(data stored in SCRATCH3701 zone)

EMBL: CP002107

ID   CP002107; SV 1; circular; genomic DNA; STD; PRO; 1193808 BP.
XX
AC   CP002107;
XX
PR   Project:PRJNA27713;
XX
DT   27-JUL-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Mycoplasma mycoides subsp. mycoides SC str. Gladysdale MU clone SC5,
DE   complete genome.
XX
KW   .
XX
OS   Mycoplasma mycoides subsp. mycoides SC str. Gladysdale
OC   Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
XX
RN   [1]
RP   1-1193808
RX   DOI; 10.1128/JB.00761-12.
RX   PUBMED; 22843585.
RA   Wise K.S., Calcutt M.J., Foecking M.F., Madupu R., Deboy R.T., Roske K.,
RA   Hvinden M.L., Martin T.R., Durkin A.S., Glass J.I., Methe B.A.;
RT   "Complete Genome Sequences of Mycoplasma leachii Strain PG50T and the
RT   Pathogenic Mycoplasma mycoides subsp. mycoides Small Colony Biotype Strain
RT   Gladysdale";
RL   J. Bacteriol. 194(16):4448-4449(2012).
XX
RN   [2]
RP   1-1193808
RA   Wise K., Calcutt M.J., Foecking M.F., Ramana M., DeBoy R.T., Roske K.,
RA   Gorton T.S., Durkin A.S., Glass J.I., Methe B.A.;
RT   ;
RL   Submitted (19-JUL-2010) to the INSDC.
RL   The J. Craig Venter Institute, 9704 Medical Center Dr., Rockville, MD
RL   20850, USA
XX
DR   MD5; 75d8d93fd3dcd99d2896ef5d1b7e18d6.
DR   BioSample; SAMN02603457.
DR   EnsemblGenomes-Gn; EBG00001189953.
DR   EnsemblGenomes-Gn; EBG00001189954.
DR   EnsemblGenomes-Gn; EBG00001189955.
DR   EnsemblGenomes-Gn; EBG00001189956.
DR   EnsemblGenomes-Gn; EBG00001189957.
DR   EnsemblGenomes-Gn; EBG00001189958.
DR   EnsemblGenomes-Gn; EBG00001189959.
DR   EnsemblGenomes-Gn; EBG00001189960.
DR   EnsemblGenomes-Gn; EBG00001189961.
DR   EnsemblGenomes-Gn; EBG00001189962.
DR   EnsemblGenomes-Gn; EBG00001189963.
DR   EnsemblGenomes-Gn; EBG00001189964.
DR   EnsemblGenomes-Gn; EBG00001189965.
DR   EnsemblGenomes-Gn; EBG00001189966.
DR   EnsemblGenomes-Gn; EBG00001189967.
DR   EnsemblGenomes-Gn; EBG00001189968.
DR   EnsemblGenomes-Gn; EBG00001189969.
DR   EnsemblGenomes-Gn; EBG00001189970.
DR   EnsemblGenomes-Gn; EBG00001189971.
DR   EnsemblGenomes-Gn; EBG00001189972.
DR   EnsemblGenomes-Gn; EBG00001189973.
DR   EnsemblGenomes-Gn; EBG00001189974.
DR   EnsemblGenomes-Gn; EBG00001189975.
DR   EnsemblGenomes-Gn; EBG00001189976.
DR   EnsemblGenomes-Gn; EBG00001189977.
DR   EnsemblGenomes-Gn; EBG00001189978.
DR   EnsemblGenomes-Gn; EBG00001189979.
DR   EnsemblGenomes-Gn; EBG00001189980.
DR   EnsemblGenomes-Gn; EBG00001189981.
DR   EnsemblGenomes-Gn; EBG00001189982.
DR   EnsemblGenomes-Gn; EBG00001189983.
DR   EnsemblGenomes-Gn; EBG00001189984.
DR   EnsemblGenomes-Gn; EBG00001189985.
DR   EnsemblGenomes-Gn; EBG00001189986.
DR   EnsemblGenomes-Gn; EBG00001189987.
DR   EnsemblGenomes-Gn; EBG00001189988.
DR   EnsemblGenomes-Gn; EBG00001189989.
DR   EnsemblGenomes-Gn; EBG00001189990.
DR   EnsemblGenomes-Gn; EBG00001189991.
DR   EnsemblGenomes-Gn; EBG00001189992.
DR   EnsemblGenomes-Gn; EBG00001189993.
DR   EnsemblGenomes-Gn; MMS_A0050.
DR   EnsemblGenomes-Gn; MMS_A0074.
DR   EnsemblGenomes-Gn; MMS_A0075.
DR   EnsemblGenomes-Gn; MMS_A0076.
DR   EnsemblGenomes-Gn; MMS_A0078.
DR   EnsemblGenomes-Gn; MMS_A0079.
DR   EnsemblGenomes-Gn; MMS_A0111.
DR   EnsemblGenomes-Gn; MMS_A0193.
DR   EnsemblGenomes-Gn; MMS_A0360.
DR   EnsemblGenomes-Gn; MMS_A0383.
DR   EnsemblGenomes-Gn; MMS_A0466.
DR   EnsemblGenomes-Gn; MMS_A0487.
DR   EnsemblGenomes-Gn; MMS_A0532.
DR   EnsemblGenomes-Gn; MMS_A0571.
DR   EnsemblGenomes-Gn; MMS_A0630.
DR   EnsemblGenomes-Gn; MMS_A0631.
DR   EnsemblGenomes-Gn; MMS_A0632.
DR   EnsemblGenomes-Gn; MMS_A0633.
DR   EnsemblGenomes-Gn; MMS_A0634.
DR   EnsemblGenomes-Gn; MMS_A0656.
DR   EnsemblGenomes-Gn; MMS_A0657.
DR   EnsemblGenomes-Gn; MMS_A0658.
DR   EnsemblGenomes-Gn; MMS_A0755.
DR   EnsemblGenomes-Gn; MMS_A0756.
DR   EnsemblGenomes-Gn; MMS_A0762.
DR   EnsemblGenomes-Gn; MMS_A0779.
DR   EnsemblGenomes-Gn; MMS_A0825.
DR   EnsemblGenomes-Gn; MMS_A0826.
DR   EnsemblGenomes-Gn; MMS_A0827.
DR   EnsemblGenomes-Gn; MMS_A0828.
DR   EnsemblGenomes-Gn; MMS_A0894.
DR   EnsemblGenomes-Gn; MMS_A0895.
DR   EnsemblGenomes-Gn; MMS_A0896.
DR   EnsemblGenomes-Gn; MMS_A0897.
DR   EnsemblGenomes-Gn; MMS_A0898.
DR   EnsemblGenomes-Gn; MMS_A0899.
DR   EnsemblGenomes-Gn; MMS_A0900.
DR   EnsemblGenomes-Gn; MMS_A0901.
DR   EnsemblGenomes-Gn; MMS_A0902.
DR   EnsemblGenomes-Gn; MMS_A1038.
DR   EnsemblGenomes-Tr; EBT00001768213.
DR   EnsemblGenomes-Tr; EBT00001768214.
DR   EnsemblGenomes-Tr; EBT00001768215.
DR   EnsemblGenomes-Tr; EBT00001768216.
DR   EnsemblGenomes-Tr; EBT00001768217.
DR   EnsemblGenomes-Tr; EBT00001768218.
DR   EnsemblGenomes-Tr; EBT00001768219.
DR   EnsemblGenomes-Tr; EBT00001768220.
DR   EnsemblGenomes-Tr; EBT00001768221.
DR   EnsemblGenomes-Tr; EBT00001768222.
DR   EnsemblGenomes-Tr; EBT00001768223.
DR   EnsemblGenomes-Tr; EBT00001768224.
DR   EnsemblGenomes-Tr; EBT00001768225.
DR   EnsemblGenomes-Tr; EBT00001768226.
DR   EnsemblGenomes-Tr; EBT00001768227.
DR   EnsemblGenomes-Tr; EBT00001768228.
DR   EnsemblGenomes-Tr; EBT00001768229.
DR   EnsemblGenomes-Tr; EBT00001768230.
DR   EnsemblGenomes-Tr; EBT00001768231.
DR   EnsemblGenomes-Tr; EBT00001768232.
DR   EnsemblGenomes-Tr; EBT00001768233.
DR   EnsemblGenomes-Tr; EBT00001768234.
DR   EnsemblGenomes-Tr; EBT00001768235.
DR   EnsemblGenomes-Tr; EBT00001768236.
DR   EnsemblGenomes-Tr; EBT00001768237.
DR   EnsemblGenomes-Tr; EBT00001768238.
DR   EnsemblGenomes-Tr; EBT00001768239.
DR   EnsemblGenomes-Tr; EBT00001768240.
DR   EnsemblGenomes-Tr; EBT00001768241.
DR   EnsemblGenomes-Tr; EBT00001768242.
DR   EnsemblGenomes-Tr; EBT00001768243.
DR   EnsemblGenomes-Tr; EBT00001768244.
DR   EnsemblGenomes-Tr; EBT00001768245.
DR   EnsemblGenomes-Tr; EBT00001768246.
DR   EnsemblGenomes-Tr; EBT00001768247.
DR   EnsemblGenomes-Tr; EBT00001768248.
DR   EnsemblGenomes-Tr; EBT00001768249.
DR   EnsemblGenomes-Tr; EBT00001768250.
DR   EnsemblGenomes-Tr; EBT00001768251.
DR   EnsemblGenomes-Tr; EBT00001768252.
DR   EnsemblGenomes-Tr; EBT00001768253.
DR   EnsemblGenomes-Tr; MMS_A0050-1.
DR   EnsemblGenomes-Tr; MMS_A0074-1.
DR   EnsemblGenomes-Tr; MMS_A0075-1.
DR   EnsemblGenomes-Tr; MMS_A0076-1.
DR   EnsemblGenomes-Tr; MMS_A0078-1.
DR   EnsemblGenomes-Tr; MMS_A0079-1.
DR   EnsemblGenomes-Tr; MMS_A0111-1.
DR   EnsemblGenomes-Tr; MMS_A0193-1.
DR   EnsemblGenomes-Tr; MMS_A0360-1.
DR   EnsemblGenomes-Tr; MMS_A0383-1.
DR   EnsemblGenomes-Tr; MMS_A0466-1.
DR   EnsemblGenomes-Tr; MMS_A0487-1.
DR   EnsemblGenomes-Tr; MMS_A0532-1.
DR   EnsemblGenomes-Tr; MMS_A0571-1.
DR   EnsemblGenomes-Tr; MMS_A0630-1.
DR   EnsemblGenomes-Tr; MMS_A0631-1.
DR   EnsemblGenomes-Tr; MMS_A0632-1.
DR   EnsemblGenomes-Tr; MMS_A0633-1.
DR   EnsemblGenomes-Tr; MMS_A0634-1.
DR   EnsemblGenomes-Tr; MMS_A0656-1.
DR   EnsemblGenomes-Tr; MMS_A0657-1.
DR   EnsemblGenomes-Tr; MMS_A0658-1.
DR   EnsemblGenomes-Tr; MMS_A0755-1.
DR   EnsemblGenomes-Tr; MMS_A0756-1.
DR   EnsemblGenomes-Tr; MMS_A0762-1.
DR   EnsemblGenomes-Tr; MMS_A0779-1.
DR   EnsemblGenomes-Tr; MMS_A0825-1.
DR   EnsemblGenomes-Tr; MMS_A0826-1.
DR   EnsemblGenomes-Tr; MMS_A0827-1.
DR   EnsemblGenomes-Tr; MMS_A0828-1.
DR   EnsemblGenomes-Tr; MMS_A0894-1.
DR   EnsemblGenomes-Tr; MMS_A0895-1.
DR   EnsemblGenomes-Tr; MMS_A0896-1.
DR   EnsemblGenomes-Tr; MMS_A0897-1.
DR   EnsemblGenomes-Tr; MMS_A0898-1.
DR   EnsemblGenomes-Tr; MMS_A0899-1.
DR   EnsemblGenomes-Tr; MMS_A0900-1.
DR   EnsemblGenomes-Tr; MMS_A0901-1.
DR   EnsemblGenomes-Tr; MMS_A0902-1.
DR   EnsemblGenomes-Tr; MMS_A1038-1.
DR   EuropePMC; PMC3416226; 22843585.
DR   EuropePMC; PMC3468273; 23071648.
DR   EuropePMC; PMC3569392.
DR   EuropePMC; PMC3570808.
DR   EuropePMC; PMC3711806; 23869216.
DR   EuropePMC; PMC4625578; 26516405.
DR   EuropePMC; PMC5447728; 28611743.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002107.
DR   SILVA-SSU; CP002107.
XX
CC   Mycoplasma mycoides subspecies mycoides is the etiologic agent of
CC   contagious bovine pleuropneumonia. The Gladysdale strain was
CC   isolated prior to 1964 in Australia and has been widely used as a
CC   reference strain. The source used for this project was a stock
CC   culture maintained in the Foreign Animal Disease Diagnostic
CC   Laboratory, USDA, APHIS, at the Plum Island Animal Disease Center,
CC   which was routinely used to induce and demonstrate acute pulmonary
CC   disease in cattle following tracheal inoculation. Consequently this
CC   represents an experimentally pathogenic strain. To minimize
CC   mutational heterogeneity in the genome sample, DNA was prepared
CC   from an axenic culture propagated from a single colony isolate from
CC   this stock (MU clone SC5). The genome, comprising a single circular
CC   chromosome, was sequenced to closure using the Sanger whole genome
CC   random shotgun method, yielding approximately 8-fold sequence
CC   coverage.
CC   On a macro scale, the sequence of the Gladysdale genome generally
CC   resembles that of Mycoplasma mycoides subspecies mycoides type
CC   strain PG1 (reflecting a non-pathogenic culture), but it displays
CC   many differences ranging from single nucleotide substitutions to
CC   duplication or transpositions involving large repeats, both known
CC   and previously unknown. This genome sequence and the clonal isolate
CC   it represents provide opportunities to examine pathogenesis and
CC   population dynamics on an experimental and genomic level.
CC   This project was supported by US Department of Agriculture ARS
CC   Project 1940-32000-039-08S at the University of Missouri and the
CC   Office of Science (BER), U.S. Department of Energy, Grant No.
CC   DE-FC02-02ER63453 to the J. Craig Venter Institute.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1193808
FT                   /organism="Mycoplasma mycoides subsp. mycoides SC str.
FT                   Gladysdale"
FT                   /sub_species="mycoides SC"
FT                   /strain="Gladysdale"
FT                   /mol_type="genomic DNA"
FT                   /clone="MU clone SC5"
FT                   /db_xref="taxon:865867"
FT   gene            161..1360
FT                   /gene="dnaA"
FT                   /locus_tag="MMS_A0001"
FT   CDS_pept        161..1360
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dnaA"
FT                   /locus_tag="MMS_A0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM PF08299; match to protein
FT                   family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69840"
FT                   /protein_id="ADK69840.1"
FT                   /translation="MLAIKQFRQTIKNEIKNILKEPVNISFTYEQEYKKQLEKDELIKK
FT                   DHSDIITKKVKKINENTFENFVIGASNEQAFIAVQTVSKNPGISYNPLFIYGESGMGKT
FT                   HLLKAAKNYIESNFSDLKVSYMSGDEFARKAVDILQKTHKEIEQFKNKICQNDVLIIDD
FT                   VQFLSYKEKTNEIFFTIFNNFIENDKQLFFSSDKSPELLNGFDNRLITRFNMGLSIAIQ
FT                   KLDNKTATAIIKKEIKNQNIKSEVTSEAINFISNYYSDDVRKIKGSVSRLNFWSQQNPE
FT                   EKIITIEIVSDLFRDIPTSKLGILNVKKIKEVVSEKYGISVNAIDGKARSKSIVTARHI
FT                   AMFLTKEILNHTLAQIGEEFGGRDHTTVINAERKIETMLKKDKQLKKTVDILKNKILTK
FT                   "
FT   gene            1522..2649
FT                   /gene="dnaN"
FT                   /locus_tag="MMS_A0002"
FT   CDS_pept        1522..2649
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dnaN"
FT                   /locus_tag="MMS_A0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69069"
FT                   /protein_id="ADK69069.1"
FT                   /translation="MNFSINRIVLLDNLSKAAKVIDYKNVNPSLAGIYLNVLSDQVNII
FT                   ATSGILSFKSILNNQNSDLEVKQEGKVLLKPKYVLEMLRRLDDEFVTFSMVEDNELIIK
FT                   TDNSDFSIGVLNSEDYPLIGFREKGIEFNLNPKEVKKTIYQVSVSMNENNKKLILTGLN
FT                   LKLTNNQAIFSTTDSFRISQKILEIQSNNNEDIDITIPFKTALELPKVLDNAENLKIII
FT                   VEGYITFIIDNVIFQSNLIDGKFPNVQIAFPTKFQTIITVKQKSILKVLSRFDLVADDG
FT                   LPAIVNIKVNEDKIEFKSFISEVGKYEEDFDDFVIEGNKSLSISFNTRFLIDAIKTLNE
FT                   DRIELKLINSTKPIVINNVYDEYLKQVILPTFLSN"
FT   gene            2686..3219
FT                   /gene="rnmV"
FT                   /locus_tag="MMS_A0003"
FT   CDS_pept        2686..3219
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rnmV"
FT                   /locus_tag="MMS_A0003"
FT                   /product="ribonuclease M5"
FT                   /EC_number="3.1.26.8"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM TIGR00334"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69914"
FT                   /protein_id="ADK69914.1"
FT                   /translation="MNKIKQIIIVEGKTDTDKLKSIYGNDLKTIQTKGLSLNKKTLEMI
FT                   EEFNNKMGVIIFTDPDGAGKKIRQTIIDYLDNKVLNAFIKKDDINKTSKKIGIAEASDD
FT                   AIKKALDNLIIYDKNNVSLSWTDYINNDFYLKSNRIVICKYFNFDNNISSKTLFKWLNW
FT                   MNVSIDDIKKIIGE"
FT   gene            3219..4019
FT                   /gene="ksgA"
FT                   /locus_tag="MMS_A0004"
FT   CDS_pept        3219..4019
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ksgA"
FT                   /locus_tag="MMS_A0004"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00398;
FT                   match to protein family HMM TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69185"
FT                   /protein_id="ADK69185.1"
FT                   /translation="MKAKKYYGQNFISDLNLINRIVDVLDQNKNQLIIEIGPGKGALTK
FT                   ELVKRFDKVVVIEIDQDMVEILKAKFDHSNLEIIQADVLEIDLKQLISKYDYEKISIIS
FT                   NTPYYITSEILFKTLQISDLLTKAVFMLQKEVALRICSNKNENNYNNLSIACQFYSQRN
FT                   FEFVVNKKMFYPIPKVDSAIISLTFNDIYKKQINDDKKFIEFVRILFNNKRKTILNNLN
FT                   NIIQNKNKALEYLNTLNISSNLRPEQLDIDEYIKLFNLVYTSNF"
FT   gene            4076..5167
FT                   /locus_tag="MMS_A0005"
FT   CDS_pept        4076..5167
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0005"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70049"
FT                   /protein_id="ADK70049.1"
FT                   /translation="MIRDFNNQEVTLDDLEQKNIETNKNKPKVQFLMRFSLVFSNIFTH
FT                   IFLLVLIVITSLFFGLRYTYYNYKVDLISNAHKIKPSIPKLKEVYKEALEVVEEIKRET
FT                   DKNSNDSLINKIDEIKAIVKEVTKFANEFNDRSKKVEPKVKEVIEDGKQVTTNLNKITK
FT                   EIEGLWKIGDSLTNRVRRSLNVFSALDSLANTANNDFRSVSESVTKITELAKKLSVEGE
FT                   KITTNVEIIKKEVDYFSKKSEIPLKNIEKLKEIYRQKLPIFERNNKKLQEIWDKLMGIF
FT                   NQFTVEKTESNYYNHLIYILLFLIIDSLALLVITYMSMISKTMKKILLFYIFGILSFNP
FT                   FVWVSVVISFLSRPIKNRKRKFS"
FT   gene            5527..7431
FT                   /gene="gyrB"
FT                   /locus_tag="MMS_A0006"
FT   CDS_pept        5527..7431
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gyrB"
FT                   /locus_tag="MMS_A0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69092"
FT                   /protein_id="ADK69092.1"
FT                   /translation="MSQEYSAESIKVLKGLEAVRTRPGMYIGSTSKTGLHHLVWEILDN
FT                   SIDEAMAGYADLINVTITKENEIIVQDNGRGIPVGINSDTKKSALSLVFTQLHAGGKFD
FT                   SESYKISGGLHGVGASVVNALSLYVEVEVYRNNIHYHQLFSEGGTKESELQQLGHTDLR
FT                   GTKVKFKPDPEIFKETVVFDYEVIKNKVKQLAFLNKGLKITLTDERIEKTVEYLFLNGI
FT                   LDYIKEKNETKNKINPNIFYVDSKYEDIEVEMALQYNSDYQENIITFVNNINTHEGGTH
FT                   EDGLKQALIRDINRYADTVIKNNKTPSKFSWDDIKEGMMCILSVRHTDPQYEGQTKTKL
FT                   SNPDAKEAVNIIIGNAFEEFLLKSPEDAKAILDKNVNAQKARIAAQKAREETRRKSALD
FT                   SFSLPGKLADCETKDSSIAELYLVEGDSAGGSAKTGRNRKFQAILPLRGKVLNVERVTE
FT                   ARAFSNNEIKSIITAIGTGIKEELDLSKLRYKKIVIMTDADVDGAHIRTLLLTFFYRYM
FT                   KPLVANGHIYIAQPPLYKIEAGKKIAYAYTDSQLDELKNNEFNNLKYTIQRYKGLGEMD
FT                   PLQLWETTMDPQQRTMLQISLEDATLANEVFSDLMGEDPELRKIYIQDNAKFVENIDF"
FT   gene            7447..9951
FT                   /gene="gyrA"
FT                   /locus_tag="MMS_A0007"
FT   CDS_pept        7447..9951
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gyrA"
FT                   /locus_tag="MMS_A0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69904"
FT                   /protein_id="ADK69904.1"
FT                   /translation="MNNENNNNDSLNENQDHYHGKISPIDISTEVRKDFLEYAMSVIVS
FT                   RALPDLKDGLKPVHRRIIYAMNDLGITSDKPHKKSARIVGEVIGKYHPHGDSAVYETMV
FT                   RMAQEFSYRYPLIDGHGNFGSIDGDGAAAMRYTEARLAKISNYLIKDIDMDTVPFIDNY
FT                   DASEHEPAYLTGYLPNLLVNGTMGIAVGMATSIPPHNLKEVVSAINAYIDNNDITIDEI
FT                   LNDHILGPDFPTGALMTNGSKMREGYKTGRGSVIIRAKIDFEENKKHDRFVVTEIPYQT
FT                   NKAKIIEKIAELVKDKTIEGIFDIRDESNYEGIRIIIELKKDANPDVVLSKLYKYTALQ
FT                   SSFSINLLTLNNNLPVLLDLKTIIKNYVEFQVSVIIKRSIFEKNKLTKRYHILEALHIA
FT                   LDNVDDVINIIKNSKTSEEAKVELTNKYNFDEEQNKAILDMRLQRLVGLERDKITLEMT
FT                   NIKERLTYLDVLINTKEEQDNVLKNQLNEIADKFGDNRRTELIDEELINIEDEELIPDL
FT                   KWMILLSQEGYIRRINPDEFRIQKRGGRGVSVNAEPSDPIDIATMGKAKDWVLFFTNSG
FT                   KVYRTKLYNIRSYSRTARGLPIVNFLNDLTSEDKITAILPLRNNKEKFNYLTFVTQKGM
FT                   IKRTKISEFENINRNGKKAINLRENDQLVSVFATTGQDTVFIANESGKVIRIKESVVNP
FT                   QSRVGGGVRALKLEDDDVVVGAISSFKLTHITTVSNKGLFKKTPIDDYRISGRNGKGIK
FT                   VMNLNQRTGKFKAIIGARETDLIMIISSDGNLIKTKVSNIPSLSRNASGVKAIRLTDNQ
FT                   EINAITLEYRKHGLENEDFEED"
FT   gene            complement(10002..10979)
FT                   /locus_tag="MMS_A0008"
FT   CDS_pept        complement(10002..10979)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0008"
FT                   /product="amino acid or sugar ABC transport system,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69437"
FT                   /protein_id="ADK69437.1"
FT                   /translation="MTILFNTSILTWALALVGVLLFASLSSLVSEKAGVVNIAVEGMMI
FT                   IGALVVSILGTYLTSNDNKSNYTQIPIVLLAGVITAVFALLHAFPAITLKANQIISGTA
FT                   INILALGLGIFLSTSNWFGKQSQVIASGYSSIDVINITKVVNGKTQQVASMLPIWTIIA
FT                   IILAIGLFVFFKYTKQGMRYAMVGENPNAIDAAGISVTKYRYLAVILSGFLAGIGGGVF
FT                   VVTAVSGGGLFSGNMLGYGFLGIAIMIFGQWRISFIVIGSIIFSWLFALGQQIGTLSTN
FT                   KTIQAISTLFNTLPFVLTILAMVAFSKTSRAPAAVGVPFDKAKR"
FT   gene            complement(10979..13546)
FT                   /locus_tag="MMS_A0009"
FT   CDS_pept        complement(10979..13546)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0009"
FT                   /product="amino acid or sugar ABC transport system,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70118"
FT                   /protein_id="ADK70118.1"
FT                   /translation="MQSKISWTLSKKSKYLFGSDSTKTKLKYIKGSFFSIIVGFIVSGI
FT                   FLSFLNINPFTYFALLFGINFDKNFYQISLNWMAVYIVAGLSMAIAFKAGVFNIGASGQ
FT                   ILTATSIATIIFFSISGKDASSISPFMIILMLITCIISAAFIAFIAGILKALFNIHEVV
FT                   STILLNWSVFYIFKWFFGKYKDFSSGLSYTSKNIPSDQLSIGSNTVIIPLLIALVCVII
FT                   IWILFSKTVLGFKLKAVGSSVTGSKYIGINVKKQIITSLTLSGAVAGIAGFLSMFTVSP
FT                   NNFFASNSLPTLGFDAIAVSLVAFNNPIGIIAIGWLWAILKTGGGPISSLYSISTQISG
FT                   LISGILIYFTAIVSVFITFKPWELLKNKYNLYTSKVNREIYWKLKLYTFKLRLKKIFLI
FT                   FTKDYKQEVNNKYQIYTKQNQITNKTSNPHLFWNGRKNIKTELKNDLKQSIYLVKSKID
FT                   EIKKFVDQDKNSLNVNGLKNDLNKQVNLLAYKYIQNLRDLDLELADHKYKIQKITSSIL
FT                   NEYQTNIKQAKKTHRLKIQQIKVFKESQIGIITYKFDSYNNIIEIKANKLKTIAQLKEQ
FT                   IKNIKSELRLEKQVSNLNKSSTQTNNSEKLEKIKQLKEQIKVVKKQANDKILEQKNKYK
FT                   NQKNIVKQEQVQLQDILHQYNNCLNKEKDCFKESKKAAFVLKQKRLQAIDMNLSQSDVN
FT                   KAVSLLNDLKTLITDNLDLNLNKQTIKSNQKTLKNALKIKFQIDEVLTQNIISEYDAPE
FT                   HIKQKSKISLTTFKLITNLKKQISYVITRVEEQELIDKYKQWISQAKQVVQDEKNNYEQ
FT                   IIKKAPRKNLADLENLFNLEKSLKEQTNLKILNLTNTMLKETK"
FT   gene            complement(13536..15152)
FT                   /locus_tag="MMS_A0010"
FT   CDS_pept        complement(13536..15152)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0010"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69103"
FT                   /protein_id="ADK69103.1"
FT                   /translation="MNKEQKVDYAIEMQNITKTFLNGAIVANDDITIKVKKGDIHALVG
FT                   ENGAGKSTLMSILFGLYQPTSGTIKVNGKEEVISNPIKANKLGIGMVHQHFKLVEVNTV
FT                   LENIILGVEQTKSNIFLNKTKMRAEIIEIMNKYDLYVDLDAKIQDISVGLQQRVEILKV
FT                   LYRKADILVFDEPTAVLTPQQIQSLLQIMKNLQKAGKTIIFISHKMDEIKQVANVATVI
FT                   RLGKKIVDLDVSEVSGNEIAEAMVGRKLVEVKNKYKKPLSDEPILDVINLTVKKSTNHK
