL
FT                   AEDDERSNALTAMGRHVMHVTKEQMLDFRKYQVLASQVTRALGRKPAATDREACRQQSK
FT                   LHHLLLHPY"
FT   gene            549951..553505
FT                   /locus_tag="Olsu_0499"
FT   CDS_pept        549951..553505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0499"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="COGs: COG0674 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase alpha subunit;
FT                   InterProIPR011895:IPR017900:IPR002880:IPR019752:IPR
FT                   019456:IPR001450:IPR002869:IPR009014:IPR015941:IPR017896;
FT                   KEGG: apv:Apar_1328 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; PFAM: pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein; Pyruvate/ketoisovalerate
FT                   oxidoreductase; Pyruvate-flavodoxin oxidoreductase, EKR
FT                   domain; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; SPTR: B6GD95 Putative uncharacterized protein;
FT                   TIGRFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   PFAM: Domain of unknown function; domain; Pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase; Thiamine
FT                   pyrophosphate enzyme, C-terminal TPP binding domain;
FT                   TIGRFAM: pyruvate:ferredoxin (flavodoxin) oxidoreductase,
FT                   homodimeric"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67614"
FT                   /db_xref="GOA:E1QZ00"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ00"
FT                   /protein_id="ADK67614.1"
FT                   /translation="MARKFKSMDGNEAAAYVSYAYTEVAGIYPITPSSPMADHVDQWAA
FT                   QGMKNVFGTPVKVVEMESEAGAAGTVHGSLGAGALTTTYTASQGLLLMVPNMYKIAAEQ
FT                   LPGVFHVSARTVATQALNIFGDHSDVMACRQTGFAMLAETNVQEVMDLAPVAHLSAIEG
FT                   KVPFLNFFDGFRTSHEIQKVAVWDYSDLADMCDMDAVQAFRDHALNPEHPHARGSHENG
FT                   DIFFQHREACNSTYDALPAVVQAYMDKVNEKLGTSYHLFDYYGAEDADRVVVCMGSFCD
FT                   TLEETIDYLNAHGEKVGLVKVRLYRPWSVKDFVAALPASVKKIAVLDRTKEPGSIGEPL
FT                   YQDVVCALVESGMGGIPVIGGRYGLGSKDEPPAAAFSVYDELKKDEPKREFTIGIVDDV
FT                   TNLSLPMDPKAPNTSAAGTIECKFWGLGGDGTVGANKNSIKIIGDHTDKYVQAYFQYDS
FT                   KKTGGVTISHLRFGDAPIRSPYYVTAADFVACHNPSYIIKGFKMVRDVKPGGSFLLNCQ
FT                   WSDEEFAEHMPANAKRYIAENDINVYLIDAIDLAAKVGMGKRTNTVLQSAFFALAKVLP
FT                   AEDALRYMKDAATKSYSKKGEAVVAANHKAIDAGATAFRKFEVPAGWATAEDRPDTLAL
FT                   EGREAIVKQVKELLGPINKMDGDSLPVSAFAANADGQWELGASAYEKRGTAVMVPRWDE
FT                   SKCIQCNNCAYVCPHATIRPVAMNAEEAAAAPEAMKTVGLKIPKNTGYTFTVAVSPLDC
FT                   MGCYNCVAICPKSDMKEGGALTMVPQEEEAAQVAVWDYAVNKVSEKGELFSDKTTKGSQ
FT                   FRKPLLEFSGSCAGCAETSYARLVTQLFGDRMFISNATGCSSIWGNPAATSPFTCNAEG
FT                   HGPAWNNSLFEDNAEHGLGFSVGYEAEQNRLVAATEALLATDVSDEFKAAAQAWLDSRG
FT                   DAAASKAAAAAYVAALEANGSDAAKAIAADRSFMTKKSFWIFGGDGWAYDIGFGGLDHV
FT                   LASGNNVNVFVFDTEVYSNTGGQASKASNIGQVAQFAAAGKATSKKSLAEIEMSYGYVY
FT                   VAQVAMGANLAQTLKAIAEAEAYDGPSLIIGYSPCEMHSIKKGGMIHCQEEMKKAVDCG
FT                   YWNLFRFNPSAGPGKKFVLDSKEPKGGYQEFLMNEARYARLTSEFPERAEKLFQRNEEA
FT                   AMARYQHLLKLKDLYAEA"
FT   gene            553768..554814
FT                   /locus_tag="Olsu_0500"
FT   CDS_pept        553768..554814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG0715 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport systems periplasmic components; KEGG:
FT                   dhd:Dhaf_2612 hypothetical protein; SPTR: A4EAG0 Putative
FT                   uncharacterized protein; PFAM: NMT1/THI5 like"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67615"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027024"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ01"
FT                   /protein_id="ADK67615.1"
FT                   /translation="MRENRIRRLHAAAVAAVAAVLSAALVACGGQAAPSGQPADTDARQ
FT                   SEAVGSVDVKVASLKGPTSIGLASFMDKAASDPGSLANAYDFTVAGSADEVVPSLIQGD
FT                   VDIALVPANVASVLYNKTAGGVVALDVNTLGVLSVVTADSGVVDFSALSGRTVYMTGKG
FT                   ATPEYVMNYLLERNGLAGQVTLEFKSEATEVVQAISQDLDAVAVLPQPYVTVACAKNPS
FT                   LKATIDLNDVWDTASADGSRLVTGVTVARREFLEEHPDAVREFVERQSASVDAANADPE
FT                   GTAPLVVNAGIVDSEQIAAKAIPGCHLVCLTGDDLRGALSGYLKTLFDADASSVGGSLP
FT                   GDDFYYAG"
FT   sig_peptide     553768..553863
FT                   /locus_tag="Olsu_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(555169..557364)
FT                   /locus_tag="Olsu_0501"
FT   CDS_pept        complement(555169..557364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0501"
FT                   /product="superfamily I DNA and RNA helicase-like protein"
FT                   /note="COGs: COG3973 Superfamily I DNA and RNA helicase;
FT                   InterPro IPR014016; KEGG: apv:Apar_0360 superfamily I DNA
FT                   and RNA helicase-like protein; SPTR: B9CP84 Superfamily I
FT                   DNA and RNA helicase; PFAM: UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67616"
FT                   /db_xref="GOA:E1QZ02"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ02"
FT                   /protein_id="ADK67616.1"
FT                   /translation="MDDRTLAAEQAHLDDIYAQLVRLRDELTERLETTHRQAARDLIDM
FT                   SEEVRQDFGGADEAMETLAAIETLNSVIDSYNQVHDFDIERLGRVAILLRQPYFAKVRL
FT                   RMRPGRPARDVYIGAAGMTDDHHTPLVVDWRNPIAETYYNQEMGTTSYEVDGRLRTVEL
FT                   ELRRQFDITRDHLNLYFDSDVAIEDSLLLSALSRHHSEKLQAITATIQREQNRVIRHRD
FT                   VGALIVSGIAGSGKTSVLLQRIAFLLYRERKTLDASQVYLFTPNDVFRRYVDTVLPSLG
FT                   ESNPRTFTWRSFTAAQGLADHGEGRGTTADELGRLEAAVPSLELLPSDFREVKVAETVL
FT                   LRTSSIQGAAEKYARFPVGPKFVALVKDELHGRLNRRIANLAHDEELQERMLALDVDEQ
FT                   MARFGEVISPNDEDELLSWAKRYAEGLYGGAHDEIERSGWLRIDRIGARILGTSNLNSV
FT                   EWLYLHLLITGGGGRDARYVMVDEVQDYSAGQLMVLARYFSRAHFLLLGDEHQAIREGS
FT                   ASFDEIRRVFGESHGEVEECRLLTSYRSTPEVTALFWGLVEQDEHAAVSSVQRDGGRPR
FT                   IIEVSSGDAGAYLAMLREILDEAGRCKGLCAVICADRARSRWLARQLKGVRPEGAPDGQ
FT                   RGGLRPRMGDAQPGSAVTLVDKGDALPAGGVVLMELSLAKGLEFDHVVVADAQAEVYPD
FT                   TPLSRNRLYTALSRATHRVSVLSQGPLTPLLAATERC"
FT   gene            complement(557366..557950)
FT                   /locus_tag="Olsu_0502"
FT   CDS_pept        complement(557366..557950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0502"
FT                   /product="ribosome biogenesis GTP-binding protein YsxC"
FT                   /note="COGs: COG0218 GTPase; InterPro IPR002917:IPR019987;
FT                   KEGG: apv:Apar_0361 small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; SPTR: B9CP83 Ribosome
FT                   biogenesis GTP-binding protein YsxC; TIGRFAM: ribosome
FT                   biogenesis GTP-binding protein YsxC; PFAM: Ferrous iron
FT                   transport protein B; TIGRFAM: ribosome biogenesis
FT                   GTP-binding protein YsxC/EngB; small GTP-binding protein
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67617"
FT                   /db_xref="GOA:E1QZ03"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ03"
FT                   /protein_id="ADK67617.1"
FT                   /translation="MALKYETARYEASYGTVGQLPEPTTPEVAFAGRSNVGKSSLLNRL
FT                   VGRKALARVSSQPGKTANINFFDVDGVRFVDLPGYGFAKVSQRERRRWADLIGGYFAQG
FT                   RSFNLVVSLVDIRHDAQQLDRDMLGFLTENELPYVVALTKADKLSRARQSQQAAALARQ
FT                   FGIDRTRMIVTSSETGLGIGELRRVIEEACL"
FT   gene            complement(558217..560793)
FT                   /locus_tag="Olsu_0503"
FT   CDS_pept        complement(558217..560793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0503"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="COGs: COG4581 Superfamily II RNA helicase;
FT                   InterProIPR000209:IPR011545:IPR001650:IPR014001:IPR 014021;
FT                   KEGG: ele:Elen_1453 DEAD/DEAH box helicase domain protein;