FT                   VYGLETFNIKVRPGEIVAVAGVEGNGQRELIQTITGLVKPVSGGIIYKKINIVNSNIKT
FT                   RYDMGMSHIPEDRHKYGMLLDFSVEENIVSQEIDKKPFSSFGFINKKAISRYAQLIIKE
FT                   FDIRGSRNGTTIARGLSGGNQQKAIVGREIKKEHDLLIVIQPTRGLDVGAIENVHSHIL
FT                   KEKEKGRAILLVSYDLNEVIALADRIVVINEGKLIGELPAKKVKKEEIGALMIGQTLEQ
FT                   IKQNQITKTTKNRKEMKTNAI"
FT   gene            complement(15155..16807)
FT                   /locus_tag="MMS_A0011"
FT   CDS_pept        complement(15155..16807)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0011"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69975"
FT                   /protein_id="ADK69975.1"
FT                   /translation="MKKLLTVLTTLIGISGSVSMVISCKVPTFSEGILGQRVLVVTDGG
FT                   NIRDKTFNESSWEGVIKYGSQIHSNFDIKNELEARQFNYKSSIGGHTKWDEKQHMFINE
FT                   DYEYAKQNSNNYVETPDHTIDAFRTSYNTAIYKKADALLLAGFGHLGAVDYAADRMKKA
FT                   GNKTVVFLDAQYKKDNVISVIFNSELAGFNAGWDAIMWANLPKMTSLNSGEFSKEAIDA
FT                   SKSKTDMVLQGSTTGNKYISIGMFGGITNKNAVDNYMWGLLAAMHVYNNRFAGKEIELT
FT                   DNKQNKVKYKLQPVYYANLGSKAKVEKLNDVNESSWFSKGFDVGGAKKSGIVDSLIKNQ
FT                   ADIIFPVAGSQINDVLESTGHKPYVIGVDTDQVTSVGSSKKGNETRFITSAKKNIVSAS
FT                   VYALNRARSLQKAIIKDKTYTSKHEKEIKDGTTLVGEQADWSISSSRKADTKWSVEKVN
FT                   GSLTNAANLSVESIDYSIDKAKEIEKNLKETLLKSGETFKQYLTKKSLDKALESISKSI
FT                   KDEEWEKLTLNNNGIAGIKNYWEMLIQSTKQGA"
FT   gene            complement(16998..18527)
FT                   /gene="metG"
FT                   /locus_tag="MMS_A0012"
FT   CDS_pept        complement(16998..18527)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="metG"
FT                   /locus_tag="MMS_A0012"
FT                   /product="methionine--tRNA ligase"
FT                   /EC_number="6.1.1.10"
FT                   /note="identified by match to protein family HMM PF09334;
FT                   match to protein family HMM TIGR00398"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69443"
FT                   /protein_id="ADK69443.1"
FT                   /translation="MSKKFYITTPIYYPSGNLHLGHAYTTTLADILNRYKKEQGYETFF
FT                   LTGSDEHGQKIENKAKEANLTPLEYLNPKVQAFKDLWTKLNIDYDKFIRTTDDYHEKTV
FT                   QKIFTILLEKGYIYKGQYEGIYCVSCEEFLTNEQIDENGLCKISNTKPQLVNENTYFLK
FT                   VSQFQEFVQNILKSEFLIPEYRRNEMLKNFVEPGLKDLSITRVNFKWGIPITQDQKHII
FT                   YVWLDALSNYITALGYLQEDDSLFKKFWQNDDCEILQLAGKEIIRFHSIYWPVMLETLN
FT                   LKQPTHLLGHGWILNKNTKMSKSLGNIIDPVKIIELYSADALRFYIANDLPTEKDGNFS
FT                   LELFIESFNAHLANNVGNLISRTHNMISKYFNGYIDLNNIKYDQELIDLGIKTIDNYIF
FT                   NMDQYKISEAIKVVLELSNACNKYIEIKTPWNLEKENRIEELKTVLATLQRNIAIISYL
FT                   LKPVLVNSYTDMIEQSGLENVQINFSDLKTFSNIKFNKLNNKKVIFNRIKE"
FT   gene            18731..20377
FT                   /locus_tag="MMS_A0013"
FT   CDS_pept        18731..20377
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR03490"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69349"
FT                   /protein_id="ADK69349.1"
FT                   /translation="MKKATKLLLSILPISSISFLSVVSCSTRNSNAKQPDKKPEKPNEK
FT                   GPIIPKNPDNKKPTNNNNNSNNNSNSNNNKPGSTVPNENKDPSKSEETPEKPERDPKKP
FT                   DKQPQGDDPNNHQPHNNQHADQPNINKDEFADLDKLPKEISFERFDFYTSKDATTALSH
FT                   LRTDGSVIKIIFSNTHRNIFGKYNINLELDGNEKEDVKKGLIDKVKVKFTNKKDKKSKI
FT                   IEFTFTGFKVIQKSPDKENKNSKKNYIKKKEKIDNKLTGLYPSLVAYMIMYTQEPKNYK
FT                   NLMQKDSINFEELENNNPNLFADPEINLNVVALKDLLLEYNRELGKLYKDKVIAVSYDD
FT                   VNGKLGLKLLIENREENDTIASKYSETLEFDFVGFRKIDLKNPNKNVLSLLFPQNNFKD
FT                   MIKNNVFKKKIEVLKSGKQKEDMVLVKEEYAKQLIFKNLLVQIIDNENNLYRSTQTLSL
FT                   QNNKKDNYTSILGLAGGGTLYPFHTIINNNSIKNIYLMINKEKNKKYKVAINFEVDIPI
FT                   FASTTSDLTFHATSGDTNILKLDITTNALID"
FT   gene            20410..22008
FT                   /locus_tag="MMS_A0014"
FT   CDS_pept        20410..22008
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR03490"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69962"
FT                   /protein_id="ADK69962.1"
FT                   /translation="MKKATKLLLSILPISSISFLSVVSCSTRNSNAKQPDKKPEKPNEN
FT                   TPKTPSKPDESKQPDNNNTNPGDSNNGSNNPEIKPDPSENPQSDQPMDKPDEKIDKPSH
FT                   SDKPQADDSNNNRDIFSDLDKISKEISFETFSFYTQRDAVTALVDLQKDPSTIYTIFSK
FT                   DYKTIFDKYHIQFLANNEESANNEKGLIEKVKLKFTHKKFDQSKILDFIFTGFKKNEYT
FT                   SITNNKEKYITKREKVEKITDLFPSLIGYVLLYSQDHNQYKNLMEAKNVINFEDLENGN
FT                   SSLFIDKAPLLNVATIKDYLFEFNPELGKLYKEKITAVKYDDYNGILGVKLEIENRDFD
FT                   PKTTKEPIIEKEFVFDNFRKVNIKDNEKNPLSLFLTQDKFKEMTKSGLLKTKIQELRSS
FT                   NKLEKKELLQDKKIDFLKQQIFKNLLVDINDNSHNIYRSQSTLSLGSNKTYKSILGLAG
FT                   GFSIYPFHTSINKDSIKNIYLSINKDEENVHKAIIEFEVYIPVFSTGFSDLKSYATSGD
FT                   EKYLVLKIVQTTSIQ"
FT   gene            complement(22061..22921)
FT                   /locus_tag="MMS_A0015"
FT   CDS_pept        complement(22061..22921)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0015"
FT                   /product="putative transposase InsK for insertion sequence
FT                   IS150"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69834"
FT                   /protein_id="ADK69834.1"
FT                   /translation="MLKTHKKVKIPILLKIAKLPKSSFYEWKHKLENTIDKDKELKEMI
FT                   VDIFSKSFETYGHRRLKMALKSKGYIVNHKKILRLTKELGVQCIKFRTKNGRYSSYKGT
FT                   VGKIADNVLKRNFHSLQANKLWCTDVTEFKVNGQKLYLSPIIDLYNDEIISYSIQTNPN
FT                   LNLTNSMLDKALKNVKNTNGLLIHSDQGFHYQHISWAKKLEENNITQSMSRKGNCLDNA
FT                   IIENFFGLLKQEIYYGEKYNSVEELTKRIHKYIYWYNNIRIKEKLKGLSPVQFRKQSCY
FT                   NIEKF"
FT   gene            complement(22930..23472)
FT                   /locus_tag="MMS_A0016"
FT   CDS_pept        complement(22930..23472)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69390"
FT                   /protein_id="ADK69390.1"
FT                   /translation="MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRF
FT                   EAFRIEGLINKEKKPYYSAKLKLKIVLYKLETNHSYDEVAKKFNIIYSSTIAGWVKKYR
FT                   EYGFLGLNNNIGRPKKIMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEFWK
FT                   KFHTLLTKEKSTRKKQK"
FT   gene            complement(23548..24534)
FT                   /locus_tag="MMS_A0017"
FT   CDS_pept        complement(23548..24534)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0017"
FT                   /product="mannitol dehydrogenase C-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF01232;
FT                   match to protein family HMM PF08125"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70003"
FT                   /protein_id="ADK70003.1"
FT                   /translation="MNLIHFGAGNIGCGFIAPILSSIVDHIYFVDNNIDIVNKINTQKL
FT                   IKIHTSDSKKISITNISAWLLTDFINYKKTWNEVSLLTISIGIKNLKHIIYYVNQLIDY
FT                   KIKNNQKLIIMCCENGIRVSSLFKSYFSNLNNNIYFVDVLVDRIVSNKNILNDYLECED
FT                   YYLWIVDKTQLPSDFKQVPNLTYTTSFDIQITKKIYMLNALHCSLAWFVFKNFSFNKYL
FT                   YVYQALKNDKVVEFVNNYLNEVILVLNHKYNINLDELNNYKNQIIKRLNSNFIKDDLKR
FT                   LARNTELKLSKNERILTILDYAKDNNLKHDILLLSYQNGLEYLKNNK"
FT   gene            complement(24535..25332)
FT                   /locus_tag="MMS_A0018"
FT   CDS_pept        complement(24535..25332)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0018"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69527"
FT                   /protein_id="ADK69527.1"
FT                   /translation="MAIDLLTKIKDFIKTDCSQDYKNIGTYLLKNYTNIKNLTITAISK
FT                   ECNTSPNKITRFAEKLNLKGFNELKFRLNDISNSIIIDNELIPISSRIDDKAKFYNDYF
FT                   EILLNSIKQQQINLKTQPINEVVNLINKANKIYLFAFNLSYNVSKNFIQRLRWYQKDAI
FT                   SESDYISIKTYLNIIKPDDLVILITISGENEYIKKIAESLNKKVKIIGIGPKQSSMISL
FT                   FDKYLYFETDESELWSINSIKAQLVIQLLDFVYVKWLKSNKRK"
FT   gene            complement(25366..25794)
FT                   /locus_tag="MMS_A0019"
FT   CDS_pept        complement(25366..25794)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0019"
FT                   /product="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69531"
FT                   /protein_id="ADK69531.1"
FT                   /translation="MLETKNIYKKIYLNKTFNSKQECLDYLKELLKQENVSLEYIDSIN
FT                   KREEDCSFNIGSKIAIPHGIYEGMLSLKNSLIVVIHLQKPLIWDNSEVQLVIGLALKQE
FT                   DQIDMLQNIAINAMNDDLFNDLLKNPTIDKVISFCTKQ"
FT   gene            complement(25794..26552)
FT                   /gene="srlD"
FT                   /locus_tag="MMS_A0020"
FT   CDS_pept        complement(25794..26552)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="srlD"
FT                   /locus_tag="MMS_A0020"
FT                   /product="sorbitol-6-phosphate 2-dehydrogenase"
FT                   /EC_number="1.1.1.140"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69067"
FT                   /protein_id="ADK69067.1"
FT                   /translation="MKKVAIVAGGAKSLGKFLALGLDKNNYQVVVLDLNKEKLDQLKEE
FT                   NHQIDTFVCDLTNEKDVINVFNEIENKYKTIDTLVYNAGWAKSAKITSFEYQDFITSLK
FT                   INLDGYFLTAKQAAKIMIKNNTKGNIIQINSKSGRVGSKYNSGYSAAKFGGVGLTQSIA
FT                   LDLAEHNIRVNSLMLGNFLDSEMFEGLIPQYAKKLNIKESEVKQYYISKVPLKRGCSFE
FT                   DVLNVLLFYISEKASYCTGQSINITGGQVM"
FT   gene            complement(26552..28111)
FT                   /locus_tag="MMS_A0021"
FT   CDS_pept        complement(26552..28111)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0021"
FT                   /product="PTS system, Lactose/Cellobiose specific IIB
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69665"
FT                   /protein_id="ADK69665.1"
FT                   /translation="MNSKVQMTHKEWANKFKLKVQKTGSFMAGMIMPSIGVLLAWGLWT
FT                   AMFLYDFDHNKKLGWFDVPMLGRLVEPEIKWLLPILIAFNGGRLVYGLRGGMIATFIIV
FT                   ATITGTDHIYSHYIWQKVGDKWVHPGSPNQFIGAMIVGPLSALFLKKVEKLYLHKINPG
FT                   LEMLVKNFGLAIYAILLGLVVFWSWGWIMWGITFVMISIIKLFGDNKWVAPLLGFFTEP
FT                   IKVSFLNNALNHGVLGPIGYNEIQIQRSNGVANPRSIFFLYDPNPGPGLDLLLAYIIFT
FT                   KKEDRYNATASSLIHTIGGIHEVYFVFIIKKPKMLLATMLGVVGAQFITSYLGGGTIGT
FT                   PSPGSLISLIALSNGTHALLINLLSFVVGTLIAFGISVLLLLKNRKNLQSESNQGFKIT
FT                   DEGIEFNEQDLDQKTIKNNNDIKKIVVCCEAGVGSSAMAAGLIRKWVSNNNYDIQVSNI
FT                   AVKDLKDEYDIVITMKSFKDFASQKAPNALIYPVEQFIGKNTYDDLYELIENKKQKTKE
FT                   EK"
FT   gene            complement(28365..28565)
FT                   /locus_tag="MMS_A0022"
FT   CDS_pept        complement(28365..28565)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69224"
FT                   /protein_id="ADK69224.1"
FT                   /translation="MNLSSLEEDILNYCDKNQKISSLTELADEFDMSWITMQRTVKKLV
FT                   KKNILKRIGSNKTGYWIRIDK"
FT   gene            complement(28595..29206)
FT                   /locus_tag="MMS_A0023"
FT   CDS_pept        complement(28595..29206)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69046"
FT                   /protein_id="ADK69046.1"
FT                   /translation="MENDKLNNAGYYLFSKNKPLTVKLGKFLTDERITLIDDIRFEGNI
FT                   FECIDRSIEYILKNINQVYVYEDLRRVPRPEIPVKAIREIIVNSFVHMRITSGDYNEIS
FT                   IFPSEVRIYNPGHFPLNTIPANFAEGKISSKPMNPLIATTLYKNNLVENFGTGFQTVFS
FT                   LCDKYNIKYSYDISNFGFTFSFYRKKLMMSFWVFMKIVIV"
FT   gene            complement(29253..29744)
FT                   /locus_tag="MMS_A0024"
FT   CDS_pept        complement(29253..29744)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0024"
FT                   /product="divergent AAA domain protein"
FT                   /note="identified by match to protein family HMM PF04326"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69717"
FT                   /protein_id="ADK69717.1"
FT                   /translation="MFNRESEQVEFKKSAAELKEAVISLCAMLNKNGHGILYFGIKNDG
FT                   TIVGQQIGKTTTTDIANEIKNHIKPNIHPNVVVLKQDDLNYISIEVNGAERPYSAYGKY
FT                   YTRVDDQDQIIYNNELRKLFQTNEFTNLTWEKNNKVWRRWSWWKSFNKLCKKGIWSRKV
FT                   "
FT   gene            complement(30098..30325)
FT                   /gene="rpsR"
FT                   /locus_tag="MMS_A0025"
FT   CDS_pept        complement(30098..30325)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsR"
FT                   /locus_tag="MMS_A0025"
FT                   /product="ribosomal protein S18"
FT                   /note="identified by match to protein family HMM PF01084;
FT                   match to protein family HMM TIGR00165"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69292"
FT                   /protein_id="ADK69292.1"
FT                   /translation="MQVKKIKKRKKVNFFQKNNIKYIDYKDIELLKKFISPNGQILPRR
FT                   ITGTSPKDQRQLALAIKRARQMALLPYVIE"
FT   gene            complement(30345..30785)
FT                   /locus_tag="MMS_A0026"
FT   CDS_pept        complement(30345..30785)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0026"
FT                   /product="single-strand binding family protein"
FT                   /note="identified by match to protein family HMM PF00436;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69853"
FT                   /protein_id="ADK69853.1"
FT                   /translation="MNRVNLVGRITRDLELRVAKNGSKFVFFTVAVSEFSTKEEKTNYI
FT                   PCSAFDRTAENMVKYLSKGSLISVEGRITTRNNQTPDGKFETIVNVLAERVNFLEPAKN
FT                   RNNMTTEQNDNFTPNQPTQQNSDSSFDDLVVSDDDELSILWE"
FT   gene            complement(30797..31210)
FT                   /gene="rpsF"
FT                   /locus_tag="MMS_A0027"
FT   CDS_pept        complement(30797..31210)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsF"
FT                   /locus_tag="MMS_A0027"
FT                   /product="ribosomal protein S6"
FT                   /note="identified by match to protein family HMM PF01250;
FT                   match to protein family HMM TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69218"
FT                   /protein_id="ADK69218.1"
FT                   /translation="MIKKYEVMYILDQDVKDTKELVSKLDAILAENGKILESNDLGLLD
FT                   FTYEINHKKKGFYHVVIVEATTQAIKEFERIAKIDKNVVRTLVLNTENIQNYEQSVVLS
FT                   KTDMTKYEEEQREKKNFRKPFIKREEAAVKESK"
FT   gene            complement(31416..31625)
FT                   /locus_tag="MMS_A0028"
FT   CDS_pept        complement(31416..31625)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0028"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00313"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69700"
FT                   /protein_id="ADK69700.1"
FT                   /translation="MNTGIVKWFNDEKGFGFITNDSDNKDVFVYYSNINVNGYKTLEQG
FT                   QKVTYELNKGIKGLEAFNVSITNK"
FT   gene            31811..32410
FT                   /locus_tag="MMS_A0029"
FT   CDS_pept        31811..32410
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0029"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="identified by match to protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69643"
FT                   /protein_id="ADK69643.1"
FT                   /translation="MSKVLVLKTTAQADEVSNSVALTNRFLEEYKKFNPDDEIIIVDLN
FT                   KDEVGTSILTSETSSTFYQQEVTKKYINLLKSVDKLVIACPMYNFSTPVTLKSFIDHVS
FT                   VANETFSYKYSKKGDAIGLITNLKAQILGVQGAPLGWYPWGQHTQYVEGAMRFLGIDFN
FT                   KTVLLAGVKVAPLLQLTPEQRVETIIDEVIEAARTF"
FT   gene            complement(32447..33481)
FT                   /locus_tag="MMS_A0030"
FT   CDS_pept        complement(32447..33481)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0030"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69570"
FT                   /protein_id="ADK69570.1"
FT                   /translation="MAKDKKNTEVSINIEQIQPISKKDPDFEEIKSSKKSKKTKTIKSE
FT                   PVLLEKMDQREYIVIPNDQKFEPGIKGLKQKQKLQKQLTNKYSRDILNKGHIITTQDYK
FT                   PNLDKHIIELKNVQKSYITGDLETPVLKGIDIKLDKSDFIVILGPSGSGKTTFLNIISG
FT                   LDKASQGDVFVLGSNLSLLKDSHMTKFRRRAVGFVFQQYNLLTNLTAKENAEVGENLSS
FT                   KKNGMSIDEIFETIGMKDQMHKYPHQMSGGQQQRVSIARALAKNPDILFADEPTGALDE
FT                   EMGRKVLEILVKVNKEYKTTVIVVTHNPNIAKIANTVIHIKNGIIDNLEHNAHPADPQT
FT                   IEWS"
FT   gene            complement(33529..34395)
FT                   /gene="hslO"
FT                   /locus_tag="MMS_A0031"
FT   CDS_pept        complement(33529..34395)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="hslO"
FT                   /locus_tag="MMS_A0031"
FT                   /product="chaperonin HslO"
FT                   /note="identified by match to protein family HMM PF01430"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70054"
FT                   /protein_id="ADK70054.1"
FT                   /translation="MDLKIRAISNKHNLRISIVDISETIKEITDLQQSNTLANMVFFKF
FT                   ICCSTLIGMQFKNKEKTYVNWNAPNSLTKTMIAEYHDSKIRAYIQNKNVNIDNFNNKDL
FT                   NEIICLIASNTGDLIVSRDLNLKEPYVSNIEIEYGNIDYDFMKYFNQSNQTKSFITTEV
FT                   KFDDNLEIKKVVGILVEMLPNHTKEDLDYISEKLGNTSYVKDVLVKSTNYYAIVKEIDN
FT                   DATILDQSTISFECTCSYQKVLSTLNLLNQNDLKDIIKDNKPVEVVCDFCNQKYQIQIQ
FT                   DVLTLLN"
FT   gene            complement(34604..37756)
FT                   /locus_tag="MMS_A0032"
FT   CDS_pept        complement(34604..37756)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0032"
FT                   /product="GnsA/GnsB family protein"
FT                   /note="identified by match to protein family HMM PF08178"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69423"
FT                   /protein_id="ADK69423.1"
FT                   /translation="MLKFIKNNKLWVAIISVFAIFLSSFGIFAKSYVDSNKQKIVNKVQ
FT                   NYVQASSYAIQSRILKETENLNEAYLNQKIGKKSLLNEFSSDFIWRPNNSKTTSTDTIS
FT                   DLWKTYFGSSTNILDKNLQIQYKTNNQYKSIENSKGEITPQNIDFLFSISKSLEKFLNG
FT                   FSPSLASLGLSFIQNTVLNNRDDPNFKNYKDGLNKFADVIENNKNLFSYLAKLLTPKQL
FT                   EKDHYKNLTIKQALIKNINQIAAVIADNKEFAKETEVDKIPEALDKILAELGLDSLGEI
FT                   IGELISSKNGFQNLGKIFSKIKDIFTSQNFQKLKTKGLELIDKITPYLATYLYSELFFG
FT                   LYYVTHEEFKNPSDLTKQKVNVSNFSALVNNKIDLNVLINGFLKVLKDKKSFDRFYNFI
FT                   FKRFNENEIFNSKNNIGSNNGVGNLIFDLINWVEKKLHNFSNLLETLIKFADFAMSDEK
FT                   IKKTFEENIKNFITKKLNELGTPLGKWHVEIKNGILNISAGSSWLASLTAKIEVFSKDG
FT                   IIPKIIDVLKKIHGIINNSSETIIKHIKEIFYLAKDNILDFSITSKNISEIIMTFKELL
FT                   INKKILNVNVKAILIKLLDISSIYDILELPYSNSALKWILERFANDKIEPHLKKIKSIS
FT                   ETLQKNKFIQNADKIKEQLPKYLDLFSSHFKKYEKSSDLKFNLNISLYKGNIIEDFILK
FT                   WINFLLQDAENKENPLLPIIRLITKKNSLETLDDIKNEWVSKITNISKKIESFQNISKI
FT                   RDTKIDIPKELLKYFGLESINNQTILQLLEILGKYFDDYLSKNPNKVVGINISSLGKVL
FT                   TALTTRIGIEYKKGLEKYNFLYEKNTDQDKTKTILKALVYGFDTHDNSSDVGSDSIKNR
FT                   KPESYYNWDKIHFYINGSSQAITLDRTKLKDDSSYSPLHMLLGINPDKSSYLKDSLGYV
FT                   FGTLFGGLPASDSNYQLSIENKTDVTSILNVFNYVLDKKDKELKKQEEQIATKYYDKNA
FT                   WSTKILSSNENEIIYQLIRLKSSDTKESKRLGTRFEVKLLKNKNNLYWSINRVIALDYK
FT                   AV"
FT   gene            37921..43290
FT                   /locus_tag="MMS_A0033"
FT   CDS_pept        37921..43290
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0033"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69630"
FT                   /protein_id="ADK69630.1"
FT                   /translation="MLKQGVKWILKFKLQLVVIVVLTFIASSILTISFTTNKRLSSAYD
FT                   QVVNNSKSPKFDSTYQITVGSKAKPEKGDPLFIPIFDFVNKQYTGFKNEGYDNFNLTFN
FT                   DIYGEKNLLTITTSSQEFKDAWAKKKDIFIYKDNQNDIKQLAKEQQDFDFAINDAFFNT
FT                   MAELLSKNDPAIRNTVIGRYTLSNPNWYKHFYNKEKNIKSNWAEFIKDKSRIETLKNTN
FT                   PDDLKTYFYSYYAFESLSQYFFKTIQTFLQNKDSELAQQSNINKDNSHKYFYEFLFGKY
FT                   FENNKASYKEEYIANNNNLYTLTFDSTVSSSEFEKMNFLISSENKEQNSQDQKFFNELV
FT                   KKGFKGILRPLQITYQNFGDQVDIKNVVQYTETQELRGFVSNSNIYSQNVKELPEIFKN
FT                   NSFVDILAMNADPFANIGEKSVNFYTSKTNDLETIVASDFPITAAFLTHHKLTALANGY
FT                   DLYIRPETIFNDPITKKTFRIVDITNKDFTNYIILDGHAPSSASEITISKQFAKANKIQ
FT                   IGDRLTLGNAKGLIVTGYAVDTYSFFPTSDPNVPLPKSDSGGLIYADFATINQILGDGN
FT                   SATANDQTSTFNFFLIKKNNSLNIKNVYFDHFSVANKIRDNILAKQKGTEIQTFYQERE
FT                   FSNSWYSLNWTLYQKISFWYSLATFLTASLITLVSALAVFVGVIKSIQANSKQIGILKA
FT                   NGASSATISWSYVSYAVILVFIAIPLGWMAGTMLQVPFVAIFKDYFSFKTNVLIYDWLA
FT                   PLISIIIFGVLIGVFSFLVALFHIKKPVLDIIKSSKKWSKPKITDWLHKHIFKKPRFAT
FT                   LLMLKLTESGKKPFSLLLVLVFIGTLFVSAGVAIPSVTKYAKDNYFKKVNYDNQYEIYN
FT                   SLSNSPLGKDVFNFWNGHEQIDNTYKEIKDPSGTINYYENPNSYTLSNQNSSVLPQLIY
FT                   KINTNKDNDSNNAEILTPYKSIIKEYLKTGVSNLYKNLLDWASYQISISNGKSISIGTI
FT                   EQLYAYILNDADLNERFKNDIDKVKETNNVTQPLTQFVGELLKTIFKDKVQTTGEWKEK
FT                   ILNLILGYSPSFIKSYLTSKSRRAQFSFGWQKQTIIPQKDQLATIFKPKSNNVETNYSI
FT                   LGLDKNQQTYKLSDKQKNQLFLSNNQVQKLYQIINNPYDKNQNNDIYLNNIKVYDHKTN
FT                   TLTIPTIVNKNLNYKLNKFGDNIISNLSANNIQLSYKTRNNDFNVLPKQAWIYDDSDYL
FT                   KTEYVNKHTKWEDQPIQIINNKNNSSSYGYEVVENNNEKYYYLNPYNLDVNKFTQRQVI
FT                   DIWSNNSNSSLVAKQHENIVDESPLFGDFVINNNGQITKSFIRPYYQLRNLLLFVPITD
FT                   QVSWEDFVLYASGWSKSTEHGLDIKRVISDLDKTDDHTRNYKYPAIKKLNASLVPQSVK
FT                   NGWQSVIKDLKSDTAYLAIRPYDFSIQQEKWANNHYEYFILDNNTKKILGVNPPSADKS
FT                   IPNILLNSVPHFYRRAVGKRKSVPAILKLQDKNVSYVNKDLKIKLQKVDDIDIYGKAYA
FT                   LVDSDLANMLYGFDISRSTNYDYRPFDTSKIIKKGELFNTYKTTNWLKVNNKDPWKQAF
FT                   ISQKDTFSYSPHYYYNTIFSNSSEPLIITSSVSLISEQRLGIGILDLMNLSDYKAGIVD
FT                   VDFTFETKQLLNQIVKTAIYIAIIIITAIMLCASLLIMLITDIYISQYKSFMIMLRSMG
FT                   YTNTQVMFYTLGIATIFSLLISFITTIIVFSSTSIIDKVFSANGFSIPINVYWVSVVFC
FT                   ILLILVSFFTSLWVSTKRVRNAEPSTMLSEVDE"
FT   gene            43728..44714
FT                   /gene="pdxB"
FT                   /locus_tag="MMS_A0034"
FT   CDS_pept        43728..44714
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pdxB"
FT                   /locus_tag="MMS_A0034"
FT                   /product="4-phosphoerythronate dehydrogenase"
FT                   /EC_number="1.1.1.290"
FT                   /note="identified by match to protein family HMM PF00389;
FT                   match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69299"
FT                   /protein_id="ADK69299.1"
FT                   /translation="MKVIFFGVRDSEVEFFEKLKNKYNYELTLAQGVLTLDRIDLIKDH
FT                   NCVIVRDADKLDKTLLQAIKDQGVEYVFTRTVGFDHIDIPTGHELGFKMARVVSYSPTA
FT                   IAELAFSLAHSLSRKSAYWAYQSVNKNFKMDQYGFSKELKNSVVGIIGTGRIGYEAAKM
FT                   FKAFGCEVLGYDIKPNSNFEDVIKYVDLDYALANADILSFHMPYIKGQNDKLINKELIS
FT                   KMKDGAILINTSRGQIQDEQAILDAIKSNKLAGAGLDVWNTEKDYLFKTLDSIDDPVIK
FT                   GLLDLYPKVLLTPHIGSYTDEAASNMIEYSLDNLNEYLTTGDCKNKL"
FT   gene            44733..45857
FT                   /locus_tag="MMS_A0035"
FT   CDS_pept        44733..45857
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0035"
FT                   /product="transporter, auxin efflux carrier (AEC) family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03547"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69783"
FT                   /protein_id="ADK69783.1"
FT                   /translation="MNGVKEAFIQTMTNQKLWGAIVATIVTILLSYGLTKANILKKEWK
FT                   AGLVKVVMTIAVPALVLTGFMKTASIQQLKEQGVVLGVSFAFYILLNVIAFLWSKFAPN
FT                   FAKKSAEMIQDNKALNSDGSMSQSRALIMWMMIIFGSTTFFGFPIIQVIYPNSGFVAAN
FT                   IWNIAYRVFLYSFCFMMISGVKWSKKNFKDAMKKTFVNPIVICTFLGLILWLTTLIPGQ
FT                   SFGENFKTVEKGGVAWFEFGKTLPIIHTPLQKLGALAAPITWIAIGITLASSDIKKAVK
FT                   DKWVWIFSIQKLVLLPLFVFLIFLALNKTGVVSKEVAVSMVILASTPPATVVVLYAIQY
FT                   KMRDEFAAQCSTLTTLLAVIMLPLWVVISSIAFV"
FT   gene            46212..47135
FT                   /locus_tag="MMS_A0036"
FT   CDS_pept        46212..47135
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69719"
FT                   /protein_id="ADK69719.1"
FT                   /translation="MKINNDNYIPRIMDKIIQKHLKIAGAICVEGPKWCGKTWTSRQNS
FT                   NSEFLVGSAANAFSNRQLAILNPEYVLKGEFPRMIDEWQEVPSLWDATREEVDKYSQNG
FT                   LFILTGSSTPTHKGVLHSGAGRIVRLRMNTMTLFESGDSTGILSLKDLLLDEIKTKYVD
FT                   ELDFKKLAYLIVRGGWPKNIKTSFNDCEVLPRSYIDSILESKLLDENNNAYNSNYIKLI
FT                   LKSLARNVSTTVSERSIINDISQNEVDSISRPTLSKYLDFLNNMFLFSNLEPYSLNTKI
FT                   FFKSKTTRKKILLWPIFSLCFIRFNT"
FT   gene            47152..47496
FT                   /locus_tag="MMS_A0037"
FT   CDS_pept        47152..47496
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0037"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69139"
FT                   /protein_id="ADK69139.1"
FT                   /translation="MNLYGLLFEGLVIRDLKVYAQANEAKVYHYQDYLDNELDAVIEFK
FT                   NGEWCAIEIKLGLNQVEQAAKQLNKAIDAITRSKNKPPINKCIIVGFGNLVYKRKEDGI
FT                   IVIPINALKD"
FT   gene            47700..49373
FT                   /locus_tag="MMS_A0038"
FT   CDS_pept        47700..49373
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0038"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69711"
FT                   /protein_id="ADK69711.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISSSQKRATKDKNDRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            complement(49503..51449)
FT                   /gene="hflB"
FT                   /locus_tag="MMS_A0039"
FT   CDS_pept        complement(49503..51449)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="hflB"
FT                   /locus_tag="MMS_A0039"
FT                   /product="ATP-dependent metallopeptidase HflB"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69293"
FT                   /protein_id="ADK69293.1"
FT                   /translation="MNKKKKKSTFWFWIILIIGFIILLSVISITSRGTTQNLTIEQLYN
FT                   LFDQGKPLNNVVLQRNNIQGIDIITGWYNNGSGWTKFTVNTNPNAINGFSDAFKNFVWR
FT                   SNTTRYTESSWFSLLSSLLPMLILILFYIGLFYFMAKSGAAGAGASGLFGMGKNKARRE
FT                   KSNVKFSDVAGIEEEKLELVELVDYLKQPAKYASAGARAPKGVLMEGPPGTGKTLLAKA
FT                   VAGEANVSFFSIAGSEFEEMFVGVGASRVREMFNEAKKAAPAIIFIDEIDAVGRKRNSA
FT                   IGTGTNEQTLNQLLVELDGFETNSGIIVMAATNRVDVLDPALLRPGRFDRVIQVSLPDI
FT                   KEREQILKLHARNKKIDPSIDWHRIAERTPGFSGAQLENVLNEAAILMVREGKTVIGIN
FT                   EIDEAIDRVVGGPAKKSRAMTMHDKEIVSYHESGHALIGLKLESASKVQKVTIIPRGNA
FT                   GGYTIMTPKDETLFSSKTDLYAMIAGYLGGRAAEEIKFGKDNVTTGAHDDFDKATAIAR
FT                   RMVMQFGMSELGITKFLTMADEAYGKTEGSYSEKTAAKIDAEVERILEESYKLAIKVIS
FT                   ENMETLELLAESLRILETITAEQIDYINKNKKLPEAVIYEKEKYKQEQEKINSGKIIDL
FT                   DINDVKEDNKENN"
FT   gene            51681..52064
FT                   /locus_tag="MMS_A0040"
FT   CDS_pept        51681..52064
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69726"
FT                   /protein_id="ADK69726.1"
FT                   /translation="MTYYLNFYLDESGNAISDFFVVGGFYLNDSDYQNIQIHESKIKSN
FT                   ILKTEKSIREYRNTVETDLKPYDSKKEVKWNSLSLSNKKVLSSKIRFNNQTNIAMISSL
FT                   KNWDSKYGKEIKIEAIYNMMVKN"
FT   gene            52157..52525
FT                   /locus_tag="MMS_A0042"
FT   CDS_pept        52157..52525
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0042"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69846"
FT                   /protein_id="ADK69846.1"
FT                   /translation="MIKTKNKQQKLEALEGYIKTEFYWNLHFKDIQIKVVQFESNSHPL
FT                   IRYADYFVGSIASMCHFLNHSNKSWYEQADVIFEQIHKKVPCICSQTIINQSSVVKKLI
FT                   NLCKELNQIRESKTNNAF"
FT   gene            complement(52509..53714)
FT                   /gene="tilS"
FT                   /locus_tag="MMS_A0041"
FT   CDS_pept        complement(52509..53714)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tilS"
FT                   /locus_tag="MMS_A0041"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.3.4.-"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM TIGR02432"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69147"
FT                   /protein_id="ADK69147.1"
FT                   /translation="MSLFNINKSKKYLIAVSGGPDSVFLLCNIVKLVDPNDLVVCHVNY
FT                   NFRSDSNNDQMIVTNLCKQLNLKLEILNINKDYSLLKQNFESWARAQRYDFFNMIASKY
FT                   QIYNLLVAHNLNDLIETYLLQLQRNNLVDYYGLKPVSHYKDLVVYRPLLDIKKSQILNY
FT                   LNTNKISYAVDSTNSDIKYQRNKIRATLNENNFTKILDQINKANNNLNSIKKIVDNYLK
FT                   NNIINNELNLTKELFLLDQTCIQRIIYTYFKLINKENLLLNRSNKTISEIVKRLVNSNK
FT                   NYWKINLNDHSLIKDYNKLFVIKNSLLEPKTIIINDLNDLINQTTFKNIKEIEQIILKD
FT                   KNFSYVITTDYEMYKSITTIANKKTNRYFIDRKISYKTRLLSPVVYNIKNKIILNKIKK
FT                   HY"
FT   gene            complement(53717..54544)
FT                   /locus_tag="MMS_A0043"
FT   CDS_pept        complement(53717..54544)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0043"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="identified by match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69455"
FT                   /protein_id="ADK69455.1"
FT                   /translation="MDVTKLILRLDQLSKEHSSTTGVTSRIILDNIELITNSTISKVAQ
FT                   ITYTSPATITRFCQRHLDISGFSELQTLLRVYLNQQEEQNRLLLQNKDKKISKFEEISK
FT                   AINATDALIETNQVDKLVKAIYNTKTVALISYDNSVNHAVTELAEKMNLIGIPPVIINQ
FT                   QDLLDYYTKISDSSWVFIVISHFAENITTYQSIVQLKKNGSRIGLISMNKPSKYSSICD
FT                   YWIKYAVTDADPLQKIKHSANFSLLYVVQVLFNRILTNDHNRFEKIIKTLKIE"
FT   gene            complement(54596..55318)
FT                   /locus_tag="MMS_A0044"
FT   CDS_pept        complement(54596..55318)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0044"
FT                   /product="methyltransferase small domain protein"
FT                   /note="identified by match to protein family HMM PF01170;
FT                   match to protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69145"
FT                   /protein_id="ADK69145.1"
FT                   /translation="MKVLNDLLGYKNRKLYQDNKMFNFTLDSVLVARFCNLNSKKKKIC
FT                   DFGTNNAVIPLILSKYTRAKIIGVEIQNKAVEIANENIKLNGLEDQIEIIHADIKEFSK
FT                   LHNQEFDLVVCNPPFFKMDGNPKLKEISLEVANARHELLITLKDIIKSASRCLKNKGNF
FT                   TIVHRSERLSEIINLFYKYNIYPKRLRLIQSKKTDNAKMILLDGIYQGNEGMELLPTLI
FT                   THNDDETYTDELLKYFHD"
FT   gene            complement(55318..56058)
FT                   /locus_tag="MMS_A0045"
FT   CDS_pept        complement(55318..56058)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0045"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69316"
FT                   /protein_id="ADK69316.1"
FT                   /translation="MKKEQVISRLKKLIDNNSLFSNIILNCKDEQTSWDVIYQIIYYAF
FT                   NKNVKDLDFNKLKDQIQNNTHVDILTIGNNINITNQEILDLINKMSLSATATQNIKFFI
FT                   IKNAQNLKLSAANSLLKFLEEPPINTYGILLTNNYSEIINTIWSRCQLINIDNQTQLDN
FT                   KLNRFEELLISKNKDEILLFNKEMKTMNKNELVKLIDDAYNRTIIYQFANLISCTLEIL
FT                   DDLKFLPLTNIAIDNYLIRIVEQI"
FT   gene            complement(56036..56677)
FT                   /gene="tmk"
FT                   /locus_tag="MMS_A0046"
FT   CDS_pept        complement(56036..56677)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tmk"
FT                   /locus_tag="MMS_A0046"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="identified by match to protein family HMM PF02223;
FT                   match to protein family HMM TIGR00041"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69252"
FT                   /protein_id="ADK69252.1"
FT                   /translation="MFITFEGMDGSGKTTTLLKVKEELERLNYQVLITREPGGEAIAEQ
FT                   IRQIILDNKNRDMDAWTEALLFIASRNQHLQKVIKPALEKNIIVISDRFIDSTSAYQGS
FT                   ARNIGVDVVNQVQQIVLKNCLPDLTLFFDVSFSEAEKRMQIRGENSKNRLDEEKSDFKQ
FT                   KVYQGYLELVKNNPKRIKVIDANQDIDQVYNQAIKIILEKLKENEKRTSN"
FT   gene            complement(56910..57269)
FT                   /gene="recR"
FT                   /locus_tag="MMS_A0047"
FT   CDS_pept        complement(56910..57269)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="recR"
FT                   /locus_tag="MMS_A0047"
FT                   /product="recombination protein RecR"
FT                   /note="identified by match to protein family HMM PF02132"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69410"
FT                   /protein_id="ADK69410.1"
FT                   /translation="MLETTFDEIIESIRTNQGLTKKTSERLLVDLLINKDKLNQFIDQL
FT                   NKTKQLISTCKICGYLSENDKCLVCSLENRNQNIICIVSTILDAKNIENANKYKGVYHI
FT                   LNGEINLNKTLHLIS"
FT   gene            complement(57271..59217)
FT                   /gene="dnaX"
FT                   /locus_tag="MMS_A0048"
FT   CDS_pept        complement(57271..59217)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dnaX"
FT                   /locus_tag="MMS_A0048"
FT                   /product="DNA polymerase III, subunit gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69220"
FT                   /protein_id="ADK69220.1"
FT                   /translation="MNTNKESLYRTYRPKDFNSVAGHNNIKEILEKQIKDNRINHALLF
FT                   SGQRGTGKTSVARIFAKTINCLNLTNSTACEQCNNCKLANQNQLIDIIEIDAASNNGVD
FT                   EIREIKNSVSTLPLNSKYKVYIIDEVHMLTKQAFNALLKTLEEPPVYAIFILATTEFNK
FT                   IPQTILSRCQIFNFTKIDKNSLKNRLQYIANQENYQIEKEVLDEIFYLSEGSLRDAINI
FT                   LEQLMLATDDLITIKSLKSIFLIATKQEQLQVIHQSLNNNTSFIISYFQKANDQGMNWD
FT                   VFALGLIEILKEIIEYKLTNNTEFLNILEKNEVEQFNSINVNNLFILADNLAEAYFKTK
FT                   AANISFNYLLLSLLKTINSNNNNLQAVSKTINTKQIEQNQEILKPNDITPEILDKPIID
FT                   EPVIQQPIIDDLLLTKDLDDQTLIKNTIENDKPLDSTNLDDQINEFDFYNQKEQAIDEI
FT                   CKTLSELKIKFNIHISQAIDSKVKMLFNEDLISILIETKNYKNQIHNIEQLLEDLFLQN
FT                   DDQLVNAQIASELFMLLDSKIISLTNDVIVLKTQTKAQANLINDSMLDNHVLQQIYNWF
FT                   KKPYLIFAIDKMKWDEIKTIFIDLKNKNKLSEYSEINLKQLKEKYLTINDEIDQDLINK
FT                   AKDLFNDDFMIGD"
FT   gene            complement(59299..59742)
FT                   /locus_tag="MMS_A0049"
FT   CDS_pept        complement(59299..59742)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0049"
FT                   /product="cytidine and deoxycytidylate deaminase
FT                   zinc-binding region"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69156"
FT                   /protein_id="ADK69156.1"
FT                   /translation="MDDFNNILDLMIYQSKKAIKHNDIPVCCCIIDDNNNILSMSINTR
FT                   YKNKDISQHAEINAINKLINKLNTFNLSEYKLITTLEPCMMCYSAIKQVKIDTIYYLVD
FT                   SYKFGIQNNYSINDQNLNLIQIKNHNKQSEYIKLLNDFFINKR"
FT   gene            complement(59747..59845)
FT                   /gene="srpB"
FT                   /locus_tag="MMS_A0050"
FT   ncRNA           complement(59747..59845)
FT                   /gene="srpB"
FT                   /locus_tag="MMS_A0050"
FT                   /product="Bacterial signal recognition particle RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            complement(59883..60845)
FT                   /gene="guaC"
FT                   /locus_tag="MMS_A0051"
FT   CDS_pept        complement(59883..60845)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="guaC"
FT                   /locus_tag="MMS_A0051"
FT                   /product="GMP reductase"
FT                   /EC_number="1.7.1.7"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM TIGR01306"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69632"
FT                   /protein_id="ADK69632.1"
FT                   /translation="MKIFDYDDVQLIPEMCIVNSRKECETTATLGKHTFKLPVVPANMA
FT                   TIINEELAEKLARNDYFYIMHRFNVDQLKFIKNMKDKNLITSISLGVKPDEYKLVDQMV
FT                   QQNLIPDYITIDIAHGHALSVKNMISYIREKMKDQVFIIAGNVTTPKAVRDLELWGADA
FT                   TKIGIGPGKVCITKLKTGFGTGGWQLSALKYCAKTASKPIIADGGLRVHGDIAKSIRMG
FT                   ASFCMIGSLFAAHLESPGKEVEINNCIYKEYYGSASEYNKSEKRYVEGKKELIKIRGSI
FT                   FDTLKEMTEDLQSSISYAGGKDLQAIKRVDYVLLGDYKD"
FT   gene            complement(61196..61723)
FT                   /locus_tag="MMS_A0052"
FT   CDS_pept        complement(61196..61723)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0052"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69913"
FT                   /protein_id="ADK69913.1"
FT                   /translation="MKKLFNILGINFLLVLSIITAIYLKNNNNTSIILKNESTNETNKK
FT                   RLEELEKELLETKDLLDKEYTFSSKLLEENKKLQGILNDYLKIKAELEEFKELLDNEYT
FT                   LNNELLKEKEKFKIKISDLEKEIENLQNQLIQSNKNVTQLENIIQEIKKTRTNKESENK
FT                   KINKQLEEKNLN"
FT   gene            complement(61858..62037)
FT                   /locus_tag="MMS_A0053"
FT   CDS_pept        complement(61858..62037)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0053"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69575"
FT                   /protein_id="ADK69575.1"
FT                   /translation="MRATGTKYSSNKMFKLALWRLLFWLLRFLTLGILLFIDLFRIILK
FT                   KGTFAEKKLTISLL"
FT   gene            complement(62272..64347)
FT                   /locus_tag="MMS_A0054"
FT   CDS_pept        complement(62272..64347)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0054"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69751"
FT                   /protein_id="ADK69751.1"
FT                   /translation="MFLYQISFLIPSVLTISCYKTDSNKIDQKPNNNNNSNNDQNQNDQ
FT                   TNQNQNQNHLNNKIDKNDEIQLFNSHFLDINKLKDLTPYQIHKQTKDYITGQKEFNNFV
FT                   KNNNIDFTLYDHKEYQKNYWELASKLGEYGNIGEDKISKTKFYNPHIPLSYSIKQQKLE
FT                   QLKDEEIKGLTATDFDFKTLVKTNPFGFLPSNLSQLLSYASFNSLEKLFKIKDIINLKS
FT                   KHDDIKGSFELLIKTKNKKYYYKTTKDKNNFLKTNEDYFKYIHERSFQLEINVKQWVID
FT                   QDEKTLQEIPRLNFANASGTAWVIDRIDNKEDKNNYKLLLATNIHVFSLRKTFDKSIFN
FT                   NKVSDQKLKEFPVGFYDGKNTKDTDDNRNMKVYLKANRTKKIDNKNGLVETDVDKNESF
FT                   DAFDVYSQYLVAPYYTPRYSADNIYFKDFSKKSLYFNDNDYLSKTNNSGADFLTLRLKI
FT                   EKDKLKKLLPSLEKIIGKKEEKDWYVKFSKNKFSSLQTQFYAGYPKNWNPFISGTQFRG
FT                   LKSKGGLVATQRKILEDIYFRDIWLKYDQKKNKEYNSLNNNWKKYEKPFINNEHGMNLT
FT                   IADQFSTLYTNIPFGQLALKQGASGSMVIDSSFNVIGILNTEVQDVPGSKYISIPLPEY
FT                   AGRKFTLPAYVQTNGVILFNSLSNDYLTKNNESPKIIDGLIEKLKEDKLKTISLNP"
FT   gene            complement(64525..64974)
FT                   /locus_tag="MMS_A0055"
FT   CDS_pept        complement(64525..64974)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0055"
FT                   /product="antioxidant, AhpC/TSA family"
FT                   /EC_number="1.11.1.15"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69379"
FT                   /protein_id="ADK69379.1"
FT                   /translation="MKNYQLKDHKNNLVELNSLVGSKGLVLFFYPKAKTSLCTLEVIEY
FT                   QKHLDEFKQLGFNVVGVSQDEPNKNDEFCCEQNLSFLLLSDLNKDLVNEFNLTSETIVL
FT                   DDEPFVKYERSTFVLDNQLNLLKEFRNVDHIEHVSDLLEYLKKND"
FT   gene            65045..66787
FT                   /locus_tag="MMS_A0056"
FT   CDS_pept        65045..66787
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0056"
FT                   /product="phosphotransferase system, EIIC"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69607"
FT                   /protein_id="ADK69607.1"
FT                   /translation="MNFNKFKINKDNFKQFSSKTTAILQKFGRGLMLPISILPFVGLLL
FT                   GIGGVIGANISTTNHTGLIVSKSLKAMSEIVFANLAILFTISIVITFTGESGSAAFLAI
FT                   LGYLVFNSTQSAFIHYNDKVLVDVFYIHKGEWLKSIVGSNLGISSLQTSLFGSIVVGVI
FT                   VVKIYNKFKYIKLPSALNFFSGIRFLPILIIPSMFLLGLIFLLIWPYVGLLINQIGISL
FT                   SKTPRGVDGFIYGVLGRALMPFGLHHILITLAYQSAFGGILEYDKLIFKLIESKVDQET
FT                   IYKIEQSFKSFTKSNTQIIVGDQNIWNFINSIPVNKIQQTPIFLWFENNLNINAGKFTQ
FT                   DYPTYLGTCMGIGLAFILTSSKENKKQTASVIMSAMGVSFLTGITEPLEFTFLFVTPVL
FT                   YYVVYVPFSGLSYLFMNLVNAHVGVGFARGFIDLLVYGALPVLKGTRFYWAFVFSLIQG
FT                   VAIFVIFYFWIIKKDLPTPGRKGNELGLISKKDYFELKNKDNSEKRIKEIIKALGSKEN
FT                   IKSVSACATRLRVVVNNESLIKTEELIKLGSVGNIIKNNNIQAIFGGEATIISEKINNI
FT                   LNQE"
FT   gene            complement(66841..67701)
FT                   /locus_tag="MMS_A0057"
FT   CDS_pept        complement(66841..67701)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0057"
FT                   /product="putative transposase InsK for insertion sequence
FT                   IS150"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69638"
FT                   /protein_id="ADK69638.1"