FT                   PFAM: DEAD/DEAH box helicase domain protein; helicase
FT                   domain protein; SMART: DEAD-like helicase ; helicase domain
FT                   protein; SPTR: C8WH31 DEAD/DEAH box helicase domain
FT                   protein; PFAM: Domain of unknown function (DUF3516);
FT                   Helicase conserved C-terminal domain; DEAD/DEAH box
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67618"
FT                   /db_xref="GOA:E1QZ04"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021904"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ04"
FT                   /protein_id="ADK67618.1"
FT                   /translation="MTDDETGSLGSLVPWPDDETFADIPADEALGLFLGWVESRGMDLW
FT                   EHQEEALLDIAAGDHVILGTPTGSGKSLVALGLSFMAVCTNRRACYTAPIKALVSEKFF
FT                   DLVGLLGRENVGMITGDVVINGDAPIVCCTAEILAQDALRKGEGADIGCVAMDEFHFYG
FT                   DRERGWAWQVPLLTLPRTQFLLMSATLGDVGGIARALEAHTGRAVDVVADAPRPVPLSW
FT                   RYVDTPLEATVKVALEAGEAPLYIVHFSQQDAIRSAQSLASFGVSTREQRTRIGDALAG
FT                   TRFTTTFGKALRRLLLTGVGVHHAGMLPRYRLLVEKLAQQGLLPVICGTDTLGVGINVP
FT                   IHTVVLTALSKFDGRRMRHLNAREFHQIAGRAGRAGFDTEGVVIAEATEYDIENARALA
FT                   KAGGDPKKARKVRTKTPPKGYVGWKEATFERLVAAEPEPMRPRMRITHAMVLAEVVQGG
FT                   DAYARTIRLIDGSAQSAEEKERLRRRADEIFATLIDAGVVERHEGADGSADFAATVDVP
FT                   EDFALDQPLSPFLLAALELLDPADDHYAMDLVSMVEATLEDPPQILRALERQARDEAMA
FT                   RMKADGVEYDERIERIQEVSYPKPLEGFLDAAFERYCEKVPWAADFAPSPKSVLRDMLE
FT                   TASDFKGYVQRCNIARSEGTLLRYLSDAYRVLDRTVPPEKLDERLRDIVAWLRLVVRSV
FT                   DSSLVDEWEAAGTTGADGADVTPPDADEVVHDRRGLVVLVRNALFARVRLIAHGDDEGL
FT                   GEMDGGWGWRAARWRAAIEAYHGAHEEVLLDGGARSNAYLLMDESDERDSHVWHVRQML
FT                   RDEDDEGDFGISADVDLDATQEEGEVVFKSYAVGFIEDLLEAEGGR"
FT   gene            complement(560783..561784)
FT                   /locus_tag="Olsu_0504"
FT   CDS_pept        complement(560783..561784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0504"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847:IPR005119:IPR011991; KEGG: ele:Elen_0408
FT                   transcriptional regulator, MarR family; PFAM: regulatory
FT                   protein LysR; LysR substrate-binding; SPTR: C8WKU1
FT                   Transcriptional regulator, MarR family; PFAM: Bacterial
FT                   regulatory helix-turn-helix protein, lysR family; LysR
FT                   substrate binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67619"
FT                   /db_xref="GOA:E1QZ05"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ05"
FT                   /protein_id="ADK67619.1"
FT                   /translation="MRLQQLRYIIAIAESGSMNSVARSLFISQSSLSVAVRDLERELGI
FT                   RVFNRSSRGITLTSEGVEFLGYARQVVEQADLLARHYRQKGEDAHRRLAISSQHYAFAV
FT                   NAFIDFVAERDDASCEYSLRETRTSEIIEDVRSFRSDIGILYLSGSNERVLRSRLEEAS
FT                   LSFTPLFRARPHVFVREGHPLAERPSVTVEDLAPFARYTFEQGPESSLFYSEEPLATLP
FT                   HDREIVVSDRATMTGLLSRYDGFLVSTGVRSDEMFSGITSIPIECDEVMNVGYVTHSQR
FT                   RLTSLALGYIAKLDELILSFEDDETLVPSKAAHRIAKALEGRRRPGRGPRDG"
FT   gene            complement(561827..562024)
FT                   /locus_tag="Olsu_0505"
FT   CDS_pept        complement(561827..562024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67620"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ06"
FT                   /protein_id="ADK67620.1"
FT                   /translation="MVEHEGNEMSAFELPKAGKQFRICDTGQVLTYEQMTSGIDADLLP
FT                   HDQDSLELFLSVMGAEATDE"
FT   gene            562183..562593
FT                   /locus_tag="Olsu_0506"
FT   CDS_pept        562183..562593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0506"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="InterPro IPR001387:IPR010982; KEGG: amr:AM1_A0344
FT                   hypothetical protein; PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein; SPTR:
FT                   A8ZKZ4 Putative uncharacterized protein; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67621"
FT                   /db_xref="GOA:E1QZ07"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ07"
FT                   /protein_id="ADK67621.1"
FT                   /translation="MGERYKEASDRSADAVAAGPRSTQGERAVHENNLRYLRDKVGLSQ
FT                   VQVAAQLGVSSKTYSSWETGRTELGAERIRALCDLLGCTPNDVLGYRGHTSFAPVTTIE
FT                   ETIVDLYGRLAPNVRMAVLEIMRDSAKKRRPR"
FT   gene            562808..564403
FT                   /locus_tag="Olsu_0507"
FT   CDS_pept        562808..564403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0507"
FT                   /product="membrane bound O-acyl transferase MBOAT family
FT                   protein"
FT                   /note="COGs: COG1696 membrane protein involved in D-alanine
FT                   export; InterPro IPR004299; KEGG: shi:Shel_17220 predicted
FT                   membrane protein involved in D-alanine export; PFAM:
FT                   membrane bound O-acyl transferase MBOAT family protein;
FT                   SPTR: C7N756 Predicted membrane protein involved in
FT                   D-alanine export; PFAM: MBOAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67622"
FT                   /db_xref="GOA:E1QZ08"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ08"
FT                   /protein_id="ADK67622.1"
FT                   /translation="MELYSAGFLLFLAVSLASYYLVGRLVPRGQWALLLVASLAFYGLV
FT                   GSWETLWLVVLVALVTWAVPLAFVRMEGLSSRQRHALDDRRQRKAVKLRWRRRQRLVLL
FT                   AALVACFGILAYLKYWNTLLYELGAAPSRGSLGLLLPLGISFYTFQSVAYLVDAYNAKV
FT                   EPQRNFARHLLFVTWFPQMIQGPINRYDQLGPQLFAPHRWSEVDVSRALVTVGYGMVKK
FT                   FVMADLLVGIITRLLSSVDAQTPGSLIVLAILMYSAQQYGDFSGGIDMVEGVSELFGVH
FT                   MAPNFRRPYFSTSLADFWRRWHISLGQWMRDYVFYPFALTAPMKRLGKWSSARLGRHVG
FT                   RTLPACVANVLVFLIVGIWHGADLHFVVWGLYNGLVIALSDLLRPAFDHLVGALRVDRE
FT                   GRPWHVFAVLRTFAVVNVGWYFDRIEDFGTSVLCLKSTLLNFDPAGLGPSLAALGLKPG
FT                   ERMQIMLAFVAIVVVFAQSLQEERRGHATQSCVAEDFLARPVLVRGATVVTLGLLVLSS
FT                   FVFNVGGGFMYANY"
FT   gene            564390..565541
FT                   /locus_tag="Olsu_0508"
FT   CDS_pept        564390..565541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0508"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR013830; KEGG: shi:Shel_17210 Y_Y_Y
FT                   domain-containing protein; SPTR: C2D866 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67623"
FT                   /db_xref="GOA:E1QZ09"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ09"
FT                   /protein_id="ADK67623.1"
FT                   /translation="MRITRAKARVVGGSGRRGGLTPARLLGVMAWCALLVLVDVAATLA
FT                   LGQYGSLSAVAVDDFGSAPSVGTAFVGSSFAERAFDPMSFDDARQEEDATAAQDSYNLS
FT                   TPGQTMGATGDAVSYAIQRGARRVVLGLGVETMCCYADARSDVPYYLARYEREPLTLVG
FT                   RLASVALDPDVVGSKDSLNVLFPWIFTTIKHVPSVGQNLRSRLSGEARSAAAEKVVRDW
FT                   RYAGRGYGNFTMQLDLSNPRTSVNTYGEPRQDPRCLEALARIADECRSAGVQLVVVSTP
FT                   HPAYDTVAFGDAYPEIMGAVQRVAQEHGATYLDFNMARDGVLDLSPEDYGDFEHLGPEG
FT                   ARRFSRLLAQMLSRIDEGADASSDFYGYDDWSQWLAGHQGWRV"
FT   sig_peptide     564390..564530
FT                   /locus_tag="Olsu_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            565545..567074
FT                   /locus_tag="Olsu_0509"
FT   CDS_pept        565545..567074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0509"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="COGs: COG1020 Non-ribosomal peptide synthetase
FT                   modules and related protein; InterPro
FT                   IPR020845:IPR000873:IPR010071; KEGG: shi:Shel_17200
FT                   non-ribosomal peptide synthase; PFAM: AMP-dependent
FT                   synthetase and ligase; SPTR: C2D865
FT                   Long-chain-fatty-acid--CoA ligase; TIGRFAM: amino acid
FT                   adenylation domain protein; PFAM: AMP-binding enzyme;