FT                   /translation="MLKTHKKVKIPILLKIAKLPKSSFYEWKYKLENTIDKDKELKEMI
FT                   VDIFSKSFETYGYRRLKMALKSKGYIVNHKKILRLTKELGVQCIKFRTKNGRYSSYKGT
FT                   VGKIADNVLKRNFHSLQANKLWCTDVTEFKVNGQKLYLSPIIDLYNDEIISYSIQTNPN
FT                   LNLTNSMLDKALKKVKNTNGLLIHSDQGFHYQHISWAKKLEENNITQSMSRKGNCLDNA
FT                   IIENFFDLLKQEIYYGEKYNSVEELTKRIHKCIYWYNNIRIKEKLKGLSPVQFRKQSCY
FT                   NIEKF"
FT   gene            complement(67710..68264)
FT                   /locus_tag="MMS_A0058"
FT   CDS_pept        complement(67710..68264)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69154"
FT                   /protein_id="ADK69154.1"
FT                   /translation="MGFLYVQIRFRKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESL
FT                   VNRFEAFGIEGLINKEKKPYYSAKLKLKIVLYKLETNHSYDEVAKKFNIIYSSTIAGWV
FT                   KKYREYGFLGLNNNIGRPKKIMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEA
FT                   EFWKKFHTLLTKEKSTRKKQK"
FT   gene            complement(68320..68478)
FT                   /locus_tag="MMS_A0059"
FT   CDS_pept        complement(68320..68478)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69747"
FT                   /protein_id="ADK69747.1"
FT                   /translation="MEYRLKEDQNWTSIKTNKLVKLKRRNYQIRIKPNQTNLPSEIQEV
FT                   NVINDMN"
FT   gene            complement(68686..68916)
FT                   /locus_tag="MMS_A0060"
FT   CDS_pept        complement(68686..68916)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0060"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69215"
FT                   /protein_id="ADK69215.1"
FT                   /translation="MLIKLKNDDGYVLILDHFNNFGTIKVKIESIKRQGFNFKLANNIF
FT                   EFDVKKHDKSSANLQTTSDYGVILTNVNANM"
FT   gene            69514..71187
FT                   /locus_tag="MMS_A0061"
FT   CDS_pept        69514..71187
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0061"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69946"
FT                   /protein_id="ADK69946.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNDRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKDAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            complement(71382..72056)
FT                   /locus_tag="MMS_A0062"
FT   CDS_pept        complement(71382..72056)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0062"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69498"
FT                   /protein_id="ADK69498.1"
FT                   /translation="MKNKSQKRLLFITLIGSITTIGSTVVSCSNSLSKHNNSQSFKTIP
FT                   TVSNVINKINNQNTNISNSSNFITNQTNTLTNKDFTNFYPTQDFEKFNPKTLTKEQIKQ
FT                   IILDNSLSSNHFSHSKFKINSSFVFLEGKDKQAQLELIDLETNEEIKENVRWYQRTKYP
FT                   DDVLKPRQTNDSSQLKLKYDGTIISKIIQTIMLKLVKFELNIKGIYTQHLLKFYQKIIQ
FT                   KV"
FT   gene            72239..72529
FT                   /locus_tag="MMS_A0063"
FT   CDS_pept        72239..72529
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70010"
FT                   /protein_id="ADK70010.1"
FT                   /translation="MFRKIFKILISLVLAIIVILIGIIVLGFSQSQIDANFLQRATKVL
FT                   KDTSTIDLLKLNVATLGQKIGVLLVIYIGPLIFITGFIWNFFKLLFSVFKK"
FT   gene            72548..73129
FT                   /locus_tag="MMS_A0064"
FT   CDS_pept        72548..73129
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69478"
FT                   /protein_id="ADK69478.1"
FT                   /translation="MSNIKTIINWISYFKSIKYIILTAILSSLLTVIALTTSMIQIAGT
FT                   GLFQVADGLFLSLTFFIPGPMMLVVGCVYAMIFDLVSGAAFYVPISIIIHILMFVSIKL
FT                   LMYKLPFYLNIMISEFFIFLYVLYAYVINYYSNSSDTSQANVKALISLITDFIQYLVSV
FT                   ISAIVLYNVFNTQSFLNLFKKLDIDIYKNK"
FT   gene            73244..74356
FT                   /gene="ald"
FT                   /locus_tag="MMS_A0065"
FT   CDS_pept        73244..74356
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ald"
FT                   /locus_tag="MMS_A0065"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="identified by match to protein family HMM PF01262;
FT                   match to protein family HMM PF05222; match to protein
FT                   family HMM TIGR00518"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69870"
FT                   /protein_id="ADK69870.1"
FT                   /translation="MKIGLPKEIKQNENRVGITPMGVVELVRNNHEVLVESGAGLGSGF
FT                   SDLEYEKAGAKITKNVEDVWKQEMIVKVKEPLKSEYKYENQIIFTYFHLAGLKDLTEEL
FT                   IKNKVIAIAYETVQTPDKALPLLRPMSEVAGRMAVIIASNLLLKNTDKDALGVLVSGTP
FT                   GTPKANITIIDGGVAGSSALRLAIAMEANVTIIEFNENRIRQLYETYGHKANILKSNYA
FT                   NIAKAVKESDVVISTVLIPGKLAPRLVTTEMVKTMKPNSVIIDVAIDQGGSVETVNHIS
FT                   SHADPTFIRHNVIHYSVPNIPGAVPRTSTIALTNATLTYVVEIASKGWKKAIQDNSALK
FT                   LGVQTVNGKLVYKKIADSLNIQYTKIDNAI"
FT   gene            74757..75581
FT                   /locus_tag="MMS_A0066"
FT   CDS_pept        74757..75581
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0066"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69626"
FT                   /protein_id="ADK69626.1"
FT                   /translation="MKKYFCNLKTSISQNKKQYLIRLGCLLIGLYLFSLSIALYVPTAV
FT                   GASQVDFTNFSILALFKDWAKVGDKTVEGLVAATNYKLALMSLYGFLLLVSVVFLVLSI
FT                   IREYKVTKDKKLWLQLIPLIVLDVIINVGLSYVIDGQIEMLKVIGYLDWLFNQSTNYQF
FT                   RTIFFTIAFVLYIVGLTFWIHSGWLLGSYNSINTNFMRLTKLPFNVSRVLMDVLIIIPG
FT                   VIMLLVNPISWDIKAKFLLNYVNIGTIGFLFLAGPMLGKTLGLLNKITKIYQ"
FT   gene            75663..76931
FT                   /gene="serS"
FT                   /locus_tag="MMS_A0067"
FT   CDS_pept        75663..76931
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="serS"
FT                   /locus_tag="MMS_A0067"
FT                   /product="serine--tRNA ligase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69230"
FT                   /protein_id="ADK69230.1"
FT                   /translation="MLDINYIEQNLDEVIQILNKRNQQDYSEDLKYAVEKNLKRKQILV
FT                   KSEALKSRKNQLSKEIGILIKDKKNEQADKAKAEVVSLNEQIIKLDEELRIVNDQILEK
FT                   LSYIPNLSHKDIYFGKSDEDNVEIRKTKHNPLLTHSTPHWEIATKLGLVDFEKGVKLSG
FT                   SRFLIYTGLGSKLVRAIADILLKRHEKHGYKEIFCPLIVNKSAMLGTGQLPKFSEDMYQ
FT                   VGEQYLIPTSEVPLTNLHANEILTYDMLPLKYTSFTQCFRQEAGSAGRDTKGMIRLHQF
FT                   NKVELVKITHPDQSMNELESLVKDAEDVLNMFDLPYRVVELCSGDIGFSSAKTYDLEVW
FT                   FPEQNKYREISSCSNCTDFQARNIQTRFKDKDGKIKLVHTLNGSGVAIDRLIATILENY
FT                   WDGEKLVLPTILKPYFDNKEFLK"
FT   gene            77033..77347
FT                   /locus_tag="MMS_A0068"
FT   CDS_pept        77033..77347
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08921"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69320"
FT                   /protein_id="ADK69320.1"
FT                   /translation="MPIIKFSGLEKEQVNQFSKNIQTIAELVKADPKNIFVIWENSEVF
FT                   VTEPSTKPIYVTVEWMARPDKEQLLADFIVDYFKDYSQKVWVFFTDVNSKLYAHRKKLG
FT                   "
FT   gene            77349..78323
FT                   /locus_tag="MMS_A0069"
FT   CDS_pept        77349..78323
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0069"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="identified by match to protein family HMM PF01207;
FT                   match to protein family HMM TIGR00737"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69952"
FT                   /protein_id="ADK69952.1"
FT                   /translation="MKIRDIQIDGKVVQGPMAGVSNEAFRIISKQHGASLVYAEMVSVA
FT                   GMVHDNKKTLNMLNVNKIEYPMSMQIFGNDVDEFIKATQWIEKNVDCDIIDLNLGCPAP
FT                   KVAIRSQSGSALLKTPELIYEIVKNVVNNTNKPVTAKIRLGWDKNSVNAVEVAKLIEKA
FT                   GASAIAVHARTRNDFYTGHADWEKIKEVKQAVSIPVIGNGDVIDAKSAKKMLDETGCDA
FT                   VMVSRACQGNPWIFDQINYYLKTGKELEKPSFEEWKTTVLQHLDLLVKLKTKQFAIKEF
FT                   RKHLTWYLDVLNNKQLTKILKEKANKIETIKDVEDIIKEYKEE"
FT   gene            78326..79828
FT                   /gene="lysS"
FT                   /locus_tag="MMS_A0070"
FT   CDS_pept        78326..79828
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="lysS"
FT                   /locus_tag="MMS_A0070"
FT                   /product="lysine--tRNA ligase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69970"
FT                   /protein_id="ADK69970.1"
FT                   /translation="MLDNRKFSEQELVRRNKYKTLVEQNKDPYKVTNWKRNTTLLKLNE
FT                   KYKDYSKEDLLNLNQELVVVAGRIKLYREAGKKAAFVNIDDQDSSIQLYVRLDEIGDQS
FT                   FEDFRNFDLGDIIGVKGIMMRTDHGELSIRCKEVVLLSKALRPLPDKHAGIQDIEEKYR
FT                   RRYVDLIVNHDVRKTFQARTKIIRTLQNFLDNKGYMEVETPILHSLKGGASAKPFITHY
FT                   NVLNTDVYLRIATELHLKRLIVGGFEGVYEIGRIFRNEGMSTRHNPEFTSIELYVAYED
FT                   MFFLMNLTEEIFRVCNAAVNSNSIIEYNNVKIDLSKPFKRLHMVDGIKQVTGVDFWKEM
FT                   TVQQALELAKKHKVHVEKHQESVGHIINLFYEEFVESTIVEPTFVYGHPKEISPLAKSN
FT                   PSDPRFTDRFELFILGREYANAFSELNDPIDQYERFKAQIEEESKGNDEANDMDIDFIE
FT                   ALEHAMPPTAGIGIGIDRLVMLLTNSESIKDVLLFPQMKPRE"
FT   gene            complement(79945..81618)
FT                   /locus_tag="MMS_A0071"
FT   CDS_pept        complement(79945..81618)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0071"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69332"
FT                   /protein_id="ADK69332.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRSDNKGFVYRLGYGY
FT                   LHELKQYHDGPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNTKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNDRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLSYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            complement(82225..82533)
FT                   /locus_tag="MMS_A0072"
FT   CDS_pept        complement(82225..82533)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0072"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69733"
FT                   /protein_id="ADK69733.1"
FT                   /translation="MADIIKITSKEQFDKEIKEGKVLVDFNATWCGPCKMLAPILHDFA
FT                   KKVDGVKFLDVDVDLNRQVAEKFRIMSIPTLITFENGNQVNKHIGFATPDQLKKLID"
FT   gene            complement(82544..83386)
FT                   /locus_tag="MMS_A0073"
FT   CDS_pept        complement(82544..83386)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0073"
FT                   /product="HAD hydrolase, family IIB"
FT                   /note="identified by match to protein family HMM PF08282;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69737"
FT                   /protein_id="ADK69737.1"
FT                   /translation="MDKKNIIIFSDLDGTLLYDDYIFSPKTIEVVEKLYKKGIYLVPIT
FT                   ARTIKDLKQKASLLQIDKFKEIIVASNGAQIYDYKTDKIIFDKTLPKEFIKEMFNRYHN
FT                   KFFAKMIFYSPNCCYVFAEGKNSKYWAHQVMGLKYISVDSPDQIDEPITHFYIVTNSKA
FT                   TPEENLNEYKYLMNNYADSYKVDSYNNRVFDISVKGVDKGCGVAEVMKYLNLDEKTTHS
FT                   YGFGDGPNDFSLLKACTTGIAMKNGIIELKEIADDITDYSNDKDGVARYICDKILNVD"
FT   gene            complement(83507..83615)
FT                   /gene="rrf_1"
FT                   /locus_tag="MMS_A0074"
FT   rRNA            complement(83507..83615)
FT                   /gene="rrf_1"
FT                   /locus_tag="MMS_A0074"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(83692..86586)
FT                   /gene="rrl_1"
FT                   /locus_tag="MMS_A0075"
FT   rRNA            complement(83692..86586)
FT                   /gene="rrl_1"
FT                   /locus_tag="MMS_A0075"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(86818..88342)
FT                   /gene="rrs_1"
FT                   /locus_tag="MMS_A0076"
FT   rRNA            complement(86818..88342)
FT                   /gene="rrs_1"
FT                   /locus_tag="MMS_A0076"
FT                   /product="16S ribosomal RNA"
FT   gene            88674..90347
FT                   /locus_tag="MMS_A0077"
FT   CDS_pept        88674..90347
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0077"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69261"
FT                   /protein_id="ADK69261.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVDSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNNRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            complement(90639..90722)
FT                   /locus_tag="MMS_A0078"
FT   tRNA            complement(90639..90722)
FT                   /locus_tag="MMS_A0078"
FT                   /product="tRNA-Leu"
FT   gene            complement(90725..90800)
FT                   /locus_tag="MMS_A0079"
FT   tRNA            complement(90725..90800)
FT                   /locus_tag="MMS_A0079"
FT                   /product="tRNA-Lys"
FT   gene            90990..93056
FT                   /locus_tag="MMS_A0080"
FT   CDS_pept        90990..93056
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0080"
FT                   /product="metallo-beta-lactamase domain protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69328"
FT                   /protein_id="ADK69328.1"
FT                   /translation="MKTIKLFLIDFYNFLILKHYFLLFLLLSICMSASFILSLDINYLI
FT                   LAIFFLSLTIILNHKNTLKIVLIFISINLIFIIYMFWFKHSNLSYLNNKTIISKVIDKK
FT                   TNYAILQHKNIKFYINDFNNKFLLDQIIEISGVFNKLESNTSFYQFDFFNYLNKQFIDF
FT                   EMINYKVEKISNGIRSNFILTNYFYTNKLASMFLFESIDKSTKFGELIKDLNLSFLIVI
FT                   SSYNIHFFTKFFYKLNTKFKWTTIITYLFYLIVFLLSYLTNFSYASLRIVIFFVISLYF
FT                   KKFNKNTKLVFKRFLTLLICFVLTPSFLTSNSAVFIIVSFMFYYEKIFRNKFLDLCLKS
FT                   LLFTFYFIPLQIFYFYSFSVVIQSLLIILRPLFSFLYFSIFIWIWFDHNFLTNILIKLF
FT                   EFIKKININFNIGYVNVIFLILVYLSILIIIKYNFKSIWSWISLIFILLLSYLISWLIK
FT                   PSVFLVMLNVGNGNCFIFHDKFKNTTIINDCGVGKGFSKNIGYEFLKYFGINHVDLIII
FT                   SHNHADHYNAIDAIRKNIKVYETITYNNFLPFKSIKNVNMHFFWNNLENENDKSLVYLF
FT                   EYRNIRILFTGDVEKEAEHLLVNNDYFKYVINLKPIDILQVPHHGSNTSSTDEFISLIK
FT                   PKYGLISGNKRTYNFPRIQTLETLYKHNVKYFISQINGNTFYDFITNSFWFKK"
FT   gene            complement(93089..95821)
FT                   /gene="phnE"
FT                   /locus_tag="MMS_A0081"
FT   CDS_pept        complement(93089..95821)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="phnE"
FT                   /locus_tag="MMS_A0081"
FT                   /product="phosphonate ABC transporter, permease protein
FT                   PhnE"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69178"
FT                   /protein_id="ADK69178.1"
FT                   /translation="MLNKKIIKDRNLFKIGNHYTKPPKRVFTICFTIGIIIFVVLGFAL
FT                   ADQDWEQFFGNFDKLTKLFSEFFKWELNSWNQKQGLPNTFLETSFYNLWQTIKLAFIGT
FT                   FLGIILCLPFSVLASRSIVSNKYINNLSRGFLSLFRTIPSFALAMIVAGYFLTSYGSSV
FT                   IGIIFFSFSVSGKLFYEKIEQIDTKVFTTMQATGANKFQSFRKAVVPQISTNLLSISLY
FT                   TLETNIRYFSVIAIVTGLDSYGDLIRSTLDSSQYNKAGFLLTIFAVTILLIELFIFLIR
FT                   NYIIEEKDYLLEKKLINKIQKPYKNIDKLSNIRFYINYILTKEVNEKIAKTTDSNELQS
FT                   LKLEKKKLISEFKKQYSLNVKKDKEKYKKLFKENKENLFVRVDFVDHLVRIDKITQTKL
FT                   ANECLIIREQIKRQVEDEIKTETTKFKKTLTPEVVLKKMPKTYIKRIVFFAIILFLFIF
FT                   LIKDVNFSLASSSSIKSTNEKILKILNINWESLYYANPNADINKTAQSFSVIYILWETL
FT                   TIAILGTVIGAVFAYILGLLSSSKIVHPIIAKPVLCLTTLIRAIPTYMYAYIFVFAVGI
FT                   GPFAGSLALAVGTTGMLTKYNREVYETINFKIVNQLKALGLNKFQVFRYGILAQTQNEI
FT                   ISYIIYRFEINFKEVAALGVVGAGVLGKVLRSYFDEFLYAEFGALVFGLIIFTLIVEGI
FT                   SNTLRVKFLENKNPKWIDWLINKYQHYCFATYKATLKLFKKQVDMSYWQANAFNSYVKS
FT                   KISLDKLPDKHISKKVIFLKNLKVDIDYDNKTLVDQKYEELISLHKKYIKEFKDNRKLL
FT                   VDQINNQAKNYLKTAKTNYLNSKLKLEKQLTELKVDIKDIEQQIKLQTESNDLNQKLQD
FT                   QKTKLTSIKDLLKSLKREYKKTVLFTKQTRTIKLWNLDY"
FT   gene            complement(95825..96577)
FT                   /gene="phnC"
FT                   /locus_tag="MMS_A0082"
FT   CDS_pept        complement(95825..96577)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="phnC"
FT                   /locus_tag="MMS_A0082"
FT                   /product="phosphonate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.28"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR02315"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69492"
FT                   /protein_id="ADK69492.1"
FT                   /translation="MIVFNNVNKVWPNGKQVLKNINLEINKGELVAVIGLSGAGKTTLL
FT                   KTINKINDISSGEILIDFDKTKEHYEVTKTRGKKLQKLRQKIGLMSQEYNNIANKTVLQ
FT                   NVLNARVSSQKGINKILGFFKREDKMIALNSLDKLNLLDYAYIRADNLSGGQQQRVALA
FT                   RTLAQQPFLIIADEPVSALDPILANQVMKDFKNINKKDGITVIINIHHVDLAKKYATRV
FT                   IGLNNGEIVFDDVPSKLDAQAMKKIYGE"
FT   gene            complement(96591..97934)
FT                   /locus_tag="MMS_A0083"
FT   CDS_pept        complement(96591..97934)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0083"
FT                   /product="putative phosphonate ABC transporter,
FT                   phosphonate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69083"
FT                   /protein_id="ADK69083.1"
FT                   /translation="MKKLISLMGISLLATSATVVTVACGKRDNELKIVFVPSQKQTRVE
FT                   STTSSLERLLTEELKKKAAARGSKFDKRVKVTTSQSYEVAGKSLANGNEDIGFLPINTY
FT                   STYWGERTSDGNHKNLGVLLTAGRLGVKPDTTLSDFMNNSKFDNSKATSEITNKTIFNL
FT                   VKNYKKVVDGVVGESKPLNGESYSKKIYDDANPVNYYRSYAFASIPFLKELKIDNNNSN
FT                   SDWKGKTYNEIIETLLKNDDEKKYQELLKTLIKNPNVKIGIGKSKTSSAGFLYPILWLK
FT                   EFVGLDDNEIISMLTGKDTERKFVKVSSFPEGSETVARKDAKPSDGKYAITFGFSDIRF
FT                   RDGQGQNVAEEKDLFGNSMVIGATQSIYNDGIVYSRSSKSVLRDENLLKDVRQSFIDLI
FT                   NQNEEAKKVFSIYNHKTYIVPNNKIDDAIIKSNAKIEVLKKQFENVPW"
FT   gene            complement(98225..99589)
FT                   /gene="asnS"
FT                   /locus_tag="MMS_A0084"
FT   CDS_pept        complement(98225..99589)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="asnS"
FT                   /locus_tag="MMS_A0084"
FT                   /product="asparagine--tRNA ligase"
FT                   /EC_number="6.1.1.22"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00457"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69924"
FT                   /protein_id="ADK69924.1"
FT                   /translation="MEIRQIFEQHSGLLDKEVEILGRVRSNRQGKFVSFMILNDGTTFT
FT                   DLQVVYKTKTKGYEQALQARVSSIVKVVGRVVLTPEKQQKFEVQADEIELIDQAIEDYP
FT                   LQKKEHTTEYLREIAHLRAKTKTFNAIFKIRSAAAYAIHRFFNEKNFVYIHSPIITSND
FT                   AEGAGEAFLVTTREDADYEKDFFGKKASLTVSGQLHAEAFAQAFKKVYTFGPTFRAENS
FT                   NTAKHAAEFWMIEPEVAFADLKDNIQLIQDMVKYIINYIFKHNRRELEFCNEQLENGLI
FT                   DKLNNVRNSEFKVTTYTEAIEILKQAVKDGHKFEVSDIEFGLDLGTEHERYICEQVNKA
FT                   PTFVTNYPKEIKAFYMKQNDDNKTVAAVDLLVPGIGELVGGSQREDNYEKLIKRCKEVN
FT                   IDIDQLEWYNNLRLYGYYKSAGFGLGFERLVMYITGASNIRDVIPFPRTPKNLLF"
FT   gene            complement(99598..100437)
FT                   /locus_tag="MMS_A0085"
FT   CDS_pept        complement(99598..100437)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0085"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF08282;
FT                   match to protein family HMM TIGR00099"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69281"
FT                   /protein_id="ADK69281.1"
FT                   /translation="MLKNIKLIVTDLDGTVLHHGKLANDIDKPVLEKAIKNNIHVTIAT
FT                   GQPYKSAKPRADLFNIGEHADLAVLANGALISKISSFEPVYVNKIDNAIVNKMVKKLTE
FT                   LNICTVIFTATASDVYWNNIPFEVESMNKRNWFERFNKTICSTDGNFDFIDPVQIMIFV
FT                   PLEKNKILEDWFKAEKLDEHLTSMRNHIETIPIYEFTNITATKGKAIKKMAEILNVDIN
FT                   DVVVFGDNMNDMTMFEEIPNCVAVENAVDQIKQKAKYITDTNINGGVGKFIEKYILN"
FT   gene            complement(100448..101578)
FT                   /locus_tag="MMS_A0086"
FT   CDS_pept        complement(100448..101578)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0086"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69778"
FT                   /protein_id="ADK69778.1"
FT                   /translation="MTTKQKRALIKKSRNKIFRSINKSFAKFHKLLETSVFFKKSHSKK
FT                   HIYMNPEINKMNKIMRLFFKHKELEFKINDNLIPIKFKTSDNITISALKYITDHNSKKW
FT                   VIVSHWFLGDKYWSLYWSKAFIELGYNVLVYDFRNHGDSEETQFVTMGLLESKDLIAAI
FT                   NYLNQTQKVQTIGLIGLSMGAFVINYLTLTQQKFLEENKVKFIISDSSYASISSLLNKL
FT                   LKLSFKRFFSKKCDTYLIKQILKKQKDLTLSDWNKMNLFDKYEKQHIIPAKIPILFIHS
FT                   IEDKITSHNDSIRMFINRKKFNLNDELLIYETSKHCLSLKEHYYQTIYRILQFENKIIK
FT                   DNNKTSIALEKMGIIDKIILNNFNEKKEISTFFYKD"
FT   gene            complement(101601..102560)
FT                   /locus_tag="MMS_A0087"
FT   CDS_pept        complement(101601..102560)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0087"
FT                   /product="putative glycoprotease GCP"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329; match to protein
FT                   family HMM TIGR03723"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69037"
FT                   /protein_id="ADK69037.1"
FT                   /translation="MKILAIESSCDEFSISIIDNNKILTNIISSQIKDHQVFGGVVPEL
FT                   AARLHVQNFNWVLKAALTEANLNIKDIDYVAYTKSPGLIGSLIVGKLVAETISLYINKP
FT                   ILALDHIQGHIFGASIENEFIYPVLAMVVSGGHTQIEIINSANDFEIIGSTRDDAIGEC
FT                   YDKVARVLGLSYPGGPILDKLALKGNKDSYLLPVLKDEDNYDFSYSGLKTACINLIHNL
FT                   NQKNQEINLEDFAASFQYTATNIVEKKIEKAIKEFKPKTLTVAGGVSANSEIRKIILRL
FT                   GEKYNIKNTFVPKMSYCTDNAAMIAKLAYEKILLNNKL"
FT   gene            complement(102654..102878)
FT                   /locus_tag="MMS_A0088"
FT   CDS_pept        complement(102654..102878)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69053"
FT                   /protein_id="ADK69053.1"
FT                   /translation="MAEKQQATVYPVTSYDGKWQVKGVGNTRPTKLFDTQKEAIAYANE
FT                   LTKKRQGSVIIHRTTGQVRDSINNKDKKK"
FT   gene            103078..104436
FT                   /gene="trmE"
FT                   /locus_tag="MMS_A0089"
FT   CDS_pept        103078..104436
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trmE"
FT                   /locus_tag="MMS_A0089"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF08477; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR00450"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69571"
FT                   /protein_id="ADK69571.1"
FT                   /translation="MLINDTVVAPATNISTQAIALIRVSGSEAFLIVNKLIKDKKLEEK
FT                   RGLFLRKLYFEDELIDEVVLSCFVAPNSFTGENVVEIACHGGILNTNKIINILIQSGAR
FT                   MALRGEFSQRSFLNGKIDLIQAEGINNLIHAKNELALKIGVANMSGSNNKAIIELKDNL
FT                   LDIISRIQVSIDYPDYDDVEGSSIEDLTNLLEIINDQINKLLMRSKMAFKNSEGIKTAI
FT                   IGQTNVGKSSILNALINEDKAIVTDIPGTTRDIVEGQINLENVSLNLIDTAGIRKTSDV
FT                   VENLGILKSKNLINEADLVLFVVNKENINDLDNQEIFELLKNKTYILIVNKAEKLSKTE
FT                   KQNLEKKYQNIVFTSAINHDIDQLVLRINQMYLNEEINKNDELILIGLNQITLVEQIKN
FT                   KLSTALSIIKSGMPIDIVNVDLYDAWNLLNELIGVEYEDEIIDNIFRKYCLGK"
FT   gene            complement(104484..104729)
FT                   /gene="rpsT"
FT                   /locus_tag="MMS_A0090"
FT   CDS_pept        complement(104484..104729)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsT"
FT                   /locus_tag="MMS_A0090"
FT                   /product="ribosomal protein S20"
FT                   /note="identified by match to protein family HMM PF01649;
FT                   match to protein family HMM TIGR00029"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70048"
FT                   /protein_id="ADK70048.1"
FT                   /translation="MANIKSQEKRVLTNEKSRLANKAFKSEIKTAIKKALNAKSNDDAN
FT                   KAELVNHAVSLVDKGLKKGIFKDNKAAREKSRLMSA"
FT   gene            complement(105009..105785)
FT                   /locus_tag="MMS_A0091"
FT   CDS_pept        complement(105009..105785)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0091"
FT                   /product="putative lipoprotein"
FT                   /note="ORF contains 5 membrane spanning regions in addition
FT                   to the lipoprotein signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69598"
FT                   /protein_id="ADK69598.1"
FT                   /translation="MLKRFNQFRQKRSFKLELIISSILLFFAISCLVLYFITKSVGLYN
FT                   KKTLSADVIFLQDITFLSEWYAVFVMIFCSFKISRMLTSKQVYLYKYTEYSFTSWSIFI
FT                   FLLYIAGFIMGQAIINDDKDFPTLYRALAIHVFIPITWIIYFSLFPLNDQKSKKQLWLG
FT                   CLQTFTILCFYSLWLLLRLLPGISLDDKIWINKIPYSFISPYNIGVIKYIFVNIGIFSV
FT                   FIGGYILTYYSNKFIYKKITTSKNIDKTKNYYKITF"
FT   gene            complement(105769..106485)
FT                   /locus_tag="MMS_A0092"
FT   CDS_pept        complement(105769..106485)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0092"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69110"
FT                   /protein_id="ADK69110.1"
FT                   /translation="MQKRTIKSDTIFYSVILFLNLLTNFIYWITHAFNVVYVDEPTNLD
FT                   IVLALDSASIAIWGLWISTFYAGICLYYSFIKKQLYQAYLLQLFIISMLISTGLIFIGI
FT                   SIINKTANINNWSALLRVVNVHFLLPTSMLLYLIFFRTNMIISKKSKLVGMWRILTVGL
FT                   SYISWITYRTIPNVQVNLINKPFLYTSLQPSNIGWVIFMSLSFSSFILYFLTYLIIVLI
FT                   NNKINDKYGGCDAKTI"
FT   gene            complement(106600..109434)
FT                   /gene="secA"
FT                   /locus_tag="MMS_A0093"
FT   CDS_pept        complement(106600..109434)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="secA"
FT                   /locus_tag="MMS_A0093"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF01043; match to protein
FT                   family HMM PF07516; match to protein family HMM PF07517;
FT                   match to protein family HMM TIGR00963"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69199"
FT                   /protein_id="ADK69199.1"
FT                   /translation="MVSDRRLLKKFGKIADKIIALEPQMRQLKDEDFILKTQEFKQMLE
FT                   NGKSLDDILIEVYAVAREAARRVLGLNAYKMQLIGGIILNSGDIAEMRTGEGKTLTGIF
FT                   PAYLNALSGKGVHIVTVNEYLSRRDSEINGKVFDLLGISVGLNGSSLTKTEKREAYNKD
FT                   ITYTTNAELGFDYLRDNMVSDYSLKVQRKLNYCIIDEADSVLIDEARTPLIISGGTSTR
FT                   INLYKAANNFALTLKEHDDLDIDLESKQVYLNEQGMKKANEFFSLKNLFAIENTEIFHL
FT                   IMNALKAQFAFKEGVEYTVRDNEILLIDQFTGRIMHGRSYSDGLQQALQAKENVDIEEE
FT                   TVTLATITYQNFYRLYSKIAGMTGTAKTEEEEFIKIYNTRVIQTPTNKPVIRKDEPDLT
FT                   FGTKNAALKKLVEDVLEAHKKGAPILIGTTSVESSEQIARYLKKANLKFETINAKNHDR
FT                   EAEIVAKAGEIGAITLATNMAGRGTDIKLAKGVAELGGLRVFGVERNEARRIDNQLRGR
FT                   SGRQGDPGLSRFYISMDDDLMMRFTAPKTRQRFKALGDDYIKSKMFTRAVTNAQKKLEG
FT                   MNFDQRKNVLDYDNILAQQREIIYAQRDDILEANDLSVVIEKMQITAAYELIEKHSTLV
FT                   HGEKTINKKELLEVIDGILVPKNKFRIDDFNNKEKMDLAVEIAEAMMQLYKARISDIPD
FT                   DVIIVMERKIILDAFDKHWTKHLDIAGKLKSGIYLQQYAQNNPLAIYIEQATNLFNKMK
FT                   INIANEVVENLANVILRVVEDEEQREERIEVTDKDIEEILFETGLQPSDINNKTINQRF
FT                   DELEEEFKDDKQKLRRLRIQRDVMLGLVLELERRAEMIISPQNDQQAITQLIKELQNDI
FT                   DIASITIDQIHQNFNNMVEQINDPEKLKHLVIAKDVLLQLVARMDDIKEQEKQTRKKKK
FT                   KKPHEDESSKTKIG"
FT   gene            109525..110100
FT                   /locus_tag="MMS_A0094"
FT   CDS_pept        109525..110100
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01205"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69817"
FT                   /protein_id="ADK69817.1"
FT                   /translation="MKTIKKEIYKNEFIIKNSKFITIATNINSKDELEEFLNKYSDINA
FT                   THNCYAYMIYDQKLIGGYNDDHEPKNTAGKPIFNVISKNNLVNIVILVIRYFGGIKLGA
FT                   SVLTRTYSNAASLIIKDLEIIEIKTYYQYLISFDIKNLKLVNQWINQNNIEVISKDFSL
FT                   NVVFKIRSTSKITSCNFFKIIDFKTIKN"
FT   gene            110176..111090
FT                   /locus_tag="MMS_A0095"
FT   CDS_pept        110176..111090
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0095"
FT                   /product="5'-3' exonuclease, SAM domain protein"
FT                   /note="identified by match to protein family HMM PF01367;
FT                   match to protein family HMM PF02739"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69985"
FT                   /protein_id="ADK69985.1"
FT                   /translation="MITNETKPILLIDGYHLLHKGYYGTLKRTIVSKNKDGIVINAIYS
FT                   FVANILKFVQSDRYHSVIVAFDFDENCWRKELYSEYKAKRKPTPIDLIPQLQIARDFLT
FT                   SANISWYEKYNYEGDDVIGSICRIANKLGYDVCILTNDKDIYQLVNNKTSIITNISKKE
FT                   KIKIIKSEQVYEHFLCQPNQVADIKAILGDQSDNIKGVKYIKRKQAESLINKYENVENI
FT                   LDHINELNEPLKTIISENKQLIIDNKKITKILTNVKLGRINFKPTKITYYRLIRFLKEQ
FT                   EMYAFIRPIRKYLERTNKKTVNK"
FT   gene            111283..111804
FT                   /locus_tag="MMS_A0096"
FT   CDS_pept        111283..111804
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69496"
FT                   /protein_id="ADK69496.1"
FT                   /translation="MTAYCIKRDDKWVVLAGSQIRLNNSHFNYFKNMFKSIKEKRDDLI
FT                   FEQKIINGILQEDQEFSSSSYASVFVLGRSSNGKQEWKPCNKIPDLSNSSSKSNSIDKE
FT                   ILYRICKNRRNDKNKKIIAYCKKTNENKFVVLKNSNIEMIKANHFKTKLLYIHNSRKEC
FT                   IKNNFRWCWI"
FT   gene            112341..112943
FT                   /locus_tag="MMS_A0097"
FT   CDS_pept        112341..112943
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0097"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69487"
FT                   /protein_id="ADK69487.1"
FT                   /translation="MKFKRDFYLNQLIDKKHNKKVKVITGIRRCGKSYLLFKLFYEHLL
FT                   SNEVKKDQIITLSLERVDSLKYRNPLKLNEYINSFISDETKQYYVMIDEIQYCETIKNP
FT                   YHENSSYDVTFIDVLLSLVKKENVDVYVTGSNSKMLSTDVLTQFRGRGDEIHLNPLSFS
FT                   EIYDSYSNKQQAFKGYSYFGRMPEVFNLKTEEEKKYI"
FT   gene            113078..113635
FT                   /locus_tag="MMS_A0098"
FT   CDS_pept        113078..113635
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0098"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70112"
FT                   /protein_id="ADK70112.1"
FT                   /translation="MNRFLSENKINISANTIKSYLNYFEDSFIIYSSQRYDVKGGRYYK
FT                   TPLKYYFSDIGLRNARINFRQNEQNHIQENIIYNELKKRGYSVDVGVVVYDDKTLNKRK
FT                   EVRLEVDFVVNQADQRYYIQSALNIDSYEKRDQEITPLKKINDSFKKIVIIGDDIFSKY
FT                   DDNGILYISIKEFLLDENIINR"
FT   gene            114201..114476
FT                   /locus_tag="MMS_A0099"
FT   CDS_pept        114201..114476
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69072"
FT                   /protein_id="ADK69072.1"
FT                   /translation="MSYYYRHNFSFSYHGLQRAKERLKLKDKKDYEVKEICLEHIRNST
FT                   KSFMSGNEIYISASNTNIFFVVNKQNNLIITVTEISAEKQLRMHGV"
FT   gene            114478..115035
FT                   /gene="coaE"
FT                   /locus_tag="MMS_A0100"
FT   CDS_pept        114478..115035
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="coaE"
FT                   /locus_tag="MMS_A0100"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="identified by match to protein family HMM PF01121;
FT                   match to protein family HMM TIGR00152"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69679"
FT                   /protein_id="ADK69679.1"
FT                   /translation="MIIGIYGKIGSGKTYISNKFINFHPEFKIINADDVSKKMLENQEI
FT                   KSKLFEIDNNIIRDDKVDKKYLRKTLFTNKKLKQQVDSLLWPLISKQIQKEIKNNPNTN
FT                   YIIEAALLFELNLTNLDLIVKVKSSLLKSIFRVLKRDKTNIRDILRIRRSQNKSIKRKK
FT                   PDLAISDFYQLEFYIQKNRLLE"
FT   gene            115194..116867
FT                   /locus_tag="MMS_A0101"
FT   CDS_pept        115194..116867
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0101"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69596"
FT                   /protein_id="ADK69596.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRSDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYKMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNNRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            complement(117073..117357)
FT                   /locus_tag="MMS_A0102"
FT   CDS_pept        complement(117073..117357)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0102"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69444"
FT                   /protein_id="ADK69444.1"
FT                   /translation="MFLIKPQFESQPQNIKNGRINSKLDHKQAISKVISYANNNSFDVI
FT                   NLDYSPILGNKKQNIEYLTYIIKKENNYKIWKEEQINQLVNIAWKELKK"
FT   gene            complement(117580..119253)
FT                   /locus_tag="MMS_A0103"
FT   CDS_pept        complement(117580..119253)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0103"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69686"
FT                   /protein_id="ADK69686.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRSDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKREKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYKMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNNRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            complement(119346..119795)
FT                   /locus_tag="MMS_A0104"
FT   CDS_pept        complement(119346..119795)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0104"
FT                   /product="S4 domain protein"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69106"
FT                   /protein_id="ADK69106.1"
FT                   /translation="MKLRLDEYIYKNNLTQSRNKAKEHILNKEVYVNNIAIMKPSFLVD
FT                   SNDLIEIRSTKLEYVSRAYEKLKKAINKWNIDLTNKICLDIGASTGGFTQCCLDNNANL
FT                   VYAVDVGTDQLHQSLLNNLKVINMSQYNFRNAKKQDFLKNPTFPT"
FT   gene            complement(119795..120010)
FT                   /locus_tag="MMS_A0105"
FT   CDS_pept        complement(119795..120010)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69309"
FT                   /protein_id="ADK69309.1"
FT                   /translation="MNNKNKSYDELISEIKEDTKKLSSNEISVEQAMEIFEQNIEKIKL
FT                   AKEKLTQYKGQIYKVMQDDELEEFKD"
FT   gene            complement(120000..121409)
FT                   /gene="xseA"
FT                   /locus_tag="MMS_A0106"
FT   CDS_pept        complement(120000..121409)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="xseA"
FT                   /locus_tag="MMS_A0106"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF01336;
FT                   match to protein family HMM PF02601; match to protein
FT                   family HMM TIGR00237"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69240"
FT                   /protein_id="ADK69240.1"
FT                   /translation="MEKILTVQELNEALKTLIENKQEFKDIYVQGELSNLTFNKSGHIY
FT                   FSIKEQDAAINCMMWKTNAYKIQSLNLEDGMQIICYGRLTYYIPTGRVSFEVRDIQIHG
FT                   IGDLQKIFEQRYKELEQKGWFDPNLKKSIPEFVKNVGIITADSGAAIYDLIRTVHRRLP
FT                   LINIYLFPAQVQGDKAEIDITNKIKQANNFKIDLDVLIVGRGGGSYEDLWAFNELEVLQ
FT                   AIKNSHIPIISAVGHEPDWVLSDYVADIRAATPTAAGELVSKSIIEIKNQLKHYYQNYK
FT                   TLILNKLDFFNEKINNYKKDQTKYIKDNFSFKYLQLKQLSIDNTKWTKNKIDSVIYKLE
FT                   DYKHSINNSIIHIINSQNKALKNYLIADEQKILNYLKKQISEFNYTISSFKGHINQILK
FT                   YEELSFDTLENKLNSLDPLKPLQNGYSIVTNLNHQKIRSYKQVKLNEDLKVILTDSKLT
FT                   VTIKEVKTNEQ"
FT   gene            complement(121411..121809)
FT                   /gene="nusB"
FT                   /locus_tag="MMS_A0107"
FT   CDS_pept        complement(121411..121809)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="nusB"
FT                   /locus_tag="MMS_A0107"
FT                   /product="transcription antitermination factor NusB"
FT                   /note="identified by match to protein family HMM PF01029;
FT                   match to protein family HMM TIGR01951"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69456"
FT                   /protein_id="ADK69456.1"
FT                   /translation="METKISFSKKRKLLIQAFYKYELLNASIDYIHQDILDDVQNIKNK
FT                   DVLFEINQISEKQTDLINHININISSSWKWDRMPAVIRAILIVGTYEILYTNTPKSVTI
FT                   NEMVKYVKEIEPDFDYKFVNAVLDKLVK"
FT   gene            complement(121821..122930)
FT                   /locus_tag="MMS_A0108"
FT   CDS_pept        complement(121821..122930)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0108"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69974"
FT                   /protein_id="ADK69974.1"
FT                   /translation="MKKLLSIITGFSLLIAPGLFAISCSSKVQVISKFDDITSIKNTGA
FT                   FKNNQAFISRNELKEIVSSNDTTSSSTASSTTVMTSTSTTSTSTQTNNNKDAKYASERL
FT                   KALAANNFTKNKKQAWDSLQNASMTFYKKVEPTAVNVLGYEQITKDNVEKLDKELKTVF
FT                   LVFKDNNKETEKLEVELLPEINTNNNNNKVIDNGSLYLDLLEKPENLKLANQKSIIEVL
FT                   RPEIAKIKIVLQNTKNNNSTNKEDIKNTEVFNILIKQLSIYLANAVKYFNSESGIITAD
FT                   PTFSYKTRSNQIYDYIVKNKKDELYKKLENAFTIEFNKINFIDIFKDFQFDDNNSNDNK
FT                   KITTKIIKSSTNSSTFSSNTTEPNSTTTR"
FT   gene            complement(122956..123825)
FT                   /locus_tag="MMS_A0109"
FT   CDS_pept        complement(122956..123825)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0109"
FT                   /product="apurinic endonuclease (APN1)"
FT                   /note="identified by match to protein family HMM PF01261;
FT                   match to protein family HMM TIGR00587"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69071"
FT                   /protein_id="ADK69071.1"
FT                   /translation="MDKILLGCHVSMNKQNNYLVGSVNEAISYKANTFMIFTGPPQSTL
FT                   RTNTNHLYINQMHELMNSYKIDAKDLVVHAPYIINIANSVDQNKWKFTVDFLIQEIKRC
FT                   EEIKIPTLVLHPGSYTTGNYKDSLNQIIKALNIVSNYQVNVKIALETMSGKGTEVCSRL
FT                   EDFKYILDNVKNKDKVGVCLDTCHLHDAGYDLSKWTEFKEQMKQNFSLDKVLCIHLNDS
FT                   KNMISSHKDRHANIGYGYVGFDTLVNVVFDKDFSNISKILETPYIDKTPPYKIEIEDLL
FT                   NKTFTNRL"
FT   gene            complement(123818..124570)
FT                   /locus_tag="MMS_A0110"
FT   CDS_pept        complement(123818..124570)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0110"
FT                   /product="putative riboflavin biosynthesis protein RibF"
FT                   /note="identified by match to protein family HMM PF01687"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69694"
FT                   /protein_id="ADK69694.1"
FT                   /translation="MNNQIIALFCDFKYITTKLLNKFNKDQLIIFGYSLNKDDFDYICS
FT                   NYQLEIFKNQNYKFIDLNNKDIKQLITKYKISKIHITKSFKDLNHFLNIFPNTYIEDDL
FT                   TDINNAKQALINADINSFYNIAGFNYTFSGIVTHCNHLGRTINFPTANILTNDSLVIKN
FT                   GVYLVKVIIDDKNIQFGMGDHWINKNNLKVFETYIFNFSNDIYNSKITFELLDYIRDNQ
FT                   KINSLEQLKTLLNNDKKECLKRLEKYNG"
FT   gene            complement(124645..124720)
FT                   /locus_tag="MMS_A0111"
FT   tRNA            complement(124645..124720)
FT                   /locus_tag="MMS_A0111"
FT                   /product="tRNA-Lys"
FT   gene            complement(124784..126919)
FT                   /locus_tag="MMS_A0112"
FT   CDS_pept        complement(124784..126919)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0112"
FT                   /product="peptidase, S41 family"
FT                   /note="identified by match to protein family HMM PF03572"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69967"
FT                   /protein_id="ADK69967.1"
FT                   /translation="MKITTILSSLFLSSSLSSTPVLTNSFINTTTNKIQTKEFNLDNLT
FT                   IKNNRTSKKIQAFLHNDVFYTSINEFLKNIDSVINYSNLEHSFKDNKTTIKLKNDSNFF
FT                   VEFDYLKKKIIVSNNKIFTKILKNYKRAEEDLKIEFIKEQNLNNTNQFEIDLSKYNIDI
FT                   LKDQNDLYLPSILLNQVFLSKSNIQTYFNGDDFKIFRFYEGLSLPGTFYLKQSDKNNQN
FT                   KIPIGLRRFQYEYLSFLFDNYYAIKLKDNKSYKEYFKKYETQILSESSNEHYLATKKII
FT                   NDLDDPHSAYVLDGYYDKDRNFHKTLFENKQRVKNSDKILDLLARNDPNKIDYVNSFIN
FT                   DDTSVISFSKFDEKSTDYILKSLKQAKENNIKNIIFNLTQNGGGYIGVAFEILGFLTNK
FT                   PFNVYSYNPLSKEKKVETIKSKYENFDFKYYILTSPYSFSAGNIFPQVARDNKVAKLIG
FT                   YKTFGGASAINYYILPTGDIIQLSSNNVFTNDKFESLEFGVTPDVELDVDVYKNPSAIY
FT                   QKETLLDLIKKADSIKETKKEIRTEKLTKILDISKKIENNKTELKTKKPDKVVLKKEEE
FT                   IYKKPDSINHNKAENDEIKNELIKEKTNIESLNIKNLNLGKLDKIDENQILIALKNKNL
FT                   ELDINNLEVKNITNNSAEILQKNTDQKFIVHFLKTPVKTSNKNTIWIVLIIIGLTTLLG
FT                   LINFIIIRKLKTKKLNK"
FT   gene            127169..128518
FT                   /locus_tag="MMS_A0113"
FT   CDS_pept        127169..128518