FT                   TIGRFAM: amino acid adenylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67624"
FT                   /db_xref="GOA:E1QZ10"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ10"
FT                   /protein_id="ADK67624.1"
FT                   /translation="MHNVLEWLERSAARAPDKVAVAGPQDHLTFAQLAEGSRRVGSWLA
FT                   AHGMSSRRGVAFYLEKSPSALSGMLGAVFAGGFYSVLDVRQPAARIQSICATLDPLVVV
FT                   ADDANLAAAREALEATAWEVVPLGELLSAPEDAALLSAARAQATDVDPLYVNFTSGSTG
FT                   TPKGVVVSHRSVIDFIPTFVRTFGMGEDDVFANQAPFDFDVSVKDIYSCLLLGARLQLV
FT                   PRPYFTAPTTLMDYLADTHATTLVWAVSALCFVSIMNAFDYRVPKDVRRVLFSGEVMPP
FT                   KQLSRWRAHLPDVTYVNLYGPTEITCNCTYYVVDRDFGKGEAIPMGRPFDNERVFLLGE
FT                   GEREVTPDMVGVEGEICVAGTALGLGYLGDAGRTGEAFVQNPLERRWLDPIYRTGDLAR
FT                   YDSAGNLVYSSRKDHQIKHLGQRIELGDIESTAAALAGVDQAACTYDARRKKIHLFYVG
FT                   EASHEEVALSLRAQLPSYMAPNGIHALEAMPLTKNGKVDRSLLAEQTTSRL"
FT   gene            567090..568295
FT                   /locus_tag="Olsu_0510"
FT   CDS_pept        567090..568295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0510"
FT                   /product="Orn/DAP/Arg decarboxylase 2"
FT                   /note="COGs: COG0019 Diaminopimelate decarboxylase;
FT                   InterPro IPR000183:IPR009006; KEGG: shi:Shel_17190
FT                   diaminopimelate decarboxylase; PFAM: Orn/DAP/Arg
FT                   decarboxylase 2; SPTR: C2D864 Possible diaminopimelate
FT                   decarboxylase; PFAM: Pyridoxal-dependent decarboxylase,
FT                   C-terminal sheet domain; Pyridoxal-dependent decarboxylase,
FT                   pyridoxal binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67625"
FT                   /db_xref="GOA:E1QZ11"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ11"
FT                   /protein_id="ADK67625.1"
FT                   /translation="MASGLATAELLDIAREFGTPTYLFDLVALSARLAAVREILGPSVR
FT                   LCYSIKANPFLSRAAAECGYELEVCSPGELDVCRGLGIEAPAIVYSGVCKGEADVRAAL
FT                   DYGVGVLTAESPRQFELVEQEARRRGLRVPVLLRLNGGSQFGMSRGDLERIVRDREGYG
FT                   AAELVGIHYFVGTQRRKLQHQRRELQMLCDLADELERRCGWRPVRLEYGPGLAVPYFEG
FT                   EDFSDTLAPARELAGDLQAVAGRFDLTVEMGRFLASSCGSYLTSVVDLKDGQDDETCYA
FT                   FVDGGINHVNYLGQMMGLKLPVIRNASVEGGSGGPLSRERRPWTLCGSLCTTNDVLVRQ
FT                   LDRPLAPDDVLVFENIGAYSVTESMYLFLSRAMPRVILRRGRGDYVLARDVVQTSMLNM
FT                   PS"
FT   gene            568422..568667
FT                   /locus_tag="Olsu_0511"
FT   CDS_pept        568422..568667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR009081; KEGG: shi:Shel_17180
FT                   hypothetical protein; SPTR: C2D863 Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67626"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ12"
FT                   /protein_id="ADK67626.1"
FT                   /translation="MDDITLDAVIEMLSGIRDDVDFATATGLVDDRVLDSFDILSVISA
FT                   IDEEFDVAVPAKDIVPDNFNSAEGIYHMVRGLADAE"
FT   gene            568770..570047
FT                   /locus_tag="Olsu_0512"
FT   CDS_pept        568770..570047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0512"
FT                   /product="O-acetylhomoserine sulfhydrolase"
FT                   /EC_number="2.5.1.49"
FT                   /note="COGs: COG2873 O-acetylhomoserine sulfhydrylase;
FT                   InterProIPR000277:IPR006235:IPR015424:IPR015421:IPR 015422;
FT                   KEGG: ele:Elen_0295 O-acetylhomoserine/O-acetylserine
FT                   sulfhydrylase; PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; PRIAM:
FT                   O-acetylhomoserine aminocarboxypropyltransferase; SPTR:
FT                   C4F806 Putative uncharacterized protein; TIGRFAM:
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism PLP-dependent enzyme; TIGRFAM: OAH/OAS
FT                   sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67627"
FT                   /db_xref="GOA:E1QZ13"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ13"
FT                   /protein_id="ADK67627.1"
FT                   /translation="MPQIDTLCVQAGYAPGDGEPRQLPIVQSTTFKYDTSEHMGRLFDL
FT                   EAEGYFYTRLQNPTNDAVAAKICRLEGGSAAMLTSSGQAANFFALFNIAEAGDHVVASS
FT                   AIYGGTYNLLAHTMSKMGVRVTFVSPTCTDEELAAAFEPNTKAVFGETIANPALAVLDI
FT                   ERFARAAHGHGVPLVVDNTFPTPVNCRPIEWGADIVTHSTTKYMDGHGCAVGGAIVDAG
FT                   RFDWMAHAESFPGLTTPDESYHGIVYAERFGLGKAFITKATSQLMRDFGSIQSPQNAFY
FT                   LNLGLESLHVRMSQHCRNGQAMAEFLAASPKVTTVSYPGLSGDAYHGLAQKYLPHGSCG
FT                   VVSFEVAGGRAAAERFMAALGLCAIETHVADARSCCLHPASSTHRQMSDAELAAAGISP
FT                   ALVRLSCGLEGTADLIADVEQALAQV"
FT   gene            570106..570696
FT                   /locus_tag="Olsu_0513"
FT   CDS_pept        570106..570696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q650X8 Putative
FT                   uncharacterized protein OSJNBa0042B15.25"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67628"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ14"
FT                   /protein_id="ADK67628.1"
FT                   /translation="MQRDALVRVQATGSYGSVFSVGEDGVCEVGLIDPVADDYSLKLPQ
FT                   LTLEELPWPPAGAEAALIERLALFHLRVRRGMDVDHAFEVYLGRNEGGDLELWFAPGAS
FT                   RAERCVTLDECGEGLVREALVGLRLDAWRSGGGATPSLGSWSWSAEVIGDGMGMAGYGR
FT                   AVAAEGLAGVVAALARLGLPVECAPGDGPRACL"
FT   gene            570687..571097
FT                   /locus_tag="Olsu_0514"
FT   CDS_pept        570687..571097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0514"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="COGs: COG2827 endonuclease containing a URI domain;
FT                   InterPro IPR000305; KEGG: ccu:Ccur_13970 predicted
FT                   endonuclease containing a URI domain protein; PFAM:
FT                   Excinuclease ABC C subunit domain protein; SPTR: C7MLC3
FT                   Predicted endonuclease containing a URI domain protein;
FT                   PFAM: GIY-YIG catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67629"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ15"
FT                   /protein_id="ADK67629.1"
FT                   /translation="MSVASGSEVGAAEPSYFVYVLRCEDGSLYTGITTDVVRRLCEHLT
FT                   RSARAARYTRTHPVVALEGLWELSGRSAASRLEWHLHHLSRPGKLALLARPEDVGGGAG
FT                   VIGASGRKELWERAMARKSQTERCEGWSPCSR"
FT   gene            571085..572386
FT                   /locus_tag="Olsu_0515"
FT   CDS_pept        571085..572386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0515"
FT                   /product="Protein of unknown function DUF2130"
FT                   /note="COGs: COG4487 conserved hypothetical protein;
FT                   InterPro IPR019219; KEGG: ele:Elen_1799 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2130; SPTR:
FT                   C8WI23 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized protein conserved in bacteria (DUF2130)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67630"
FT                   /db_xref="InterPro:IPR019219"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ16"
FT                   /protein_id="ADK67630.1"
FT                   /translation="MFEIECPKCHTVFEEDESKFAHIVRQVRDREFQKELDAQVRLMEE
FT                   ARRLAVAEAEARGRAAAQEGVAGKDRRIAELEARLEGMEQRMDAQRAQLEGQAKLAVSQ
FT                   ATAALEHERDDFRHRAELADLDRRRLEQSLAEQRREATRQVEQAIQMKNDEIEQIKSFQ
FT                   SKLTIKMVGESLEQHCEIEFNKWRSAFPLARFGKDNTAVEHSKGDYVFRDFDEEGVEYL
FT                   SVMFEMKNEEDQSTNRRRNQDHFDKLDRDRRNKGCEYAVLVSTLERDNEFYNQGIVDVS
FT                   AISGHERMYVIRPQFFIPLLTFLQSVAKGTLDYRRQVRRLQDESIDIAYFNQALGEFKE
FT                   GFGKDYEHASKKLAGAIDGIDRAIKQLEAIKESFRLTETHLSRASRKAEDLTIKRLTRH
FT                   SPLLSERFSELGKEPPAPGLGEAVEPDSVEGPVE"
FT   gene            complement(572405..573499)
FT                   /locus_tag="Olsu_0516"
FT   CDS_pept        complement(572405..573499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0516"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shi:Shel_12980 hypothetical protein; SPTR:
FT                   C7N5Z0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67631"
FT                   /db_xref="GOA:E1QZ17"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ17"
FT                   /protein_id="ADK67631.1"
FT                   /translation="MPPTSSEQTMSLKTPSSREDSCDSEQESQTFCDTDVPSPDAAPDA
FT                   KAGNPSEEPVGDGPSDADEPGEDPLPGEEVPAEDAPGEGPSAETPAEAPTGGTREGDEQ
FT                   PSDGEREGLGTITTDVIAPLPLDPRKNARREQEGWYRDHRVIYFIGGIALICLVAAFSA
FT                   MGSCGKGFHDPQADIVKSQVAAAASKQGKAADDPGDDSSAADATTDESKPAADESDAEK
FT                   AVHATLKGYYDKLKDYDGQVTKAEETYAGTYSNRDHAVREAARQEALTLTSTIQADLDA
FT                   LNAAGITDGSSYHAQLLLVAQCYQDLVTRMGTINDSWSRCVLYNYPDYYPDELMELVNG
FT                   SKASGSDQPAAKVDFDAAYAQIAL"
FT   gene            complement(573710..575113)
FT                   /locus_tag="Olsu_0517"
FT   CDS_pept        complement(573710..575113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0517"
FT                   /product="PASTA domain containing protein"
FT                   /note="COGs: COG2815 conserved hypothetical protein;
FT                   InterPro IPR005543; KEGG: ccu:Ccur_03300 serine/threonine
FT                   protein kinase; PFAM: PASTA domain containing protein;
FT                   SMART: PASTA domain containing protein; SPTR: C2D861
FT                   Putative uncharacterized protein; PFAM: PASTA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67632"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ18"
FT                   /protein_id="ADK67632.1"
FT                   /translation="MSNEFGTGEQSDQSPSGSSKQGGTSRQAPKHLTPKAEPTGKSVPT
FT                   DEPPLAGKLSFTAKPVPADGDTAGPTPRTANPRPADGPASDPAERQGLIFDGLDVPADQ
FT                   VPPVIDAPAVPGVPKIPIEPPVPDASVGPSSLRDSLATESSPAMEAPPAPDASDASDAG
FT                   VRDVRAVPGGRGASVPSVAEAPDVPEPRSDLYVPATYRDPQPEATPPVEAIRHMPFWMR
FT                   GALTAVMAAALVSALILTRGFGLLAGKTLPNVVGYSEQDASSLLKSEGYSVKIEEQETQ
FT                   VVNDGGKVIATNPVASEQVPAGAIIVLKVGHVGIETREVPALVGLTEREAVDQIGASAF
FT                   FVKDDITYTHSNTVEEGHIISQGPVAGSLRTMGTKIDLVVSMGPSSSDDEDEGGLTSIS
FT                   VPDVTGMDYDDALVLLEGMGLTVERGEDVATDILANGTVAQVDPPVNTDVRVGGTVVVH
FT                   MAVPTGTNR"
FT   gene            complement(575638..577128)
FT                   /locus_tag="Olsu_0518"
FT   CDS_pept        complement(575638..577128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0518"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="COGs: COG0554 Glycerol kinase; InterPro
FT                   IPR018483:IPR018484:IPR018485:IPR005999; KEGG:
FT                   shi:Shel_21570 glycerol kinase; PFAM: Carbohydrate kinase,
FT                   FGGY-like; SPTR: B9CMN1 Glycerol kinase; TIGRFAM: glycerol
FT                   kinase; PFAM: FGGY family of carbohydrate kinases,
FT                   N-terminal domain; FGGY family of carbohydrate kinases,
FT                   C-terminal domain; TIGRFAM: glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67633"
FT                   /db_xref="GOA:E1QZ19"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ19"
FT                   /protein_id="ADK67633.1"
FT                   /translation="MEGRYVIALDQGTTSSRAILVDRAGSMVDCVQRSYPQIYPQPGWV
FT                   EHNPQEILYSQLGALNELVVRHGLVTGDVAAIGIDNQRETTIVWDPTTGEPIANAIVWQ
FT                   CRRTAALVEELCGGEDVRCMVQRKTGLLPDAYFSASKIRWLLDSVAGARERAQAGELLF
FT                   GTVDSWLVWVLTGGLVHATDATNASRTMLYNIHEGRWDQELLRLFDIPMQMMPEVRPSA
FT                   AYFGETSYPGVPAGIPICGVAGDQQAALFGQCCFEPGQAKNTYGTGCFLLMHTGAEAAL
FT                   SHNNLVTTVVATPPGCDRTEYALEGSVFVAGALVQWLRDELHLIRNAEDSEFLARGVDD
FT                   TGGVYIVPAFTGLGAPWWQPDARGLICGITRGTTTAHLVRAALEALAYQTVDLVRAMEA
FT                   DAGVSLATLNVDGGASRNDFLMQFQADVLRSEIRRPKSVETTALGAAYLAGLTSGFWAG
FT                   TDELSALRATDDVYVPHMDEGRARALLAGWADAVRRTT"
FT   gene            complement(577132..578097)
FT                   /locus_tag="Olsu_0519"
FT   CDS_pept        complement(577132..578097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0519"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG2267 Lysophospholipase; InterPro IPR000073;
FT                   KEGG: ele:Elen_1032 alpha/beta hydrolase fold protein;
FT                   PFAM: alpha/beta hydrolase fold; SPTR: C8WPB6 Alpha/beta
FT                   hydrolase fold protein; PFAM: Putative lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67634"
FT                   /db_xref="GOA:E1QZ20"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ20"
FT                   /protein_id="ADK67634.1"
FT                   /translation="MGRWPIEFDSEDGRTRIRGFVWWDENPFRARRPLRPRGMVQLVHG
FT                   MAEHIERYDEFARSLVGAGYLVCGHDQLGHGRSCAPERHGCLPTHGGKDILVGDVERLR
FT                   QLVVGLCAPATPLFVFGHSMGSFVVRVYLSLYGDRVGGGIICGTGTVPAATSRVGGALA
FT                   RLVARVCGADHRSSLLHSLAEGAYGRAIEGARTDYDWLSHNRENVQRYLADDACGFAFG
FT                   AGGYATLADLTAEACSLECAQRVPHALPLLYVSGSEDVVGACGKGVQAAAGLARQAGST
FT                   DVVCTIYAGMRHEILNEDDRGIVYGDIRNWLDAHTNPEGV"
FT   gene            578670..579647
FT                   /locus_tag="Olsu_0520"
FT   CDS_pept        578670..579647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0520"
FT                   /product="multimeric flavodoxin WrbA fused to cytochrome
FT                   c-like domain"
FT                   /note="COGs: COG0655 Multimeric flavodoxin WrbA; KEGG:
FT                   bhy:BHWA1_02501 multimeric flavodoxin WrbA fused to
FT                   cytochrome c-like domain; SPTR: C1QEI5 Multimeric
FT                   flavodoxin WrbA; PFAM: NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67635"
FT                   /db_xref="GOA:E1QZ21"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ21"
FT                   /protein_id="ADK67635.1"
FT                   /translation="MSFKVMAVCAGRKGGNGEMLAKEALSAVRESGGGVELINLFDYRM
FT                   LPCTGCEGCTMQMGKMAAGLQREYHGCVLKGKDDVDAIITEMQTCQGIIFAVPTYDLTP
FT                   SSLYLRLAQRFLAYELSFLLAVGAVKENPHTVAGLIAVGGSKHDWQTLALEGMQATMFT
FT                   QSVQVVDRFMATRDGRPGNVALYDDQLPRARKMGENIARAINTPVEERGWLGDPNDGVC
FT                   PNCHSSLVYPGDEHWDGVQFPWECAVCGCGGTLGENPETGRPMLVIDPRNGRIRDRNDD
FT                   RARAEHLNEINKTRDDFFAHMDVVKPIMEKYRSMEFPTLVIDRG"
FT   gene            complement(579723..581348)
FT                   /locus_tag="Olsu_0521"
FT   CDS_pept        complement(579723..581348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0521"
FT                   /product="putative transcriptional regulator, PucR family"
FT                   /note="COGs: COG2508 Regulator of polyketide synthase
FT                   expression; KEGG: nth:Nther_1023 putative transcriptional
FT                   regulator, PucR family; SPTR: C5EG39 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67636"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ22"
FT                   /protein_id="ADK67636.1"
FT                   /translation="MELKELLVRLPEGSIADERYADATAEVYNLSFLTPHSVGLRPDVL
FT                   YFGDETLIPSNLSSDQLVNLVMFGCEGIPRHLKGHKASNVIVLSHEADPFACYNALQNY
FT                   FIEDIEVTNIVRRMLSAHFSNNGLQHLVEEASRALDNPILVVDSAYHYIASHLSDSPAA
FT                   TAGQRALDRQLQQELDFETILEPGVSYIRDAGLNQKVLRARRPLLHYHELLQCNTMISA
FT                   VTVHGICIAHVMMLARNHEFRETDTECFARLTLFVGQEMQKASLYETSQGQMESYFLVN
FT                   LLNDDQPSCAVIERRLKVLGWEPLPNLYVAVCESKSEDLTPHDLDHIASQLSGTMTASI
FT                   YASYEGRLVILFSRDAERPLGKYTEGSLREVAALNNLVVGVSNMFTDLTDIRNFYHQAL
FT                   AAIKFGELVSVFLDDRSVHHYRDYAYAQMLDITNHRANLLNFCHPALRRVMDYDQAHGS
FT                   ELMDTLFIYLQNSGNTRRSAKMLSLHKNTLLYRMGRIREILGCDLSSGEDCFMLQVSFR
FT                   VLLYLDLFKPRVHLDRSDLHKSDA"
FT   gene            581524..582156
FT                   /locus_tag="Olsu_0522"