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0113"
FT                   /product="glycosyltransferase, group 2 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69497"
FT                   /protein_id="ADK69497.1"
FT                   /translation="MLNSQLNTTTTVFFYMTLVIGIIFMLLLSSDWLFFMFAYTKNKKK
FT                   LAKYKPKKNRSFAIVIPAHNESMVVGKLIDSIKAQKYDGIIDIYLVADNCTDNRKTYNV
FT                   GIEKGITVLERFHNTLKGGNFAIRHGWRYIRDNNLLDKYDCFCTFDADNLLDENWVYEV
FT                   NKTFDFYEDIEVVTTYRNSKNYGDNWISSAYSIQFLKESDIINKGRATLNHSSYINGTG
FT                   FCITKKIFEQTNWWDFNSLSHDIEFTQWLMLNKIKTGYTEDACFYDEQPIDFKSSWKQR
FT                   MRWCVGFKQVWKIYRSKMIKNMFTFKVNKIKLWVNFTMIFPAVITLMINLLFYLITSGL
FT                   MVSNYIVNYLNSSLVMVEQVNNYLRDLIIYFTTTPLIILGVIFINYLLWGFIVVTRNKK
FT                   SIQATSWQKFKSIFTYPFFMLTYIPTSFLALFKSTYSTTPIPRKEELVQS"
FT   gene            complement(128678..130351)
FT                   /locus_tag="MMS_A0114"
FT   CDS_pept        complement(128678..130351)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0114"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69333"
FT                   /protein_id="ADK69333.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDDGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNDRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            complement(130392..131372)
FT                   /locus_tag="MMS_A0115"
FT   CDS_pept        complement(130392..131372)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0115"
FT                   /product="glycosyltransferase, group 2 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69971"
FT                   /protein_id="ADK69971.1"
FT                   /translation="MNNKKLCTIIIPCYNMQDFLNKCLDSIYQNKESEKYLDVLIIDDG
FT                   STDNTIKIANKYLKKHNNISIYSKPNGHWGSVINYVKHNKLINTKYAFILDADDRISKK
FT                   FTNLLVNVVDPLNVDLGIFKTKILYKNSVVVNPRWLSKKQKTFLPMIIPCSTIFKTDIF
FT                   YKSVDLVEKVPYQDYVLYSWMYLNSTNVQFLPHTISTYWYSRPNNTMSSSWNDKRVSGE
FT                   KTLLNELKKLNLEHLFLARIVLPGYIKGLSKANIKIAFNKEKVDLLLKNASIFFKLVFR
FT                   INLKRAKRYNVIKWTKDKVDIIFLRFPLSRENTQFSAAIFFYKKI"
FT   gene            complement(131775..132308)
FT                   /locus_tag="MMS_A0116"
FT   CDS_pept        complement(131775..132308)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0116"
FT                   /product="putative UTP--glucose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69957"
FT                   /protein_id="ADK69957.1"
FT                   /translation="MCKGFINNESFAVLLGDDLFKCQTPAIKQLMDLYEEKQSTILGTI
FT                   LIDKKDCKKYGICKIESSDDNVYKVCSVIEKPDEQNAPSNVAIAGRYILTPEIFNYLDL
FT                   QLKGETGEIELTDSILKTISDVDCYAKVIDGKRYDIGNKLGYLEAFVDFALNRDDTKNE
FT                   FIKLVKKINEEETL"
FT   gene            complement(132347..132646)
FT                   /locus_tag="MMS_A0117"
FT   CDS_pept        complement(132347..132646)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0117"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69329"
FT                   /protein_id="ADK69329.1"
FT                   /translation="MAIRKAVIPCAGFGTRFLPFTKSQAKEMLPIIDTPTIEYIVKEAV
FT                   DSGIKEILIILNDKKSEIMNYFSRNIQLEGFLYNKEKSLNLNKLKLNMMQIFTI"
FT   gene            complement(132856..133398)
FT                   /locus_tag="MMS_A0118"
FT   CDS_pept        complement(132856..133398)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0118"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69659"
FT                   /protein_id="ADK69659.1"
FT                   /translation="MKITTILSSLFLSSSLSSTPVLTNSFINTTTNKIQTKEFNLDNLT
FT                   IKNNRTSKKIQAFLHNDVFYTSINELESITNTKELLINLKGLLNNQILIHQNKIKEYQL
FT                   ELKKTNKKILNKLWLWWLLPIIGMFIFFIIYNTRLQNPYYANQLVDIKVKITDLDIKNI
FT                   YIDKLLEEINSSIKLEF"
FT   gene            133648..134997
FT                   /locus_tag="MMS_A0119"
FT   CDS_pept        133648..134997
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0119"
FT                   /product="glycosyltransferase, group 2 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69175"
FT                   /protein_id="ADK69175.1"
FT                   /translation="MLNSQLNTTTTVFFYITLVIGIIFMLLLSSDWLFFMFAYTKNKKK
FT                   LAKHKPKKNRSFAIVIPAHNESMVVGKLIDSIKAQKYDGIIDIYLVADNCTDNRKTYNV
FT                   GIEKGITVLERFHNTLKGGNFAIRHGWRYIRDNNLLDKYDCFCTFDADNLLDENWVYEV
FT                   NKTFDFYEDIEVVTTYRNSKNYGDNWISSAYSIQFLKESDIINKGRATLNHSSYINGTG
FT                   FCITKKIFEQTNWWDFNSLSHDIEFTQWLMLNKIKTGYTEDACFYDEQPIDFKSSWKQR
FT                   MRWCVGFKQVWKIYRSKMIKNMFTFKVNKIKLWVNFTMIFPAVITLMINLLFYLITSGL
FT                   MVSNYIVNYLNSSLVMVEQVNNYLRDLIIYFTTTPLIILGVIFINYLLWGFIVVTRNKK
FT                   SIQATSWQKFKSIFTYPFFMLTYIPTSFLALFKSTYSTIPIPRKEELVQS"
FT   gene            complement(135050..135964)
FT                   /locus_tag="MMS_A0120"
FT   CDS_pept        complement(135050..135964)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0120"
FT                   /product="glycosyltransferase, group 2 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69469"
FT                   /protein_id="ADK69469.1"
FT                   /translation="MNNKKLCTIIIPCYNMQDFLNKCLDSIYQNKESEKYLDVLIIDDG
FT                   STDNTIKIANKYLKKHNNISIYSKPNGHWGSVINYVKHNKLINTKYAFILDADDRISKK
FT                   FTNLLVNVVDPLNVDLGIFKTKILYKNSVVVNPRWLSKKQKTFLPMIIPCSTIFKTDIF
FT                   YKSVDLVEKVPYQDYVLYSWIYLNSTNVQFLPHTISTYWYSRPNNTMSSSWNDKRVSGE
FT                   KTLLNELKKLNLEHLFLARIVLPGYIKGLSKANIKIAFNKEKVDLLLKNASIFFKLVFR
FT                   INLKRAKRYNVIKWTKDKVDIIL"
FT   gene            complement(136367..136900)
FT                   /locus_tag="MMS_A0121"
FT   CDS_pept        complement(136367..136900)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0121"
FT                   /product="putative UTP--glucose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70070"
FT                   /protein_id="ADK70070.1"
FT                   /translation="MCKGFINNESFAVLLGDDLFKCQTPAIKQLMDLYEEKQSTILGTI
FT                   LIDKKDCKKYGICKIESSDDNVYKVCSVIEKPDEQNAPSNVAIAGRYILTPEIFNYLDL
FT                   QLKGETGEIELTDSILKTISDVDCYAKVIDGKRYDIGNKLGYLEAFVDFALNRDDTKNE
FT                   FIKLVKKINEEETL"
FT   gene            complement(136939..137238)
FT                   /locus_tag="MMS_A0122"
FT   CDS_pept        complement(136939..137238)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0122"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69081"
FT                   /protein_id="ADK69081.1"
FT                   /translation="MAIRKAVIPCAGFGTRFLPFTKSQAKEMLPIIDTPTIEYIVKEAV
FT                   DSGIKEILIILNDKKSEIMNYFSRNIQLEGFLYNKEKSLNLNKLKLNMMQIFTI"
FT   gene            complement(137447..137989)
FT                   /locus_tag="MMS_A0123"
FT   CDS_pept        complement(137447..137989)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0123"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69685"
FT                   /protein_id="ADK69685.1"
FT                   /translation="MKITTILSSLFLSSSLSSTPVLTNSFINTTTNKIQTKEFNLDNLT
FT                   IKNNRTSKKIQAFLHNDVFYTSINELESITNTKELLINLKGLLNNQILIHQNKIKEYQL
FT                   ELKKTNKKILNKLWLWWLLPIIGMFIFFIIYNTRLQNPYYANQLVDIKVKITDLDIKNI
FT                   YIDKLLEEINSSIKLEF"
FT   gene            138239..139588
FT                   /locus_tag="MMS_A0124"
FT   CDS_pept        138239..139588
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0124"
FT                   /product="glycosyltransferase, group 2 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69356"
FT                   /protein_id="ADK69356.1"
FT                   /translation="MLNSQLNTTTTVFFYITLVIGIIFMLLLSSDWLFFMFAYTKNKKK
FT                   LAKHKPKKNRSFAIVIPAHNESMVVGKLIDSIKAQKYDGIIDIYLVADNCTDNRKTYNV
FT                   GIEKGITVLERFHNTLKGGNFAIRHGWRYIRDNNLLDKYDCFCTFDADNLLDENWVYEV
FT                   NKTFDFYEDIEVVTTYRNSKNYGDNWISSAYSIQFLKESDIINKGRATLNHSSYINGTG
FT                   FCITKKIFEQTNWWDFNSLSHDIEFTQWLMLNKIKTGYTEDACFYDEQPIDFKSSWKQR
FT                   MRWCVGFKQVWKIYRSKMIKNMFTFKVNKIKLWVNFTMIFPAVITLMINLLFYLITSGL
FT                   MVSNYIVNYLNSSLVMVEQVNNYLRDLIIYFTTTPLIILGVIFINYLLWGFIVVTRNKK
FT                   SIQATSWQKFKSIFTYPFFMLTYIPTSFLALFKSTYSTIPIPRKEELVQS"
FT   gene            complement(139641..140555)
FT                   /locus_tag="MMS_A0125"
FT   CDS_pept        complement(139641..140555)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0125"
FT                   /product="glycosyltransferase, group 2 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69981"
FT                   /protein_id="ADK69981.1"
FT                   /translation="MNNKKLCTIIIPCYNMQDFLNKCLDSIYQNKESEKYLDVLIIDDG
FT                   STDNTIKIANKYLKKHNNISIYSKPNGHWGSVINYVKHNKLINTKYAFILDADDRISKK
FT                   FTNLLVNVVDPLNVDLGIFKTKILYKNSVVVNPRWLSKKQKTFLPMIIPCSTIFKTDIF
FT                   YKSVDLVEKVPYQDYVLYSWIYLNSTNVQFLPHTISTYWYSRPNNTMSSSWNDKRVSGE
FT                   KTLLNELKKLNLEHLFLARIVLPGYIKGLSKANIKIAFNKEKVDLLLKNASIFFKLVFR
FT                   INLKRAKRYNVIKWTKDKVDIIL"
FT   gene            complement(140958..141830)
FT                   /locus_tag="MMS_A0126"
FT   CDS_pept        complement(140958..141830)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0126"
FT                   /product="nucleotidyl transferase"
FT                   /note="identified by match to protein family HMM PF00483"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69519"
FT                   /protein_id="ADK69519.1"
FT                   /translation="MAIRKAVIPCAGFGTRFLPFTKSQAKEMLPIIDTPTIEYIVKEAV
FT                   DSGIKEILIILNDKKSEIMNYFSRNIQLEGFLYNKGKIAELEQIKTKYDASIHYIIQDE
FT                   PLGLGHAISLCKGFINNESFAVLLGDDLFKCQTPAIKQLMDLYEEKQSTILGTILIDKK
FT                   DCKKYGICKIESSDDNVYKVCSVIEKPDEQNAPSNVAIAGRYILTPEIFNYLDLQLKGE
FT                   TGEIELTDSILKTISDVDCYAKVIDGKRYDIGNKLGYLEAFVDFALNRDDTKNEFIKLV
FT                   KKINEEETL"
FT   gene            complement(142039..142479)
FT                   /locus_tag="MMS_A0127"
FT   CDS_pept        complement(142039..142479)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69052"
FT                   /protein_id="ADK69052.1"
FT                   /translation="MQNKSGLILLKEVFINNYSNKIDFLKTIFSDKQINELESITNTKE
FT                   LLINLKGLLNNQILIHQNKIKEYQLELKKTNKKILNKLWLWWLLPIIGMFVFFIIYNTR
FT                   LQNPYYANQLVDIKVKITDLDIKNIYIDKLLEEINSSIKLEF"
FT   gene            142548..143309
FT                   /gene="plsY"
FT                   /locus_tag="MMS_A0128"
FT   CDS_pept        142548..143309
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="plsY"
FT                   /locus_tag="MMS_A0128"
FT                   /product="acyl-phosphate glycerol 3-phosphate
FT                   acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF02660;
FT                   match to protein family HMM TIGR00023"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69706"
FT                   /protein_id="ADK69706.1"
FT                   /translation="MYYLGIILASVIGYFLGSISWSIIIVKKVGNIDIRTVGSGNPGAT
FT                   NTVRTLGKKWGLVVAFLDALKVVFTAIVAILLSMIPNDLFSQTSYFIPCIFALIGHCYP
FT                   IYYKFKGGKAVSCFLGLLFVVNVLYLIIFLIIWFISVAISRKVSVASMFSALIILLIMW
FT                   IPYLSGVSYFIWEWNGLEKFRVAWKNYILFSLLNSFHYWFSNTWASGILEGNIIILIGG
FT                   LILAWRHSQNIKRIKNKTEPDTFPKKVKPVR"
FT   gene            143373..144911
FT                   /locus_tag="MMS_A0129"
FT   CDS_pept        143373..144911
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0129"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69171"
FT                   /protein_id="ADK69171.1"
FT                   /translation="MSLIVLENITHQNGEKILYKNSEMRINKGEHVALIGPNGAGKSTL
FT                   LNIIAQKITPDHGTIQWHPKAKIGYLDQHQEVDPNITSEEYLKDAFKNLFEIEAKIHKI
FT                   YENMAIEYKESDLIKALELQDYLTSHNFDTIDKTIGNLVSGLGINPNNMKKKLSELSGG
FT                   QRGKILLAKLLLKNDDFILLDEPTNFLDIEQVEWLINFLNNYENAFLMISHDVEFINRV
FT                   AKIIYAIENQKINRYVGDYNKYLELSALKADQYDKARESQQQQIAKLKDYIARNAARFS
FT                   TAKSAQSRQKQLDKMDVLDERKKLVKPKMSFKYKRPNSAVVVKSQNLEIGYNFSLTAPL
FT                   TFELREGQKCIVKGYNGIGKTTFLKTISNQLKPISGWCKLGDGVEVRYFEQVEKFHEYE
FT                   TPISYLSSRHKEVLDPEIRATLSRFGIKSELMLNPMSDLSGGEQTKVRLASLSLEPASL
FT                   LILDEPTNHIDVLAKESLLEAIKEFQGTVLITTHDINFETNWADKVLNFEDLVE"
FT   gene            145924..147150
FT                   /gene="ilvA"
FT                   /locus_tag="MMS_A0130"
FT   CDS_pept        145924..147150
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ilvA"
FT                   /locus_tag="MMS_A0130"
FT                   /product="threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR01127"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69785"
FT                   /protein_id="ADK69785.1"
FT                   /translation="MSHPFSVDEIKQIHQEISKIIHYTPLHYADKLSALTGNNIYLKLE
FT                   NLQKTGSFKLRGATNKINKLTNEEKEHGIIAASAGNHAQGVAYAATNLGLKSTIVMPEN
FT                   APMAKIQATEKYGGKVVLSGRFFDDALAKAIELKEKENLTLIHAFDDIEIIKGQATIAY
FT                   EIDQQIKNIDYCLVPIGGGGLMSGIATYLKQVNPNIKMIGVEAANVNSYQQAKALSRPV
FT                   MVDSKPSIADGIAVKKVSDLTFSILNQYVDDVVVVSEEEIAEAMLFLMENCKFVTEGSG
FT                   AVTAAALMFDKLNIKNQNKTIVGLVSGGNIDIAMVGNIINKALIKTNRRLVLSVNITSD
FT                   NKEILKIINIINSCGAKIFKIKTNRDIMYLELSEIHATFIIDLSNTDQQQQIIDKIIQA
FT                   NYKITSITD"
FT   gene            147407..148948
FT                   /locus_tag="MMS_A0131"
FT   CDS_pept        147407..148948
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0131"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69317"
FT                   /protein_id="ADK69317.1"
FT                   /translation="MIIFWILVGITTTLVYNLEWFIQKVIIFNGSLQADLNMGTAIIDK
FT                   NLTIVFSEHNIKKIDDFYIKLNDVIDKENHIITKYYNININSAFKKEGLLFSAAALIAS
FT                   FISGPILVYAITKKKTYKFFILPILLGLSIMMFFIMPVISSVLLLATVFTPLFGMLYSY
FT                   RTALDSWATSVARKTNVKISFVRGFYEVGAGLGSIGLTQLLLHLNYYKRTISWADATPH
FT                   YVVGAFYVILTIFLWLFMPDNIFDKLHVKEERVSQKKYEEVKQANKLNQELTLKQIILN
FT                   KNFIIGLIFFLIVIGTVQAFGSIWVNTVENFTSTTKSFNSPQHIGYQKAFSIPVQLLLS
FT                   YLILQVVTKIKLKQFLLWAAILASISWFGIGTIVYIVKPKNPIIISLIGGIGGAVTGTL
FT                   AVALGYEFISRVTTINTRPATFVVFNSITYGFGGIIFVGVNTFLSKTPAFGISGTGGYW
FT                   VWLICGISCLFAILLLLFFFKEPEFITREIDDKTFNKHLLVPSHHNPDKPKQTKK"
FT   gene            148960..149820
FT                   /locus_tag="MMS_A0132"
FT   CDS_pept        148960..149820
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69533"
FT                   /protein_id="ADK69533.1"
FT                   /translation="MILSLYVWLQIRKKLKRKVSYQESLDFEYQIANENGYNFDHLDLS
FT                   GFNKEYKTINTRFGKLKIFKHGTGDTVIIYCHGILSNNRNAIKFLDYCFSRNITLISYD
FT                   NFGWGESDKFGKCTLGIKEADLLKDVIDFIKKDLKPKKLVIYGESMGGGTVYSFISKYN
FT                   NKIADKFIVDAGYNSFLDIAIQSGFKKVWYFIYLSYLFLPILFKLSHYPVKRFIKKQDF
FT                   KNLDNVLHIQSTGDALVDYKHFKKHLKYLKNKHIYSKPIRHCMGIDYLRDEHYSVLDDW
FT                   IEIKK"
FT   gene            150096..150812
FT                   /locus_tag="MMS_A0133"
FT   CDS_pept        150096..150812
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0133"
FT                   /product="putative lipoprotein"
FT                   /note="Tandem dinucleotide repeats of TA occur 5' of the
FT                   ORF in a putative promoter region; this tract is possibly
FT                   subject to indels governing phase variable expression of
FT                   the gene"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70012"
FT                   /protein_id="ADK70012.1"
FT                   /translation="MSIKSLLTILSSLMISASGVGLVVACTKTDSTQAPSTNQNKDKDK
FT                   KDGNGKSEEKPKVISKSQWSDAFRDSITGWDIENYDFSKPNNNQNLPKFPKQNIEVGTY
FT                   SKKQVLDNSALHSSIKKKIDEILKIEEKSLKVENVYFDDESGKAIVKSTKFSDTLKVTF
FT                   LVKENLELGAYTKDQILDNSKFHSTIKKKIAEILKVDESTLTVLDVYYEDKTGGGVVKS
FT                   TKLPNEIKFIFSVKEK"
FT   gene            151213..152544
FT                   /locus_tag="MMS_A0134"
FT   CDS_pept        151213..152544
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0134"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="identified by match to protein family HMM PF07672;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69758"
FT                   /protein_id="ADK69758.1"
FT                   /translation="MLFIANWGFSVTLAGSGVSNGTVHPGFLGYFGIENNRGFQVLNQI
FT                   SNWSITLGRAIGSVLIALLLAKFAHKYTTIIALSMTLAGIPAAFMPATRSGYALFLILR
FT                   TIMAIGGTTLVILTQPVVANFFGAKQKSIVSQFGIWFYPLGTIVSILPAFLVSIPDSVR
FT                   NQWQLIITLLAALNIISLILFILIGTKFDIKKDEPKVKVNGWKILCSYIKKKQTYAWVL
FT                   LYGGWLCIAVFLTSLTIPIFNGLSNANGSFNKFIQGWQIAFLAAVFVGPISLGLWSRKQ
FT                   AKRRWFIACAITMGIVLFVLSTLTFVFGVAKYGKSQNNSMFVFSAIMFVILGFLTGLCV
FT                   WGIQGVMLNMPHEYKEADPKTIGWMFSLIWGFGYMFFTVVLIIISGVTLLQGLDKVLVS
FT                   SIQLVIIIVATLISLIGILMLKEPHPEYPMFPTKKDSTKNVSIK"
FT   gene            152815..152967
FT                   /locus_tag="MMS_A0135"
FT   CDS_pept        152815..152967
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69327"
FT                   /protein_id="ADK69327.1"
FT                   /translation="MIGHIIDGEFIKKEEIKKEISFKYYGDYELAKSVSQDIWNDLKEV
FT                   SHIAA"
FT   gene            153141..153929
FT                   /locus_tag="MMS_A0136"
FT   CDS_pept        153141..153929
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0136"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69929"
FT                   /protein_id="ADK69929.1"
FT                   /translation="MLKNNNSRINSLNDFSFKSKLKNSKNISILIAFNVTTRDVICSLP
FT                   YSGNCVDVTSFPDFLEKTGINKGIIIGDKGINSSALMFNVGFIHPLKRSLKLLEEIDAY
FT                   NMKDKINSKDEPTWCKKIFHNGLYYYAFRNLKHASREEHDFMSSKKFSKERYEKIKHKF
FT                   GTIVYVSDQDIICEDALNLYKQRWEIELVNDFYKNTLELETVRQHDDYSVYGDEFLNML
FT                   TLIIGNRIKNKFADSRILETKTYRDVMKIFKQYKKNTNAI"
FT   gene            complement(154136..154288)
FT                   /locus_tag="MMS_A0137"
FT   CDS_pept        complement(154136..154288)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0137"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69453"
FT                   /protein_id="ADK69453.1"
FT                   /translation="MINVIKEVKEIEVFVNKQKIETIQVYNDELQESWQTYQILLELLT
FT                   KEKVT"
FT   gene            complement(154290..155117)
FT                   /locus_tag="MMS_A0138"
FT   CDS_pept        complement(154290..155117)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0138"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70050"
FT                   /protein_id="ADK70050.1"
FT                   /translation="MATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIA
FT                   DKGMSVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASS
FT                   YNKKRINGHFRRQIISFSQKRATKDKNDRDILIQNFTKKMNKDNLVSCDDLAGSKKYIF
FT                   FKPINKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLK
FT                   GKLSGTVPNVFINLKPYCWLHLFMFHFISVFKLHHLHSKFKIRTDWKKQNHWA"
FT   gene            complement(155120..155812)
FT                   /locus_tag="MMS_A0139"
FT   CDS_pept        complement(155120..155812)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0139"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69544"
FT                   /protein_id="ADK69544.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFNYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKMMYYDLTQQLLILKHFLVKVIKNLVIQKME
FT                   NLKKTRLL"
FT   gene            complement(155904..156395)
FT                   /locus_tag="MMS_A0140"
FT   CDS_pept        complement(155904..156395)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0140"
FT                   /product="putative lipoprotein"
FT                   /note="Tandem dinucleotide repeats of TA occur 5' of the
FT                   ORF in a putative promoter region; this tract is possibly
FT                   subject to indels governing phase variable expression of
FT                   the gene."