FT   CDS_pept        581524..582156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0522"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="InterPro IPR009057:IPR001647; KEGG: bld:BLi02242
FT                   hypothetical protein; SPTR: B5CQX1 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67637"
FT                   /db_xref="GOA:E1QZ23"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ23"
FT                   /protein_id="ADK67637.1"
FT                   /translation="MRGAVKGGQPDVESRIEDAVFDLMEMTDIPDIRVNDVIRVASVSR
FT                   STFYRHYANVDEVVKLFEADILDSMRSINRDALNVRFGRSELDPTTTMVSRMKVLHDNR
FT                   KKIIALNGPHGDPQFVHKATVVMHDHFRARLRSVPGDATLRDLYLSFVIAGHNNLVQYW
FT                   LEVKPDVTPHQVAAMLNRLVYSAFFLDDESALAHPLSPSFGDEVGHA"
FT   gene            582410..583699
FT                   /locus_tag="Olsu_0523"
FT   CDS_pept        582410..583699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0523"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase; InterPro
FT                   IPR002155:IPR016039:IPR016038; KEGG: mka:MK1378 acetyl-CoA
FT                   acetyltransferase; SPTR: C5EG38 Acetyl-CoA
FT                   acetyltransferase; PFAM: Beta-ketoacyl synthase, N-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67638"
FT                   /db_xref="GOA:E1QZ24"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ24"
FT                   /protein_id="ADK67638.1"
FT                   /translation="MRVRLGKQARSVSIVGVGCTPFKNFEDHPETKGMSEGDAFGYAAL
FT                   EAVRDAGLQPRDVQYFYHGAANPFMIGDSLTPNMQVADWFGVRGIGSVHHSEACCTGYV
FT                   ALQEAVQAVASGSYDVVLSGAVDLAASLPVVGAPGCYRRDFPLEEMLPSIPMVYDRAYG
FT                   RPLDSAFGISFDNWINKYRWEFDLTDDQVDQALNGMSKSLRRDAVLNPLAFYTSDFDDA
FT                   AEANGLEGADAFLSSMFNPKVTQYLRVTGFETKCDGAAAVVVMPTEMAVARGLDHKVID
FT                   VLGTGAAAFEGATPDNEYNGTKAGAQQVYEYTGVRPDELDLLFVNDFFLAGDIVAAEEV
FT                   GYIPRGEAWRYAIDGRCGFDGDKPINTHGGRCNFGHAHGASGVADICEAVRQMRGEAGP
FT                   TQMPTVPRTTFLRGFGGGQNIRCQILRTHE"
FT   gene            583738..584208
FT                   /locus_tag="Olsu_0524"
FT   CDS_pept        583738..584208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0524"
FT                   /product="protein of unknown function DUF35"
FT                   /note="COGs: COG1545 nucleic-acid-binding protein
FT                   containing a Zn-ribbon; InterPro IPR002878; KEGG:
FT                   afu:AF0284 hypothetical protein; PFAM: protein of unknown
FT                   function DUF35; SPTR: C5EG37 Predicted protein; PFAM: DUF35
FT                   OB-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67639"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ25"
FT                   /protein_id="ADK67639.1"
FT                   /translation="MLLEDMEPIAKKFYDGVAEGKYLGRKCVECGAIEFPPHLGCNACG
FT                   CADTEWVELSGRGTLESFTVPGIQNDKPYLKSVEPYGYGKVRLDEGPEYTFVIFCGKKR
FT                   VVRGLQERLYKGHEEIRVHAMPIKRVTPLKPGSDETIEWYELCFQLDEAGEA"
FT   gene            584343..584582
FT                   /locus_tag="Olsu_0525"
FT   CDS_pept        584343..584582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0525"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="InterPro IPR006163:IPR009081; KEGG: hmo:HM1_2166
FT                   acyl carrier protein; PFAM: phosphopantetheine-binding;
FT                   SPTR: C5EG36 Predicted protein; PFAM: Phosphopantetheine
FT                   attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67640"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ26"
FT                   /protein_id="ADK67640.1"
FT                   /translation="MATQELFDQIAGFAKTAYQYDGDITADTTFDELGKGSMKMIALTS
FT                   TIENELDAEVTIHEVMKMKTFGELVERVEEEMED"
FT   gene            584719..585726
FT                   /locus_tag="Olsu_0526"
FT   CDS_pept        584719..585726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0526"
FT                   /product="Phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /note="COGs: COG0280 Phosphotransacetylase; InterPro
FT                   IPR012147:IPR002505; KEGG: shi:Shel_11220
FT                   phosphotransacetylase; PFAM: phosphate acetyl/butaryl
FT                   transferase; PRIAM: Phosphate acetyltransferase; SPTR:
FT                   C5EG35 Phosphate acetyltransferase; PFAM: Phosphate
FT                   acetyl/butaryl transferase; TIGRFAM: phosphate
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67641"
FT                   /db_xref="GOA:E1QZ27"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ27"
FT                   /protein_id="ADK67641.1"
FT                   /translation="MDLMESLRARAAADPQRVTFFEGDNPKMMRAVGELSSARLAKCCL
FT                   VGEAEALHRVAEEVGVDLGGIEVVDVCNEEANEAFACRFEQVPGCPWKPKVIRRHAKRP
FT                   MDRAFMMQRADETDVTFGGIDCSTGDVITAGQTIVGLADGVDVISSLGICNIPGWEGPE
FT                   GSLLGFGDAAVCIDPNPEQLASIAIASAETVRALLGWEPRVAMLSYSTDGSAESELVEG
FT                   VREAVGLARERRPDLKIDGEFQLDAAIRPDVAAKKVRRDSEVAGRANVLVVPNINVGNI
FT                   GIKLIQNFAHADAYGPLLQGFRKVVCDCSRSAPVSELVGNVIMSCVRSQALKEG"
FT   gene            585729..586847
FT                   /locus_tag="Olsu_0527"
FT   CDS_pept        585729..586847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0527"
FT                   /product="butyrate kinase"
FT                   /EC_number="2.7.2.7"
FT                   /note="COGs: COG3426 Butyrate kinase; InterPro
FT                   IPR011245:IPR000890; KEGG: gyc:GYMC61_0263 butyrate kinase;
FT                   PFAM: acetate and butyrate kinase; SPTR: C7IBL9 Butyrate
FT                   kinase; TIGRFAM: butyrate kinase; PFAM: Acetokinase family;
FT                   TIGRFAM: butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67642"
FT                   /db_xref="GOA:E1QZ28"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ28"
FT                   /protein_id="ADK67642.1"
FT                   /translation="MAEKSFRILVINPGSTSTKVGVFEGDREALARTVSHDASRLAEFE
FT                   GVSEQMPYRKETILAALEEGGIDLSTIDAFVGRGGGLMPLEGGTYEVNDVMLDHAFRGA
FT                   NGVQHPAQLGSLLVHGFAEEYGKRAFVVNPPDTDELCDEARMTGVRGVYRHVHLHALNL
FT                   KETAIRHACSLGRRYDECNFIVCHIGGGISVSAHEHGKMVDGFDIVEGEGPMAPTRCGG
FT                   LPVAGVLDYLEAGHATAEIRRACMKTGGFVDLLGTSDAIEVTERAARGDEAARRTWEAM
FT                   LYQINKCIASMAAVLRGKVDGILLGGGMVNSDELVQSVKGGCGWIAPVAAYPGEFELEA
FT                   MAAGAMRVLSGEEEPKVYTGVPVFQGFHCFED"
FT   gene            586915..588108
FT                   /locus_tag="Olsu_0528"
FT   CDS_pept        586915..588108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0528"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701:IPR016196; KEGG: dhd:Dhaf_1899
FT                   major facilitator superfamily MFS_1; PFAM: major
FT                   facilitator superfamily MFS_1; SPTR: C0CN25 Putative
FT                   uncharacterized protein; PFAM: Major Facilitator
FT                   Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67643"
FT                   /db_xref="GOA:E1QZ29"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ29"
FT                   /protein_id="ADK67643.1"
FT                   /translation="MTSEQKRYIVGIYAAAMCIMGMLVPVPILANIARSFPDANIATVQ
FT                   MCIGIIPLCMALSAMFLSSVLASRVLKRHTALACHILIMVAGLSVVAFHDSLAQVLCAS
FT                   VFVGIGIGGIQNGTDALIADYFEGEQRGSIMGVYSTFVALGGILWTALSGILGHDQWCM
FT                   AYAAYAAELPFIIVEFVCLPKGHLEPKPKGGNVLKSMPREVALITFISFVFVLCFQLFS
FT                   TNVSLIVADRGFGGTAESATASTVMTVAGIFAGLLVGPLFRRFKNRSMPLAWCVTIVGL
FT                   LAALLAPSLAALCAAGFVISLGKETYVPLQGNFAAGNSSNEGRAFNLAIGMAGTNFGMA
FT                   LSPLFFEVATAPFGAQIPQKFVLGIVIIAVLVAFGVVHYKSLTPAQLAEEKAHSAAK"
FT   sig_peptide     586915..587019
FT                   /locus_tag="Olsu_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            588327..588605
FT                   /locus_tag="Olsu_0529"
FT   CDS_pept        588327..588605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: apv:Apar_0311 hypothetical protein; SPTR:
FT                   B9CMN4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67644"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ30"
FT                   /protein_id="ADK67644.1"
FT                   /translation="MAGLHCTDCVYGSFCRNEDFDKFQGTCSRGFTLADPHVHTKPDMF
FT                   FAEVPERLVPIIDPFGKEYLRTKNICEQFTRPTQGTVKGKDVLGGRF"
FT   gene            complement(588652..589089)
FT                   /locus_tag="Olsu_0530"
FT   CDS_pept        complement(588652..589089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0530"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="COGs: COG1970 Large-conductance mechanosensitive
FT                   channel; InterPro IPR019823:IPR001185; KEGG: apv:Apar_0316
FT                   large conductance mechanosensitive channel protein; PFAM:
FT                   large-conductance mechanosensitive channel; SPTR: C8W9F9
FT                   Large conductance mechanosensitive channel protein;
FT                   TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: Large-conductance mechanosensitive channel,
FT                   MscL; TIGRFAM: large conductance mechanosensitive channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67645"
FT                   /db_xref="GOA:E1QZ31"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ31"
FT                   /protein_id="ADK67645.1"
FT                   /translation="MKKFMHEFREFVARGNVMDMAVGIIIGGAFTAIVTSLTSDVIQPL
FT                   IAIVSGGGTEVSGLDITVGANTISFSSFISAIINFLIIAFVVFCMVKALNKLQEQAARL
FT                   SGRQEGEVPATPTCPHCLEEVKAGATRCPHCGAGIPGGAKA"
FT   gene            complement(589246..589710)
FT                   /locus_tag="Olsu_0531"
FT   CDS_pept        complement(589246..589710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0531"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="COGs: COG1490 D-Tyr-tRNAtyr deacylase; InterPro
FT                   IPR003732; KEGG: ele:Elen_2503 D-tyrosyl-tRNA(Tyr)
FT                   deacylase; PFAM: D-tyrosyl-tRNA(Tyr) deacylase; SPTR:
FT                   C1XND8 D-tyrosyl-tRNA(Tyr) deacylase; TIGRFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase; PFAM: D-Tyr-tRNA(Tyr)
FT                   deacylase; TIGRFAM: D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67646"
FT                   /db_xref="GOA:E1QZ32"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ32"
FT                   /protein_id="ADK67646.1"
FT                   /translation="MRALVQRVSEASVAVGGEVVGQCGRGLVVLLGVGPNDDETSCRRL
FT                   WDKVRDLRVFDDADGRMNLALGAVGGGVLVVSQFTLYADCRRGLRPSFTGAANPQLGRR
FT                   LYDRFCALAERDVSHVGRGVFGADMQVSLVNDGPVTIWLDTDELSRRGVG"
FT   gene            complement(589715..591358)
FT                   /locus_tag="Olsu_0532"
FT   CDS_pept        complement(589715..591358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0532"
FT                   /product="Carboxypeptidase Taq"
FT                   /EC_number="3.4.17.19"
FT                   /note="COGs: COG2317 Zn-dependent carboxypeptidase;
FT                   InterPro IPR001333; KEGG: apv:Apar_0317 carboxypeptidase
FT                   Taq; PFAM: peptidase M32 carboxypeptidase Taq
FT                   metallopeptidase; PRIAM: Carboxypeptidase Taq; SPTR: B9CMP1
FT                   Carboxypeptidase Taq; PFAM: Carboxypeptidase Taq (M32)
FT                   metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67647"
FT                   /db_xref="GOA:E1QZ33"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ33"
FT                   /protein_id="ADK67647.1"
FT                   /translation="MADTNTTDDVGTLGARATGIDAGNDGDADAAGATAGAGVEPAVLI
FT                   NPKTDIAALAELERHLYAHRYAQIGIACYGSSIDPAAAAADRGEAQAILEEEDQALLCS
FT                   PETGAMLERLSLPHVAELLTPTQAAEVRVLKRDRSRLVDVPGEVQGAFTRLVSESDDVW
FT                   RRAKAANDWESFEPYLDRVVHQMVDIAGFRDPQRNPYDVWLDDFEHGTDRAFYDAFFAQ
FT                   VKGVVVPLLAEIASKGWQPDRSVIEGKFDEGRQWELARDLMDLEGLDKRTVFLTSTEHP
FT                   FSDALTTNYGIIAAHVYPEDVISNVFTMLHEGGHALYETGVDPSYDYTVLKGGTSSGIH
FT                   EAQSRFFENYVGRSRAFAPHLLAAMAKHFRGQLGRVTPNQFYQATNRAEGTPVRVEADE
FT                   LTYPLHILIRYEIEQELFSGEATAADVPTLWKQGYKDYLGVDVVDYAHGCLQDTHWADG
FT                   LFGYFPTYALGGAYGAQMRHRMIDEGMDFEGLLAQGDLSPISAWLKDRIWKYGRSKDPD
FT                   ELIASACGEPFDARYYTDYLVEKFSALYGL"
FT   gene            591527..592471
FT                   /locus_tag="Olsu_0533"
FT   CDS_pept        591527..592471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0533"
FT                   /product="ROK family protein"
FT                   /note="COGs: COG1940 Transcriptional regulator/sugar
FT                   kinase; InterPro IPR000600; KEGG: apv:Apar_0320 ROK family
FT                   protein; PFAM: ROK family protein; SPTR: B9CMP4
FT                   Glucokinase, ROK family; PFAM: ROK family; TIGRFAM: ROK
FT                   family protein (putative glucokinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67648"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ34"
FT                   /protein_id="ADK67648.1"
FT                   /translation="MAHVLGIDIGGTSIKAGLFAEGGRLLDVRQIPTGSLVCAEAFAGV
FT                   VTGLRELCSVNDVDEGDVRAVGLDVPGPVDDQGRVGMLPNIELDPDGLQDAIVSHFSGA
FT                   ALAFVNDANAAALGELWQGSAKGVGSFVLVTLGTGVGGGVVAGGHLVSGASGAAGEIGH
FT                   VTVNPEEERTCGCGRKGCLEQYASATGIVRLYRQELARRGIEGARVRHDTDTLTVFEAA
FT                   RAGDEAAVRAIDSMCDYLGFALAQISCVIDPEVFLIGGGVAGGFEQFSVRLSSAFRARC
FT                   LASCASTRILPCSLGNKAGMYGVAFAALQKAGE"
FT   gene            592649..594160
FT                   /locus_tag="Olsu_0534"
FT   CDS_pept        592649..594160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0534"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="COGs: COG1299 Phosphotransferase system
FT                   fructose-specific IIC component;
FT                   InterProIPR003353:IPR003352:IPR006327:IPR013011:IPR 013014;
FT                   KEGG: apv:Apar_0321 PTS system, fructose subfamily, IIC
FT                   subunit; PFAM: phosphotransferase system PTS
FT                   fructose-specific IIB subunit; phosphotransferase system
FT                   EIIC; SPTR: C8W9G4 PTS system, fructose subfamily, IIC
FT                   subunit; TIGRFAM: PTS system, fructose subfamily, IIC
FT                   subunit; PTS system, fructose-specific, IIB subunnit; PFAM:
FT                   PTS system, Lactose/Cellobiose specific IIB subunit;
FT                   TIGRFAM: PTS system, fructose-specific, IIB component; PTS
FT                   system, fructose subfamily, IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67649"
FT                   /db_xref="GOA:E1QZ35"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ35"
FT                   /protein_id="ADK67649.1"
FT                   /translation="MAEETYDIIAATGCPTGIAHTFMAKKALEDAAAAKGLTIKVETHG
FT                   QVGIENELTPAQIKAAKAVVIAADKDVNAERFEGKPLVSVGVSKCLSVEMAEGLIDRAL
FT                   AAKPEGELAEEVASASASDEGAEKESVGHVIYKHLMNGVSHMLVFVVAGGVLTAVSFLW
FT                   GITSFDSTAADYNSFAACLKIVGGIAMNLMVPVLAAYIAESIGKRPALVPGFVAGMIAI
FT                   QGLPVSPETGLIDAGGSGVGFGFLGGIVGGFLAGYVVLGLERLLSGMPKNLDGLKAIFL
FT                   YPLLSTFVVGLVMLGISGPMATINTAMMDFLKGLSDSGPVVLGLAIGCMCAFDMGGPVN
FT                   KAAYVTGTALLTEALTAGVGTDTYNFGTNFMAAVSAACIVPPLITTFAVIVGRKYFSQS
FT                   DHDAGIVNLILGCTHITEGAIPFMTKNIWPVMPIMMLGSSIAAILTIFFGVHDPAPHGG
FT                   FLVLPVVDGGLLWVIAILIGAVVGGILYTVFKASEYKRNGNKVVE"
FT   gene            594206..594658
FT                   /locus_tag="Olsu_0535"
FT   CDS_pept        594206..594658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0535"
FT                   /product="PTS system D-fructose-specific IIA component
FT                   (F1P-forming), Frc family"
FT                   /note="COGs: COG1762 Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type); InterPro
FT                   IPR002178:IPR004715:IPR016152; KEGG: apv:Apar_1119 putative