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69091"
FT                   /protein_id="ADK69091.1"
FT                   /translation="MKKLLTILGSVGLVATTSAAVIACGDKTPSTKSAGKVENKEKTKP
FT                   SEAPKKEEKKEDKNNEENQKNKSKPINPENDRKNSELIKAIVKKQKDAFATFHTRKDFL
FT                   DQIKVFAKEEGIKNLELANGDEDTTFVEGKNKPENKVKLRLGTYEFDVELGDVLPTFPT
FT                   "
FT   gene            complement(156475..157887)
FT                   /locus_tag="MMS_A0141"
FT   CDS_pept        complement(156475..157887)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0141"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69722"
FT                   /protein_id="ADK69722.1"
FT                   /translation="MAIPKDILKIPRPSSTRVKTTSKEGIYNVIQRTSIRKNGKIIPVE
FT                   KGVIGKIINGVFQSIEKQTYEVDIKSYGLFALNEKLNNHIFRELLNFYDFEDARKLYVI
FT                   ASLRTMFSDIKNEHLKHEYDTNFISEIYPKCALSSNTISSFLEKIGKSSSKMEDFMNKR
FT                   LEEFSNHSIVIDGMLKNNTSETNIFSEMSRKSRTKGSQNLNLIYAYDINAQEPVASSVY
FT                   PGNMLDYTAFRDFLRTYEIKNGFLILDKGFDDKECKNLMREKNIKYLIPIKINHTFKKF
FT                   NLKSGFNFTFTYDDDTIRAKKIIINNKYYFCYKSTLTEMVEKKNFISRAHKKGAYDEIK
FT                   LLERENLFGLIIFECNYDLDLKDIYVAYKKRWEIELLFKQFKNVLEQNEANVQGNYRLL
FT                   ATKFINFLSSIMLCRIKNHLLNSSVLDNRTISETFRYLSKIIKKRKSRKREEWDDVETL
FT                   KYIKEMKSILKI"
FT   gene            complement(158447..158572)
FT                   /locus_tag="MMS_A0142"
FT   CDS_pept        complement(158447..158572)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69642"
FT                   /protein_id="ADK69642.1"
FT                   /translation="MKSTKYSDVLTFTFSNTLDLGKFKKENNAVSQLKVKKKQKF"
FT   gene            158535..158957
FT                   /locus_tag="MMS_A0143"
FT   CDS_pept        158535..158957
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0143"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69170"
FT                   /protein_id="ADK69170.1"
FT                   /translation="MNVRTSEYLVDFTVPLPLSFSYSIFKSVSVDISVFVNFAIFFLIS
FT                   YCEKLLYLFSSLKKPPKSKFCIGNFVSFGFSSSCSCFSFNFFSSSIFFFSSSSSVSFGF
FT                   TGDSEFWLLSVFSFLSDLSSLSLIELGGSSGLKFAG"
FT   gene            159288..159788
FT                   /locus_tag="MMS_A0144"
FT   CDS_pept        159288..159788
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0144"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70104"
FT                   /protein_id="ADK70104.1"
FT                   /translation="MNNEYFENIGFIHPLKRSSKILDKIDAYNMSEKLDDKENPTWYKK
FT                   VFYENKYYYCFRDVKRAFKEEHDFMSSKKFSKERYDKMKHKFGTIAYVSDQNIICQKAL
FT                   NMYKQRWEIELVNDFYKNTLELDSVKVDDDLSVYADELLIIGYRIKINLKMQVYLKLKH
FT                   IEK"
FT   gene            159788..159904
FT                   /locus_tag="MMS_A0145"
FT   CDS_pept        159788..159904
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69627"
FT                   /protein_id="ADK69627.1"
FT                   /translation="MKIFKQYKKVQIPDKPDIWYLTGVAKKNEEIINKVLYS"
FT   gene            160264..161037
FT                   /locus_tag="MMS_A0146"
FT   CDS_pept        160264..161037
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0146"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69966"
FT                   /protein_id="ADK69966.1"
FT                   /translation="MAIPKDILKIPRPSSTRVKTTSKEGIYNVIQRTSIRKNGKIIPVE
FT                   KGVIGKIINGVFQSIEKQTYEVDIKSYGLFALNEKLNNHIFSRTPYFGLKSRKWGFYMS
FT                   KLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRFEAFGIEGLINKEKKPY
FT                   YSAKLKLKIVLYKLETNHSYDEVAKKFNIIYSSTIAGWVKKYREYGFLGLNNNIGRPKK
FT                   IMKNPNKKPAKIKKSQVKINNEQQINRIKRTSGIL"
FT   gene            160991..161113
FT                   /locus_tag="MMS_A0147"
FT   CDS_pept        160991..161113
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69411"
FT                   /protein_id="ADK69411.1"
FT                   /translation="MNNRLIELKEQVEYYKLEAEFWKKFHTLLTKEKSTRKKQK"
FT   gene            161122..161304
FT                   /locus_tag="MMS_A0148"
FT   CDS_pept        161122..161304
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0148"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69896"
FT                   /protein_id="ADK69896.1"
FT                   /translation="MLKTHKKVKIPILLKIAKLPKSSFYEWKHKLENTIDKDKELKEMI
FT                   VDIFANHLKRMGIEG"
FT   gene            161307..161981
FT                   /locus_tag="MMS_A0149"
FT   CDS_pept        161307..161981
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0149"
FT                   /product="putative transposase InsK for insertion sequence
FT                   IS150"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69259"
FT                   /protein_id="ADK69259.1"
FT                   /translation="MALKSKGYIVNHKKILRLTKELGVQCIKFRTKNGRYSSYKGTVGK
FT                   IADNVLKRNFHSLQANKLWCTDVTEFKVNGQKLYLSPIIDLYNDEIISYSIQTNPNLNL
FT                   TNSMLDKALKKVKNTNGLLIHSDQGFHYQHISWAKKLEENNITQSMSRKGNCLDNAIIE
FT                   NFFGLLKQEIYYGEKYNSVEELTKRIHKYIYWYNNIRIKEKLKGLSPVQFRKQSCYNIE
FT                   KF"
FT   gene            162263..163030
FT                   /locus_tag="MMS_A0150"
FT   CDS_pept        162263..163030
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0150"
FT                   /product="putative glucosamine-6-phosphate deaminase"
FT                   /note="identified by match to protein family HMM PF01182"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70062"
FT                   /protein_id="ADK70062.1"
FT                   /translation="MKIIIFDKIKDLQEYCAQLFIDQVKQNPFAKIGFATGVSPIDCYK
FT                   LIIKYSKQNNISWKNVTTFNLDEFVNISKDHKQAFIKQMKDNLFDHLDINPKNINFLDC
FT                   QTNDPKKECQRYENLIRSVDGIDFQYISLGINGHMAYNEPNTSFNTDTHVVKLTKETIL
FT                   DMVNKKKFNSLNDCPTHAMTMGIQTLLNWTKKAIMVSYGIHKALVTKQMIEDKPNEQIT
FT                   ASFLQLHKDCTYILDKDAASLLDKKYLEIAERR"
FT   gene            163034..164707
FT                   /locus_tag="MMS_A0151"
FT   CDS_pept        163034..164707
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0151"
FT                   /product="phosphotransferase system, EIIC"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69413"
FT                   /protein_id="ADK69413.1"
FT                   /translation="MHNLKTKTKKDKENSFYNNLLNALQRLGKTLMFPIAVLPIAALLA
FT                   RFGALIQDPLANGGSNISEIQKFIGLVIATPGQIVFDNLAIIFAIGISFGLAKDNRGEA
FT                   ALVGGIVWFGMTALLKEGLIPTFIWKNVLTSDKLLIKQGEQMVPATQLLYFLRNNTVKY
FT                   QLDSGVVGGIVVGCLVALIYNKYKDVTLPQALSFFGGRRFIPMLGVLMIVPLGLGFAII
FT                   WPWAQFILIKIGTTLSQANGFAKGFAVGTYGFLNRIVQPFGLHHILNTFVWFQLPIEGK
FT                   LLADGSTTIINGDITAFQKGLIGSGLFTSGFFPLFLGGLPGVALALILASDKDKKKQMT
FT                   AFYGGSAFVAWITGIDEPLIFNFIFISPILYVLNALFTGIFYMFVTWSQIALGIGFSAG
FT                   FIDYVVSFWTSWQISTKIGWYANPLWIWVFAIAMFGLYFTTFYFLIKKLNIPTPGRENQ
FT                   LGFKKEVLEPITSNNKQNKYEIMAKRILDIVGEDNIELVESCSTRLRLTVKNNSKQVID
FT                   DEKIKQVGAFGVVRLGKNNYQIIIGTDVEHVADKLKEILN"
FT   gene            164838..166289
FT                   /gene="gltX"
FT                   /locus_tag="MMS_A0152"
FT   CDS_pept        164838..166289
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gltX"
FT                   /locus_tag="MMS_A0152"
FT                   /product="glutamate--tRNA ligase"
FT                   /EC_number="6.1.1.17"
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69850"
FT                   /protein_id="ADK69850.1"
FT                   /translation="MSFRLRYAPSPTGFLHIGNTRTALMNYLFAKHYNGSFIVRIEDTD
FT                   LARNVDGAIESQFENLNWLGIFPDESIFNVGDQKYGKYMQSQKFDRYKQLAEQLVNQNK
FT                   AYRCFCSSEELEKDYEEQTSKEIIATKYSQKCLFLTQDQISQNLKDKKEYSIRFKVPQN
FT                   KVWTINDIVRGDVSFDSKDLGDFVILKSNGVATYNFAVVIDDYDMQITHVLRGEEHISN
FT                   TPRQMMIYDAFNWNYPKFGHLTLIVDNTGKKLSKRSGNALFFIEQYKKQGYLSQAIFNY
FT                   IALLGWSPPGEQEILSQNELIKIFDEKRFSKSPSTFDMVKMKWINSVYMKKLEDNEYLE
FT                   FVKSFINTNKFDITSKSEAWLNHLLLLYKKELEYAEQINDHLDLFFNKNTLDNNTIDVL
FT                   NNLTNYKNVVEIFKNQINDLKDWTIENIKQIIKDTSTLANVKGKDLFMPIRIFATKSEH
FT                   GPSLADVIYLLGKTTVLNNINSLER"
FT   gene            166292..167506
FT                   /locus_tag="MMS_A0153"
FT   CDS_pept        166292..167506
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0153"
FT                   /product="HD domain protein"
FT                   /note="identified by match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69922"
FT                   /protein_id="ADK69922.1"
FT                   /translation="MYLKVIRDNVHGDIYFDDVIYIQLINTYEMQRLRRILQLAGTQLA
FT                   YSSATHTRFSHCIGTYYILKEFFKNKAFLKINSYEQKLVKIAGLLHDIGHGAFSHTFEK
FT                   ITHKNHEQYTSEIILNKKGNIYPILKKHHINPQDIVDIINGTYKNKIINLLVSSQIDAD
FT                   RFDYLKRDSISCGVDYATLDFKWMIRNAFIIGDKIVFPKKTIYAIESYLLGRYHMYQQV
FT                   YNHKTSTIFDAMFISWFKRVTDLFNNDYKFKDNRIIELFSNLFYNKDIDLDSYLKIDDY
FT                   LMFDIFKNCSSEKDVILSDLSKRLTDRKLFTIRDEKLINKTTIINKLNKLGLDPKYYLL
FT                   ETNIKPLSMYNPVIKNNKDENIYLYDSNNQQVHELSYYSKLVKFFQKSNSQKNLRKIIF
FT                   PKEIV"
FT   gene            167532..167960
FT                   /locus_tag="MMS_A0154"
FT   CDS_pept        167532..167960
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0154"
FT                   /product="putative DNA-directed RNA polymerase, delta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69402"
FT                   /protein_id="ADK69402.1"
FT                   /translation="MSKVRNLDLVYSYLQSTKTPSSLNEIWKSISKDIISQKKDEISVI
FT                   AGLYGDMVLDNRFALTTDNLWALSSNSSVENIKKQYDDFIITDHKHRYSDLDEELTIDD
FT                   EMLLDEDYDSDFTQELDDFDEDFDDTDQTYIDDDEYNR"
FT   gene            168051..169649
FT                   /gene="pyrG"
FT                   /locus_tag="MMS_A0155"
FT   CDS_pept        168051..169649
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pyrG"
FT                   /locus_tag="MMS_A0155"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF06418; match to protein
FT                   family HMM TIGR00337"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70097"
FT                   /protein_id="ADK70097.1"
FT                   /translation="MAKFIFVTGGVVSGLGKGITASSIGALLKASGLKVFMQKFDPYLN
FT                   VDPGTMSPYQHGEVFVTKDGGETDLDLGHYERFIDEELTKLSSTTSGKIYLSVIQGERK
FT                   GVNSGKTIQVVPHITDAIKQKVYQAAKQSQADVIISEIGGTVGDIESQPFIEAIRQIRL
FT                   EQGKENVMFVHVVLLLWLAASKEYKTKPIQNSVKAMASLGIQPDVIVCRSDSSSPKDIK
FT                   EKISLFCNVPITNIIDAIDQDSIYRVPLALAKQNLQDIIIEQLQLKAKNIDLSLWKQFN
FT                   KKIDSSTEEIEISFVGKYIELQDAYLSVLESLKIAGWEFNKKIKIRWVQADKLDESNYK
FT                   EVLKNSQGILVPGGFGKRGIEGMMLASRYARENDIPYLGICLGMQIATISIARDLLNWS
FT                   DADSTEFNKNTTHPIFDYIKGIDRDNIGGTLRLGTMVTKLEKNSLVSKLYNSDIALERH
FT                   RHRYEFNNEYKKDLESVGLRFSGIYEEKNIVEVVEMPSLKFFVASQFHPEFTSRPNKPT
FT                   PLFKGFIKAIVENNK"
FT   gene            169883..170845
FT                   /locus_tag="MMS_A0156"
FT   CDS_pept        169883..170845
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="This ORF has 2 membrane spanning regions. This ORF
FT                   contains tandem Palindromic Amphipathic Repeat Coding
FT                   ELements.; identified by match to protein family HMM
FT                   PF03382; match to protein family HMM TIGR02167"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69112"
FT                   /protein_id="ADK69112.1"
FT                   /translation="MKKILKLIPYSIITSLSIPLSFTFWKNQETISLFSQDTRKVNPNH
FT                   EYNEDKTEIKKIGYYKHPNTNKVTIRPIPYYVKKVATELPTEIESLYRAFAYRYSHHDP
FT                   ITGFENWDTKNVKDMSYVFFENHIINTDLSAWKTDNVTNMTGMFKNATKFDNGGKSLSW
FT                   TTNNVESMESMFDGAESFKQNLMSWNVEKVTKNKNFSRASGIFSDENKKPKWKNLKEND
FT                   PVIKKEENITPKVIIHPTPTPKPKVTLPLAKIINRTNETKPTLKPNSGQELPKSNITTS
FT                   KQENKKLSTPAIVGIVVGSQVVLTSLAAGIPYLIKRFKK"
FT   gene            170977..171828
FT                   /locus_tag="MMS_A0157"
FT   CDS_pept        170977..171828
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="This ORF has 1 membrane spanning region. This ORF
FT                   contains tandem Palindromic Amphipathic Repeat Coding
FT                   ELements.; identified by match to protein family HMM
FT                   PF03382; match to protein family HMM TIGR02167"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69646"
FT                   /protein_id="ADK69646.1"
FT                   /translation="MKTQKTEQPHKYKEGDRTEIVQIGFYKRGNEITIKQIPYYVKKVP
FT                   DKLPDEIQSLYRAFAHRYKDQNHPTVTGFEKWDTSKIKNMSYVFYDNQLIDADLSEWKT
FT                   SNVTNMDGMFKNAIKFNNKEKPLKWNTEKVESMESMFDGAESFKQNLKDWKVDKVTKNK
FT                   NFSRASGIFEHIDKKPSWKITEHNDPIIKKPESTEPKVIIHPSPSRPKQTIPLTKLINP
FT                   IIKSTPNSNQNLGIPKTNLSTTPQQSKKLSTPAIVGIVVGSQVVLTSLAAGIPYLIKRF
FT                   KK"
FT   gene            complement(171867..172727)
FT                   /locus_tag="MMS_A0158"
FT   CDS_pept        complement(171867..172727)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0158"
FT                   /product="putative transposase InsK for insertion sequence
FT                   IS150"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69302"
FT                   /protein_id="ADK69302.1"
FT                   /translation="MLKTHKKVKIPILLKIAKLPKSSFYEWKHKLENTIDKDKELKEMI
FT                   VDIFSKSFETYGYRRLKMALKSKGYIVNHKKILRLTKELGVQCIKFRTKNGRYSSYKGT
FT                   VGKIADNVLKRNFHSLQANKLWCTDVTEFKVNGQKLYLSPIIDLYNDEIISYSIQTNPN
FT                   LNLTNSMLDKALKKVKNTNGLLIHSDQGFHYQHISWAKKLEENNITQSMSRKGNCLDNA
FT                   IIENFFGLLKQEIYYGEKYNSVEELTKRIHKYIYWYNNIRIKEKLKGLSPVQFRKQSCY
FT                   NIEKF"
FT   gene            complement(172736..173278)
FT                   /locus_tag="MMS_A0159"
FT   CDS_pept        complement(172736..173278)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69791"
FT                   /protein_id="ADK69791.1"
FT                   /translation="MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRF
FT                   EAFGIEGLINKEKKPYYSAKLKLKIVLYKLETNHSYDEVAKKFNIIFSSTIAGWVKKYR
FT                   EYGFLGLNNNIGRPKKIMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLKAEFWK
FT                   KFHTLLTKEKSTRKKQK"
FT   gene            173479..174372
FT                   /gene="fba"
FT                   /locus_tag="MMS_A0160"
FT   CDS_pept        173479..174372
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="fba"
FT                   /locus_tag="MMS_A0160"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167; match to protein
FT                   family HMM TIGR01859"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70008"
FT                   /protein_id="ADK70008.1"
FT                   /translation="MPKLYHKKLVNAKQMVIDAHRHRYAIGHFNINNLEWTKAILEAAE
FT                   ASKTPVIIATSEGAIKYMGGVNTVVGMVNGLLDYLNITVPVALHLDHGQSLEMAKKCIL
FT                   AGYSSVMFDGSHFPYAENLEMTKELIKFAEEYEVSVEAEIGSIGGEEDGVIGQGELGDP
FT                   LQAEEISKTGITMLAAGIGNIHGKYPSWWQSLSFDTLERLQKACKMPMVLHGGSGIPQE
FT                   QVKKAISMGIAKINVNTELQLAFRDATRKYVEERKDLDDAKKGFDPRKLLKPGYDALKT
FT                   TFLELTNWFGCQGKAK"
FT   gene            complement(174512..176185)
FT                   /locus_tag="MMS_A0161"
FT   CDS_pept        complement(174512..176185)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0161"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69383"
FT                   /protein_id="ADK69383.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKKSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNNRNILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            176384..176926
FT                   /locus_tag="MMS_A0162"
FT   CDS_pept        176384..176926
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0162"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69591"
FT                   /protein_id="ADK69591.1"
FT                   /translation="MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRF
FT                   EVFGIEGLINKEKKPYYSAKLKLKIVLYKLETNHSYDEVAKKFNIIYSSTIAGWVKKYR
FT                   EYGFLGLNNNIGRPKKIMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEFWK
FT                   KFHTLLTKEKSTRKKQK"
FT   gene            177065..177796
FT                   /locus_tag="MMS_A0163"
FT   CDS_pept        177065..177796
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0163"
FT                   /product="putative transposase InsK for insertion sequence
FT                   IS150"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69135"
FT                   /protein_id="ADK69135.1"
FT                   /translation="MIVDIFSKSFETYGYRRLKMALKSKGYIVNHKKILRLTKELGVQC
FT                   IKFRTKNGRYSSYKGTVGKIADNVLKRNFHSLQANKLWCTDVTEFKVNGQKLYLSPIID
FT                   LYNDEIISYSIQTNPNLNLTNSMLDKALKKVKNTNGLLIHSDQGFHYQHISWAKKLEEN
FT                   NITQSMSRKGNCLDNAIIENFFGLLKQEIYYGEKYNSVEELTKRIHKYIYWYNNIRIKE
FT                   KLKGLSPVQFRKQSCYNIEKF"
FT   gene            complement(177855..178445)
FT                   /locus_tag="MMS_A0164"
FT   CDS_pept        complement(177855..178445)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0164"
FT                   /product="conserved domain protein"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69421"
FT                   /protein_id="ADK69421.1"
FT                   /translation="MFVSGLLRTYLFRFIFSAPAGKIADKTGKYIKFLMTGILIGTFLV
FT                   TTVLLLPGFRVGWIIEKAPKWYLWTVRVIVYTFFLCLGALCWGLVTNRWATLFEIGIDR
FT                   KHYASAVGIVSVVAFTPDAWFQQLQAVLIAKYKVADPLIKGGYNNQFAYQILMIIIVVI
FT                   SLVGFAAGALLIYLNNKDKKMAQIQTQVQQIKK"
FT   gene            complement(178408..178686)
FT                   /locus_tag="MMS_A0165"
FT   CDS_pept        complement(178408..178686)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0165"
FT                   /product="conserved domain protein"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69906"
FT                   /protein_id="ADK69906.1"
FT                   /translation="MIYMFCGLIALTVILLIFTVKEDKSEKEENTSFNIKDVFGILKNV
FT                   KIWLVSLVVMGVYMYQMVKYFSILFRSITTSCCSCYVCKWIIKNLFI"
FT   gene            178718..178915
FT                   /locus_tag="MMS_A0166"
FT   CDS_pept        178718..178915
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0166"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69569"
FT                   /protein_id="ADK69569.1"
FT                   /translation="MFFPANKGVSTKNKIYPIETKTVPANPLKLPCIPFKIPFCSGLPC
FT                   WDNNFHNGAQKIILAKAQIE"
FT   gene            complement(178986..179351)
FT                   /locus_tag="MMS_A0167"
FT   CDS_pept        complement(178986..179351)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0167"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70035"
FT                   /protein_id="ADK70035.1"
FT                   /translation="MTKTTKPNPFTNFINKTFKTFDKKTLFVIMLLAVSDTLVFIFPSY
FT                   LRNVMSSEVISLYLGVKTEHLSQASAIYGYISLAIYFFGSILGDKLSVKWLTIIGLATF
FT                   GVSGAWYGSIGLTAGGL"
FT   gene            179945..180649
FT                   /locus_tag="MMS_A0168"
FT   CDS_pept        179945..180649
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0168"
FT                   /product="glycerophosphodiester phosphodiesterase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69116"
FT                   /protein_id="ADK69116.1"
FT                   /translation="MILVAHRGFRGLYGENREYDFKNALTICKAVEFDIRLTKDDKIII
FT                   FHDHNFKRIGNLNRGVKTLTYDEITKIPYFVENPLATPILFEVFMDRYLDQYEMINVEI
FT                   KPDHYTEDELDIIFNAIKKYCNKGVEIIVSSFSPVVLKEILKRKGNYYKSGYLFEKMSQ
FT                   FDVELGKKFDFLHPPITLLKKQSNCELFKKLNIPLNVWTFKKMSDVEILHKMYKDLING
FT                   YISDYPDLYPKN"
FT   gene            180810..181088
FT                   /gene="rpmE"
FT                   /locus_tag="MMS_A0169"
FT   CDS_pept        180810..181088
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmE"
FT                   /locus_tag="MMS_A0169"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by match to protein family HMM PF01197;
FT                   match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69640"
FT                   /protein_id="ADK69640.1"
FT                   /translation="MPKIDIQPKYFDQAKFICTTCASEWVCGTSKGEEVRVDVCSNCHP