FT                   PTS IIA-like nitrogen-regulatory protein PtsN; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2; SPTR: C2D855 Putative uncharacterized
FT                   protein; TIGRFAM: PTS system, fructose subfamily, IIA
FT                   subunit; PFAM: Phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2; TIGRFAM: PTS system,
FT                   fructose subfamily, IIA component (TC 4.A.2.1.8)"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67650"
FT                   /db_xref="GOA:E1QZ36"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ36"
FT                   /protein_id="ADK67650.1"
FT                   /translation="MSDFVQASHVFLDNPAKTVDEALAFLSAQAVALGIAEDERAVLDA
FT                   FKAREAEGTTGMMEGFAIPHAKSEAIKQASVMVVKFAGDVEWESMDGKPIRVAIALCVP
FT                   GGEAGTTHLQLLSKVAVMLMDEKFRNETLADVDTASIAARINSGLD"
FT   gene            complement(594816..595736)
FT                   /locus_tag="Olsu_0536"
FT   CDS_pept        complement(594816..595736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0536"
FT                   /product="1-phosphofructokinase"
FT                   /note="COGs: COG1105 Fructose-1-phosphate kinase and
FT                   related fructose-6-phosphate kinase (PfkB); InterPro
FT                   IPR011611:IPR017583; KEGG: apv:Apar_0322
FT                   1-phosphofructokinase; PFAM: PfkB domain protein; SPTR:
FT                   C8W9G5 1-phosphofructokinase; TIGRFAM:
FT                   1-phosphofructokinase; PFAM: pfkB family carbohydrate
FT                   kinase; TIGRFAM: 1-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67651"
FT                   /db_xref="GOA:E1QZ37"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ37"
FT                   /protein_id="ADK67651.1"
FT                   /translation="MIYTLTPNPAIDMNVTADSVEKNVVSRTRDAVYTPNGKGLNVSFT
FT                   LQHFGIRAPILGFFGGFSGRYIIDGARGRACEAHPVMVDGITRINTFVTCGPDEYKFPS
FT                   AGCAVPRGRQLKMLELIDGLADLECLVVSGSLPPQIEPTFYDEVIHHVHARGAEVVLDT
FT                   SHARLAELVEKRPLLIKPNDEEVAAIFGVDVKSEADIVSALRLIHEHGCKNILLTLGER
FT                   GAYFYDGARVWRASAARVEVYSTACAGDATLASFLSLWFADRENVEGALRRAMATGGSV
FT                   AMCAGLGDFARVAELEGQIRVEVVA"
FT   gene            complement(595801..596652)
FT                   /locus_tag="Olsu_0537"
FT   CDS_pept        complement(595801..596652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0537"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /EC_number="4.1.2.40"
FT                   /note="COGs: COG0191 Fructose/tagatose bisphosphate
FT                   aldolase; InterPro IPR000771:IPR013785; KEGG: apv:Apar_1070
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II; PRIAM: Tagatose-bisphosphate aldolase;
FT                   SPTR: C8W7Q7 Ketose-bisphosphate aldolase; TIGRFAM:
FT                   ketose-bisphosphate aldolase; PFAM: Fructose-bisphosphate
FT                   aldolase class-II; TIGRFAM: ketose-bisphosphate aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67652"
FT                   /db_xref="GOA:E1QZ38"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ38"
FT                   /protein_id="ADK67652.1"
FT                   /translation="MLATTKEMLLDAQAGHYAVGAFNVENLEFVMAVIRAAEDRRSPVI
FT                   MQTTPGTVKYANLDYFAALCRVAAEEASVPVAIHLDHGDGFGRCVQAMHAGYTSVMIDG
FT                   SHVPFEENVALTASVTKVAGPVGIPVEAELGKVGGKEDDGPAVEGESPYTDPDQAEEFV
FT                   ARTGCSSLAVGVGTVHGIYKGTPHIEQGILSSIRERLDVPLVLHGTSGVPDDQVAEAIR
FT                   NGICKVNYATELRQAYTRGFMGYMEENPSCFDPKKPAAPGMDQIFAVVASHMDNLGSTR
FT                   KA"
FT   gene            597095..597892
FT                   /locus_tag="Olsu_0538"
FT   CDS_pept        597095..597892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0538"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="COGs: COG1349 Transcriptional regulators of sugar
FT                   metabolism; InterPro IPR001034:IPR014036; KEGG:
FT                   msm:MSMEG_1377 DeoR-family protein transcriptional
FT                   regulator; PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR; SPTR: A4E904 Putative uncharacterized
FT                   protein; PFAM: Bacterial regulatory proteins, deoR family;
FT                   DeoR-like helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67653"
FT                   /db_xref="GOA:E1QZ39"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ39"
FT                   /protein_id="ADK67653.1"
FT                   /translation="MALEARGSGLGIDERRAAILALLDRESTVRVSQLAQAFSVSRVTA
FT                   RGDLDALERAGKLRRTHGGAVSLSRQLTVSVQERRVNVNAGAKRAIAHEAARLVSDGES
FT                   LLLDSGTTALEFVRALSSHSSLTIVTADLTIAEYVDRSMPGCDVVLLGGLLRKAHRYTS
FT                   GPLALAALAGLRTDSAFLCPGAFAPERGFMTDYQSMAQLKHEMLHAAGRRYCLIDASKV
FT                   GAGGLMRFAGPGDFEAIVMDRDPDGIVAGQTEGLGVRLVLAQA"
FT   gene            598045..599214
FT                   /locus_tag="Olsu_0539"
FT   CDS_pept        598045..599214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0539"
FT                   /product="N-acetylglucosamine 6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="COGs: COG1820 N-acetylglucosamine-6-phosphate
FT                   deacetylase; InterPro IPR006680:IPR003764:IPR011059; KEGG:
FT                   apv:Apar_1061 N-acetylglucosamine-6-phosphate deacetylase;
FT                   PFAM: amidohydrolase; PRIAM:
FT                   N-acetylglucosamine-6-phosphate deacetylase; SPTR: C2D6Y2
FT                   Possible N-acetylglucosamine-6-phosphate deacetylase;
FT                   TIGRFAM: N-acetylglucosamine-6-phosphate deacetylase; PFAM:
FT                   Amidohydrolase family; TIGRFAM:
FT                   N-acetylglucosamine-6-phosphate deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67654"
FT                   /db_xref="GOA:E1QZ40"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ40"
FT                   /protein_id="ADK67654.1"
FT                   /translation="MSDYAVKADRFVLPGYVATGGYLVISGGVFGTWSAEAPEGMEVVD
FT                   RGGRWVVPGYVDTHIHGQADHDVMDCDAAGVNEASLALARRGTTSWTPTTLTQPRAQIT
FT                   SACASVYEASESRDDDFPGARIEGIYLEGPFFTERHCGAQNPAHMFDPSVEAFREWQEA
FT                   AHGLICKSALAPERKGSQEYCATLADLGVACVLGHSDASYEQALAAVAAGASCFVHTYN
FT                   GMSGLHHRDPGLVGAAMSTVGTYAEVICDGKHVLPGAVKALVDAKGWEHTVIVSDALAC
FT                   AGMPDGDYVLGDLPIRLGDDLAHLILEDDTMGSIAGSVTCVAQEVKNLVDWGIVTAEQA
FT                   VRMGSEIPARSAGVDDVCGLIRPGRCADFNVLGLDLTLEETYVGGVLVQ"
FT   gene            599362..600207
FT                   /locus_tag="Olsu_0540"
FT   CDS_pept        599362..600207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0540"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="COGs: COG0561 hydrolase of the HAD superfamily;
FT                   InterPro IPR013200:IPR006379; KEGG: apv:Apar_0157
FT                   HAD-superfamily hydrolase, subfamily IIB; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase type 3; SPTR: C2D6Y3
FT                   Possible HAD hydrolase; TIGRFAM: HAD-superfamily hydrolase,
FT                   subfamily IIB; PFAM: haloacid dehalogenase-like hydrolase;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67655"
FT                   /db_xref="GOA:E1QZ41"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ41"
FT                   /protein_id="ADK67655.1"
FT                   /translation="MAVKLILADIDRTILPEGERSVSARTVAAFHAARDAGIHVGPASG
FT                   RGHAWMPSLFGGDERCCETCIATNGNQVFLDGRKLREAHFDEESLAVVAACVRDIGGAG
FT                   LVAFDGATPVLVEGRLEDLEPIFPAYADACRSDGDGGPVGLSGLSATKANVFMGADGRR
FT                   ADERATRDLVAMLNRDIPGLDFDFPELGYVNVMPEGWNKASGIDCLVEALGISLDEVVV
FT                   FGDAGNDLSMFAHVPDSVAVANATEEAAAAARWHIGACRDDAVAAAIEALVRGEWPFVG
FT                   "
FT   gene            complement(600217..601392)
FT                   /locus_tag="Olsu_0541"
FT   CDS_pept        complement(600217..601392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0541"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro IPR000160;
FT                   KEGG: aeh:Mlg_2653 diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein;
FT                   SPTR: Q0A594 Diguanylate cyclase; TIGRFAM: diguanylate
FT                   cyclase; PFAM: GGDEF domain; TIGRFAM: diguanylate cyclase
FT                   (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67656"
FT                   /db_xref="GOA:E1QZ42"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ42"
FT                   /protein_id="ADK67656.1"
FT                   /translation="MRSPNRPGHEHLRTGWPPRRMPSTLRAILGAERLAPDERAALSAL
FT                   NFRCGAVLAAITMLMETYLTINNVLMSRHPRVVESVGRAWIAWHKAAYITMFLSAALLL
FT                   AGYLFKRRRGAMRTDSLSSHLIIGQFVVVAMAFGILISYGDLQRGNGLYAFFIQMVSIV
FT                   CIFAIRPVILIPGIALSYAIMLCLALQTDHLSHGTATNTLALGLVLIVACCVRYYTHIR
FT                   DIRLSSQLERYSYHDVLTGLRNARAFRHDIQGRHGQDVTIAVMDVNDFKSCNDRFGHET
FT                   GNRTLALLSASVSMELSHAERLYRVGGDEFVLLSPDMASDVTRRLTRGRRVFESNTSAD
FT                   GLLIGGQPLSFAFGCARGTIDGMADVVALTDQADAAMYRDKQKQGQGHGRE"
FT   gene            601870..604428
FT                   /locus_tag="Olsu_0542"
FT   CDS_pept        601870..604428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0542"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="COGs: COG4932 outer membrane protein;
FT                   InterProIPR008456:IPR008454:IPR019948:IPR019931:IPR
FT                   008970:IPR008966:IPR011252; KEGG: ccu:Ccur_13730 putative
FT                   collagen-binding protein; PFAM: Cna B domain protein;
FT                   Collagen binding domain protein; Gram-positive anchor;
FT                   SPTR: C7MLA1 Putative collagen-binding protein; TIGRFAM:
FT                   LPXTG-motif cell wall anchor domain protein; PFAM: Cna
FT                   protein B-type domain; Collagen binding domain; TIGRFAM:
FT                   LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67657"
FT                   /db_xref="GOA:E1QZ43"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ43"
FT                   /protein_id="ADK67657.1"
FT                   /translation="MLLKRLRYLLAVALAVGIVVVGGGRALAEPQSPRVELPNVVTNAH
FT                   VTTSTGTTPVNVGPWQAFKIHFHYVLPNLTVHEGDTTTIELPAGFRSAAPTDFVIKDGD
FT                   HIIARGKTDPTNTKYILTYTDYVEGKSDISGDFSVNAQIDSDVHTQSGVLPVNPVVSGE
FT                   TVPAGSVNYTVHVETALPIIKSGWANAFDTTKGVWQIKINQDGKEYTDAVLDDTLLTPG
FT                   VSIDPDSLEVFEGTWQLQGTSYKLVGQTDVTSQYLPQFISTGTTFKLGLGHIPASKGLL
FT                   VRFQTKISYTPLPGEKFENKGTLTDNGVSKESKAYYLLPTAGGTGEGYNYTINIKKTDE
FT                   MGAPLANAVFDIVRTRTGAVVGQVTTNASGEASLSGLLRDSYVIKETTPPSGYLAADDQ
FT                   AVIDTDFPLTTKSVTKTFVDKAAPTTVDVAVEKAWNDNGDQDGIRPSSVKVRLFADGAP
FT                   TSKIVTLDSAGSWKGSFTGLDQKDASGNDIAYTVEEDPVPLGYTSAVTGDAAAGYTVTN
FT                   SHDPETVDVPVEKRWVGPAGSEVTVRLLADGADTGRELRLNEGNGWRGSFDGLPRYDHG
FT                   REVAYAVTEAEVSGVDGSKYETSVEGNASDGFTITNVNTETVGVSGTKTWDDDNDRDGA
FT                   RPASITVNLMRDGARVLSRTVAPDASGAWAYSFAGLPRYADDGHEYAYTVTEEAVPNYA
FT                   TTIDGADITNSHTPGRTSVTVTKAWDDANDRDGLRPTSVEVQLYANGHELGAPVTLNAA
FT                   NGWAHTWTGLFMREAGKDVAYEVREVSVPRGYEASVSGDATAGYTITNAHVPKRVVKAA
FT                   TKAATGLPQTGDAAGAPALAALAASGLAVAAGALLRRREG"
FT   sig_peptide     601870..601953
FT                   /locus_tag="Olsu_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            604686..605300
FT                   /locus_tag="Olsu_0543"
FT   CDS_pept        604686..605300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0543"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ele:Elen_1602 hypothetical protein; SPTR:
FT                   C8WHH9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67658"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ44"
FT                   /protein_id="ADK67658.1"
FT                   /translation="MSITSKLSRVLTLACTAVLASTLMIGLTACSNDEQAIKDGISTEL
FT                   GAFKNPTKESLEPYVGQLSSSDLKELETYGIDIYEFLGHCFSKFDYSVGKVSASGDTAT
FT                   AELSLTNVDVQSAVKATSDEFQSSDMRDELAQIYTDGGETALIQKFFEMFYSKLDETTE
FT                   TVSNDVTVKLTKSNGSWTIDDDSLNDLVSAAYGGADFSSML"
FT   sig_peptide     604686..604778
FT                   /locus_tag="Olsu_0543"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            605734..606801
FT                   /locus_tag="Olsu_0544"
FT   CDS_pept        605734..606801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0544"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="COGs: COG0016 Phenylalanyl-tRNA synthetase alpha
FT                   subunit;
FT                   InterProIPR004188:IPR002319:IPR004529:IPR010978:IPR 006195;
FT                   KEGG: apv:Apar_1055 phenylalanyl-tRNA synthetase, alpha
FT                   subunit; PFAM: phenylalanyl-tRNA synthetase class IIc;
FT                   aminoacyl tRNA synthetase class II domain protein; PRIAM:
FT                   Phenylalanine--tRNA ligase; SPTR: C8W7P2 Phenylalanyl-tRNA
FT                   synthetase, alpha subunit; TIGRFAM: phenylalanyl-tRNA
FT                   synthetase, alpha subunit; PFAM: tRNA synthetases class II
FT                   core domain (F); Aminoacyl tRNA synthetase class II,
FT                   N-terminal domain; TIGRFAM: phenylalanyl-tRNA synthetase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67659"
FT                   /db_xref="GOA:E1QZ45"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ45"
FT                   /protein_id="ADK67659.1"
FT                   /translation="MAMSDDLRAIQAQVEQGVLGADTLDALDRIRVASLGKKGSLTAIM
FT                   RSMGKVPPEERPAMGQLANTVRANVQAAIEQRKLQLAKAALDAKISAEAADVTLPGRRL
FT                   APGTQHLISQIREEIEDIFCGLGYTIEDGPFVETTYYNFTALNAPEDHPSRSAKDTFYV
FT                   VDNAPEGKETHALGESDVLLRTQTSGVQVHVMETRKPPIYMVCPGTVFRPDTADANHLP
FT                   QFTQVEGLVVDEGITFGDLKGTLDYFCREIFGRDRATRYRPHFFPFTEPSCEVDVSCGV
FT                   CHGEGCRFCKNTGWLEILGCGMVDPNVLGYVGIDSERYSGFAFGIGVERVAALRYDLPD
FT                   LRMLMTGDMRFLRQF"
FT   gene            606872..609343
FT                   /locus_tag="Olsu_0545"
FT   CDS_pept        606872..609343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Olsu_0545"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="COGs: COG0072 Phenylalanyl-tRNA synthetase beta
FT                   subunit;
FT                   InterProIPR002547:IPR005146:IPR005147:IPR005121:IPR
FT                   004532:IPR020825:IPR016027:IPR009061:IPR012340; KEGG:
FT                   apv:Apar_1054 phenylalanyl-tRNA synthetase, beta subunit;
FT                   PFAM: B3/4 domain protein; t-RNA-binding domain protein;
FT                   tRNA synthetase B5; ferredoxin-fold anticodon-binding;
FT                   SPTR: C8W7P1 Phenylalanyl-tRNA synthetase, beta subunit;
FT                   TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit; PFAM:
FT                   tRNA synthetase B5 domain; B3/4 domain; Ferredoxin-fold
FT                   anticodon binding domain; Putative tRNA binding domain;
FT                   TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit,
FT                   non-spirochete bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Olsu_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADK67660"
FT                   /db_xref="GOA:E1QZ46"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:E1QZ46"
FT                   /protein_id="ADK67660.1"
FT                   /translation="MRVSYEWLKTMVDVPDDPHELVDEFVRTGTEVEAVERLGADIRGV
FT                   VTSQVLEKVPHPDSDHLFVCKMDVGACNVDADGKPVPLQVVCGAQNFEQGDKTVTALVG
FT                   ARLPGGIEIKRGKLRGIESLGMNCSSRELGLDGDHSGIMILPPDAPVGVDFTEYRGMCD
FT                   TVIDCEITPNRPDCLSMCGMAVEAAAVLDRDTHIELPAIKGESADFGRTADLVDVHIED
FT                   PELCGRYTARVVRGVKIAPSPEWLARRVIACGARPINNVVDVTNYVMFLTGQPLHAFDL
FT                   GKLGKRAGKRHIVVRAARKGELLTTLDGQERALTPDMTVITDDGKTPIALAGVMGGLDS
FT                   DIDEGTVDVLLESAVFDAGHISRTSRNLDLMSEASIRYERQVDGARCAIVSDVAAALFE
FT                   Q