FT                   FYTGAQTYTNVAGRVEQFKSKFAKRDTIKAQVEKQSQVQKAKNKENK"
FT   gene            181161..183059
FT                   /locus_tag="MMS_A0170"
FT   CDS_pept        181161..183059
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69243"
FT                   /protein_id="ADK69243.1"
FT                   /translation="MSYKIKELTFRSKNPSLNKVDFIADDGQIVDIVIDNKKEMDFFIK
FT                   VLLGKKKNSSGRFQIDDFDIINRTYTKKHVEFIKRDTWFQRIIPSKWILVLSLLFDQNF
FT                   LKTASNKYLEKKYEYLSLVASKGESNDKKLRQNIDNLISKHINSKTREEQKALNESINT
FT                   QKKYNQEKFLAIAEKWPIQIRLLSKAVENLKTEIKTATLMLMFQQTLWDNVYALDELRD
FT                   NCSCEYNAKHSSNKKLKNSWKKFAYQQTYYAVHKQLRIISTKIADLRLSIFRQQRKLKQ
FT                   FEKQLDFEFKKYLRSLLSSTTNKTEKKDINNNWEQTKKYFTDWKNANKNTLNDFEKQQI
FT                   ELHIEPIRKTTQQLGETINFLIHQYHERVLSDELEYIDKRRFLKQKKEKKKEIKSVFKQ
FT                   AVEKMSTSVDNYNIKFEWFIKSSVKYLSLNIVYLKILKAINLKKRNIIFFNITKHLSEK
FT                   ELLQLFETIKSIQQHHLLMTFIFLNDSINDVYDLNKSIYYTNNKLELKEMLTVDIFDSL
FT                   LKKQDNNINKISYKKINENEIKFLNESTWVLTNYNLKDTGYISFNPLKISTEPKKRIDL
FT                   LLSATVIKSKKFIDKSMYFALTEEKEKIYFYDRTNLYKDNDEIVLYISKDSISNIN"
FT   gene            183069..184019
FT                   /locus_tag="MMS_A0171"
FT   CDS_pept        183069..184019
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0171"
FT                   /product="DHHA1 domain protein"
FT                   /note="identified by match to protein family HMM PF01368;
FT                   match to protein family HMM PF02272"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69794"
FT                   /protein_id="ADK69794.1"
FT                   /translation="MLDQKKSQLLLDKIKQYQNIIITKHKQPDWDAQGSAIGLANIIND
FT                   NFKNKTIYVVGSRISDDDSFFIDETNLSDEFVKNSLIITVDTATKKRVDFNRFDLSCDS
FT                   FKIDHHINVEDYCNNDLIDDSSISNTQVISLWALENDLFISPTAAYNLYLGLLTDSNRF
FT                   LYDKTNQTTFYVASKLLEAGANLKKANDFLYVSDLKLRQWVMYSFSKMKLTNTGIAYIV
FT                   LLDEDLKGWDLSYEETKLALSVMSGIKEIKIWFTIIQVEDILKVSLRSRDFSIDKIANK
FT                   YNGGGHRLASGAEISSLDQINDLINDLEQLIKGEQ"
FT   gene            184021..184650
FT                   /gene="tdk"
FT                   /locus_tag="MMS_A0172"
FT   CDS_pept        184021..184650
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tdk"
FT                   /locus_tag="MMS_A0172"
FT                   /product="thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="identified by match to protein family HMM PF00265"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69697"
FT                   /protein_id="ADK69697.1"
FT                   /translation="MTELDINEIEAYNSNKMGWIELITGCMFAGKTEEFIRRLRVLSYA
FT                   KKRVLAFKPSIDNRYSVENIISHSGSKLDSYLVHSSDEIKQIIEKENQIQQVDVIGIDE
FT                   VQFFDEQVVELIEQLANQGIIVIVNGLDKDFRCLPFKNVDKLLVTAEFVTKLRARCHLC
FT                   GNFANRSQRIVNGQPALWDSPLILVDGKESYEARCRNCFIVPKKEV"
FT   gene            184653..185747
FT                   /gene="prfA"
FT                   /locus_tag="MMS_A0173"
FT   CDS_pept        184653..185747
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="prfA"
FT                   /locus_tag="MMS_A0173"
FT                   /product="peptide chain release factor 1"
FT                   /note="identified by match to protein family HMM PF00472;
FT                   match to protein family HMM PF03462; match to protein
FT                   family HMM TIGR00019"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69076"
FT                   /protein_id="ADK69076.1"
FT                   /translation="MNAKTYEALETMQKRLLQILKDLEDENILKDIKKFTELNKEKSNL
FT                   EEVVEKFVEYKKAVEHIKDAKAILENEKDQELIELAKIELDENNDKVEHLQQVIEEMLL
FT                   PKDPNDDKNVIVEIRGAAGGDEANIFAGDLLRMYKLYAETQNWKINILEASVGEAGGYS
FT                   QVVFMIKGDRVYSKLKFESGAHRVQRVPKTEAKGRIQTSTATVAVLPEMSEVEIEIRSN
FT                   DLRIDTYRASGAGGQHVNTTDSAVRITHLPTGIVVTSQDGRSQHDNKDIAMTMLRTKVY
FT                   EAEVEKQQAQADATRKNAVGTGARSEKIRTYNYPQNRVTDHRVGLTLNKLDQVMEGNID
FT                   EFIIALINEEQRQKVAEQLEKNNE"
FT   gene            185740..186588
FT                   /gene="prmC"
FT                   /locus_tag="MMS_A0174"
FT   CDS_pept        185740..186588
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="prmC"
FT                   /locus_tag="MMS_A0174"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF05175;
FT                   match to protein family HMM TIGR00536; match to protein
FT                   family HMM TIGR03534"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69816"
FT                   /protein_id="ADK69816.1"
FT                   /translation="MNNTIFNVLNKIKNTNISLNKADVYHILEHIINKDYQWIISNLDH
FT                   KLTKKQIYKIDQILDLLKQNYPLAYILKSKYFYSNIFFVNKDVLIPRNESELIIDHVSE
FT                   FVKNNNDLLIVDLCTGSGCLGISCALLNDQNKVILTDISYKSLKVANKNIKKFNLTNTS
FT                   CLNGNFIDVLIKNNLKANLIICNPPYIDINDQNIDKNVIDFEPSIALFAPNKGLYFYEI
FT                   LIKNIDKIVDTNKNFLIVLEFGWLQKDSIEQLLINNCLKYKWEFKKDYNDYWRNLIIKN
FT                   F"
FT   gene            186597..188069
FT                   /locus_tag="MMS_A0175"
FT   CDS_pept        186597..188069
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0175"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69207"
FT                   /protein_id="ADK69207.1"
FT                   /translation="MYKNKNFKIKIINNKFSMRIKDIDPKIEQKNFSIYLKAILGLVVF
FT                   LITLLPFYAYLHLIFKHESLSFYFANYSIISKYVDLPSKSQIWGLAISALVFMAIVITM
FT                   FISFKALVNMSNNKRYKQVIIALIIIFGILTILFQGISQYFYGYFQDFFNYQVISGLDN
FT                   KISDFKKITTQFIEFEKNTSSIYNWIDVNNIWWIIFVQIFLMFVTSISLQNITFFEYEK
FT                   NSEDKYINYFVQKNKVIYQNRIKLFVNNLFSFTDKTLSNWLIILALMICFPILIYIVAI
FT                   STRGSEKSLIYWTHQLPNLLKDYQNWNTIFDQYKNQLNLTKSSPLLILSSPIIFLGITL
FT                   STVLFLLTISIRDEKSSQLVLRTKFILLSILISLLILSIFISQLELHKLLIAWNTSNNE
FT                   QIIGSNYIQTIKQITGQKVFENIGQKLFLLNNIDQKIDSIFNDRYIISVCISFLVVSTI
FT                   TGFCIILKGMLDKRLAIDFVKNQFKNKKLFRK"
FT   gene            188078..188578
FT                   /locus_tag="MMS_A0176"
FT   CDS_pept        188078..188578
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0176"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69405"
FT                   /protein_id="ADK69405.1"
FT                   /translation="MLTDIKINKAIELLKNNQIIILPTDTIYGLSAIYSLENQIRVNQV
FT                   KNADITKPLIVLISNLNQLNDLEITDLTDKDYLLNDEPTTVIFKTKSSSIAIRLVKRED
FT                   IKQIINKIGPIISTSVNLHNFKPLIKESDLINFNKNIEVFFDTQLNNKPSKIYSSIIKK
FT                   YLR"
FT   gene            188691..189605
FT                   /locus_tag="MMS_A0177"
FT   CDS_pept        188691..189605
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69862"
FT                   /protein_id="ADK69862.1"
FT                   /translation="MNSHSLVFNYRDNKHFLQEMYTIIKKRGPKTFEEWMVNNNFDSAY
FT                   IPVTIVNERNGVLAVSGFIKSKAIINKTFLNTILLTNTFTKAKESNPLIVNELIQGVVK
FT                   KYENISDFIYTFSNVENDEVLIRNGFKKIKEYTYFMRWDPNKEAKLSVLKRLDLDTNQA
FT                   DFEFVKDELFHSSKNNSLFYIREDGALSIYSLLKYYRNNVFYIFNLDAIVIFSINNKTF
FT                   QLIGLYSKNEIDVLELLDAIVPKGISLIEFYFVPNIKSKFVVKELRKVRAADCQHRSFL
FT                   YVRQSTTNLEASKFVVPLLNRLK"
FT   gene            189834..190541
FT                   /locus_tag="MMS_A0178"
FT   CDS_pept        189834..190541
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0178"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69529"
FT                   /protein_id="ADK69529.1"
FT                   /translation="MKRKIIKKNLALVKKKRLFLDFLKNNQLEDVYLKNTDFNKKSNIL
FT                   LNNFIIILKINNLNYKNYWANISFINFCIYYLYHKFYKSLSDQKLNQINLTIKKIATNR
FT                   KYNSLDINYEKQLIEIVKQYDIKFSTDFLKTYFNNHQIYHYISNSFSLMFDKDKKIFAY
FT                   SYCYWLILFIYIKKYLSLQLNYKYSYSLFNLEMICNENYIKNIKQLTPIFFNLLIMKNN
FT                   KWISKLDIKRKKK"
FT   gene            190541..192070
FT                   /locus_tag="MMS_A0179"
FT   CDS_pept        190541..192070
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0179"
FT                   /product="phospholipase D domain protein"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70016"
FT                   /protein_id="ADK70016.1"
FT                   /translation="MKKPIVTVLSLVFMFGLTIFGLLLLNIYFFTWPLIGFGIFHLLAI
FT                   IWAFIVLADKKRRFETRIRWFCFIVCIPIIGVLSYLFFGRSYKYKITKNYKFLEIKNKH
FT                   LENELEQIDQILTNQIPQFKRAFKTASISQTSNIFLNTKVEFLENGNQLFLNLFKDIKN
FT                   AKHYILLNFYIFKDGKLLDELTNLLIRKLKENVKVYIIYDFAGSYTLFEEAKIKLLEYG
FT                   CQIVCYAPIRFPFIKWTANYRDHRKDIVIDNKIGYIGGINIGDEYINLDNKFGYWNDCS
FT                   LKITGNAVSEIQRIFISDFDFYKPSFKKISIKQDLDLNNIYPVKCKDQLVQIVSSGPNH
FT                   EEPLHLSIFINLINSAQKRIWISTPYFIPPQEIRTALINAANSKLDVRILIPGLTDKAF
FT                   LLDQTKQWTRELYKAGVKIYSINNVFNHNKTYLFDDEITFIGSTNLDFRALFADQQTMG
FT                   LIYSKSLNKTISNKFEQDFKNSYLYDHLPNKNINWFRKIVIKIYNIIQPLL"
FT   gene            192194..192613
FT                   /gene="rpsL"
FT                   /locus_tag="MMS_A0180"
FT   CDS_pept        192194..192613
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsL"
FT                   /locus_tag="MMS_A0180"
FT                   /product="ribosomal protein S12"
FT                   /note="identified by match to protein family HMM PF00164;
FT                   match to protein family HMM TIGR00981"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69130"
FT                   /protein_id="ADK69130.1"
FT                   /translation="MPTINQLVKVNRKAKTWKTKAPALNRGINTLIKKVTKIASPQKRG
FT                   VCTRVATMTPKKPNSALRKYARVRLTNGMEVNAYIPGEGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHVIRGTLDTQGVAKRSQGRSLYGVKRPKVKK"
FT   gene            192700..193167
FT                   /gene="rpsG"
FT                   /locus_tag="MMS_A0181"
FT   CDS_pept        192700..193167
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsG"
FT                   /locus_tag="MMS_A0181"
FT                   /product="ribosomal protein S7"
FT                   /note="identified by match to protein family HMM PF00177;
FT                   match to protein family HMM TIGR01029"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69633"
FT                   /protein_id="ADK69633.1"
FT                   /translation="MRKNRAEKRDVLADPIYNSKLVTRAINKIMLDGKRGIAQSIIYDA
FT                   FNIIKEKTNKEPIEVFNKAIENIKPHLELKVRRIGGANYQVPIEVSAERQITLALRWLI
FT                   NYARLRNEKVMTIKLANEIIDASNNIGGSVKKREDTHKMAEANKAFAHYRW"
FT   gene            193192..195261
FT                   /gene="fusA"
FT                   /locus_tag="MMS_A0182"
FT   CDS_pept        193192..195261
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="fusA"
FT                   /locus_tag="MMS_A0182"
FT                   /product="translation elongation factor G"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF03764;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69520"
FT                   /protein_id="ADK69520.1"
FT                   /translation="MAREYSLLNTRNIGIMAHIDAGKTTTTERILFHTGKIHKIGETHE
FT                   GASQMDWMAQEQERGITITSAATTAFWKNTRFNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDGQSGVEPQTETVWRQATNYKVPRIVFVNKMDKTGADFIYSVKTIGDRLGAKAAPIQ
FT                   LPIGAEENFTGIIDLVEMKAYEFDGKPEENYKEIEIPTNLLEQAKELRAHLVEVAVEYD
FT                   EELLMKFLDGGEISISELKSAIRKGVINADFFPVLAGSAFKNKGVKLLLDAVVDYLPSP
FT                   LDIPSIKGILPTGEEVERHADDTEPFSALAFKVMTDPFVGKLTFFRVYSGILTKGSYVL
FT                   NSTKQQKERVGRILQMHANNRTEIEEVYSGDIATAVGLKNTTTGDTLCDEKGEIILESM
FT                   VFPEPVIQLALEPKTKADQEKMSIALSKLAEEDPTFRTYTDDETGQTIIAGMGELHLDI
FT                   IVDRMKREFNVATNVGAPQVSYRETIKLPGKAEGKYIKQSGGRGSYGHVVIEFEPNKDK
FT                   GFEWVDKITGGRVSKEYINSARVGLENALRNGVIAGYPMIDVKATIVDGSMHEVDSNEM
FT                   AYKIAASMALKEASKKMNPVVLEPIMNVEVTVPDEYYGDVMGNISSKRGIIEGSEQRGN
FT                   AQTIKSKVPLTEMFGYATELRSFTQGRGNYTMIFSHYAEAPKAIADEIIKKSGK"
FT   gene            195393..196580
FT                   /gene="tuf"
FT                   /locus_tag="MMS_A0183"
FT   CDS_pept        195393..196580
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tuf"
FT                   /locus_tag="MMS_A0183"
FT                   /product="translation elongation factor Tu"
FT                   /EC_number="3.6.5.3"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03143; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00485"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69235"
FT                   /protein_id="ADK69235.1"
FT                   /translation="MAKEQFDRSLPHVNIGTIGHVDHGKTTLTAAITKVLSEQGNAEFK
FT                   DYANIDNAPEERERGITINTAHVEYKTANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLSRQVGVPKIVVFLNKCDMVEDDEMIDLVEMEIRDLLTEYDF
FT                   DGEGAPVIRGSALGALNGDSKWTGAINELMAAVDEYIPTPQRDADKTFLMPVEDVFTIT
FT                   GRGTVATGRVERGTVKVNEEVEIIGLKEEPTKTVVTGLEMFRKLLDFAVAGDNVGALLR
FT                   GVDRHSVERGQVLAKPGTIKPHTVLKASVYALTQEEGGRHKPFFNKYRPQFYFRTTDVT
FT                   GEVTLPEGTDMVMPGDNVEMEIQLIKPVAVEEGTKFSIREGGRTIGAGTVISIEK"
FT   gene            196716..197249
FT                   /locus_tag="MMS_A0184"
FT   CDS_pept        196716..197249
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69386"
FT                   /protein_id="ADK69386.1"
FT                   /translation="MKKLLDFRKAKESNLHEFFSKFAKSILTFVALLPAAGLTIILGKI
FT                   IGPLRLGQIKASAKVFNQIGGVIETVGWAAFSHMGLLFAVAIGGTWSKNRYGGSFAAAF
FT                   AYFILLAVGSSMFITRTTEAGEIQFLNYILGRWEKHELFFSSQEGVMSIRYDAIGGIIM
FT                   GFVGATIYNNVLQL"
FT   gene            197215..197505
FT                   /locus_tag="MMS_A0185"
FT   CDS_pept        197215..197505
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0185"
FT                   /product="conserved domain protein"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69875"
FT                   /protein_id="ADK69875.1"
FT                   /translation="MQQFIITYYNFNKLPQALSFFNGARFVPFMVIIIVLPISVGIGLV
FT                   WPLFQTVINHLGNFFAKEQKLKFLAPFLIWNFRKIIITIWITPHDYNSYEL"
FT   gene            197480..198019
FT                   /locus_tag="MMS_A0186"
FT   CDS_pept        197480..198019
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0186"
FT                   /product="conserved domain protein"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69525"
FT                   /protein_id="ADK69525.1"
FT                   /translation="MITIPMNYSQLGGSVDFTSASQFSNTTPEKAEVIAKFFQSLENNK
FT                   EALKAQGQEKIWLSWITALGNVKSGWADYAAKHSNNVNGLTMQQAYEIVLDSVVPVRFK
FT                   VGQMITSSGSLVGAGLGMAFAIPKEKRAKYSSIYFLGLAVCLLTGVTEPIEFIFMFSAP
FT                   LIICFTCNFNWNSIWN"
FT   gene            198033..198587
FT                   /locus_tag="MMS_A0187"
FT   CDS_pept        198033..198587
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0187"
FT                   /product="phosphotransferase system, EIIB"
FT                   /note="identified by match to protein family HMM PF00367"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70032"
FT                   /protein_id="ADK70032.1"
FT                   /translation="MRIHAFGGIETLIKYLFVFGPTSISGIGLKGILWIQGLWLLLVTI
FT                   AFGGIYFAVFYFFTKKFKPAIPGFTNDETSTSEITTIKEDQPAKKQTKSTKTKSDQTIN
FT                   TIVNLLGGLDNLDDVDACMTRLRVKVKDKAKVDNKFKELTGAVGVLNKGSSLQIVYGPK
FT                   ADIYKGEILELLERNKNAKAK"
FT   gene            198571..200841
FT                   /locus_tag="MMS_A0188"
FT   CDS_pept        198571..200841
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0188"
FT                   /product="glycosyl hydrolase, family 31"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF01055"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69086"
FT                   /protein_id="ADK69086.1"
FT                   /translation="MPKPNNITSEMLEYSFPIKQRIFDPRNEYWITTKVSDLWTNDNNL
FT                   FIEITFSNLQKATFQIKLFESNIINLKLSQRSINKVFNEHLNSNLKSEKISYIKTDKEI
FT                   IIDLKNNEKLIFNINPFVLKIIDSNNQIKTKTTLRTGYQFFEGFINPNLGIEIDQNKNQ
FT                   KFFMSFDIENDEKFYGLGEKFRPLVKNGVESVIWNTDNSCVTNNDLAYNGLPLLYSTNN
FT                   WGFLINTSCKTTFEIGSPTTDILSFKVDQDYLDLYLFSNNNLKELVSSYTLLTNRISKV
FT                   PDIGYGVWLNRLYYHNYEELFEAINKAKELNYPLDVITLDPKWLKNRYTKSCNFEYNID
FT                   AFGDFKKLFDDVKANGLEMCFWINPYIQNDGLENSKFLFENDLLVRSVNGSYAHPWTGT
FT                   ETYQENNYIIDFTNPKAYNWYKDQIKKLFKLGLRFVKPDYGDGLPADAILYNGYNAKNF
FT                   KQYFMYLYVKCCYEAGEEFFGTGRNVVVSRPGYIGTQKFVGKWSGDSITSFSDLKNHLQ
FT                   AGLSLSLAGEVIWGTDICGFVQSGDFSLDLYNRWTQVGMLNTFSRYHALGKREPWRFDK
FT                   NTLNNSIKWAKFKKTLLPEFKVWEFESITKGLPILRPMVLENQNNKIARLIDDQYYIGA
FT                   NLLICPILKQNSTNRDVFLPDGSWYKLDDKTKVYQGNCLYNFDVEWDDILIFVKNNSAI
FT                   LRFDNGSYNFKNVKDQQIVIDIYGKIDNLEYQFEIDEIINKISIKNNQVECLSKHKIII
FT                   KNN"
FT   gene            200994..202349
FT                   /locus_tag="MMS_A0189"
FT   CDS_pept        200994..202349
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0189"
FT                   /product="cytosol aminopeptidase family, catalytic domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00883"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69755"
FT                   /protein_id="ADK69755.1"
FT                   /translation="MIKFNDKKEELTLVCLTEVNNKPYVSDTDLSTTFISEDKTIYMVI
FT                   KKDHKCLKTKIRNAFKKFVSTNKFNINVDVDSFLVFFDMCGCKKDAIEGIYESIAFETF
FT                   DKVSYKKDTKPNEVIYNLITREDVKELEQKEAIKMEFVNFARTLQDTPPNIATSEYLAE
FT                   KIIQKAKEIDGLKVTVLNKKEATKLGMNLFLAVNAGSIYEPQAVVLEYVGDENEPKKAL
FT                   VGKGITFDSGGYNLKPSSAMEGMKFDMSGAAIMLSTVMALAKMKAKVNIVGIGMFTDNR
FT                   IGSTATLPQSVIKSMNGLTVEIDNIDAEGRLVLADGITYVIREKQATEIWEASTLTGAM
FT                   VIALGSYATGVFTNCDKRWELISQASHKTSEKVWRMPIFDEHLEKVKADSVNADLTNAA
FT                   KGREAGSSTAAAFLSAFAEEKPFVHFDIAGTADKAGRGQGVLVRTLFEIFNK"
FT   gene            204123..204725
FT                   /locus_tag="MMS_A0190"
FT   CDS_pept        204123..204725
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69403"
FT                   /protein_id="ADK69403.1"
FT                   /translation="MSFKIEEKIKPFLEMDLSKLELEDKTKLFLLLSPPINYGIKKAMS
FT                   KFHSLPLEHHDLMSYAWIAFDELLQVYQAKNIKKKFIWSVIDAVTWKCIDACTKYINNR
FT                   HKVLNMSLSNSIKQEHLENIVSEEDYMGYNFAIEEIIDLYFKNCNDKLAKPIFEMYIRN
FT                   VPKKHIFTKFNISRNKLKKIIEKTTADLKKIIEPLID"
FT   gene            complement(204883..205548)
FT                   /gene="trmB"
FT                   /locus_tag="MMS_A0191"
FT   CDS_pept        complement(204883..205548)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trmB"
FT                   /locus_tag="MMS_A0191"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="identified by match to protein family HMM PF02390;
FT                   match to protein family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69918"
FT                   /protein_id="ADK69918.1"
FT                   /translation="MRLRKKNWTDDFLNQHSFYLINYNNKKIDLKQIFLNNNPTCLEIG
FT                   SGKGQFITTLALKNLNTNYIGMEKSSTITGVALKKSLKEFENQLKDMTNLKYFNNFAED
FT                   LSQMFSSDSFNKIYLNFSDPWPKTRHYKKRLTYVKFLDIYSDILIKNGYLEFKTDNDSL
FT                   YNFTIEQLNLTNKWEIVINATDLYNNTEFLKDNIPTEYETKFHLANKNIYKIVIKNLK"
FT   gene            complement(205550..206953)
FT                   /gene="mgtE"
FT                   /locus_tag="MMS_A0192"
FT   CDS_pept        complement(205550..206953)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="mgtE"
FT                   /locus_tag="MMS_A0192"
FT                   /product="magnesium transporter"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF03448; match to protein
FT                   family HMM TIGR00400"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69787"
FT                   /protein_id="ADK69787.1"
FT                   /translation="MVDLENKEQEILELYKNKEFDKCIEIIEKLRYADVREIFNYLDEQ
FT                   IAFNLYKKLEINKAREIFNYLSFDLKEYILTNLSQTKIKQLINDLYTDDIINAVENMPF
FT                   EVVKKVFNAASKEQKKEIASILKYDIDTAGSIMSVNFLSVKQTTTVSKTIKEIQKNHDD
FT                   YDEIDNVFVVNKLNQLVGSIEVKDLILNDMNTKIEDIMNTKVISINSNQSQEDASNALK
FT                   KYDISTLAVVDDNNVLVGIITSDDIIDVLIEETNEDMQKYTGIRTNETNYFDTSIFKMF
FT                   ISRIWSLILMLGLTIITNSLLLVFFKNYNWSPNTQSKEELLFMLIPLVVILSTIIICCA
FT                   NQTLVMIRRAISLEEINKKSLKTIVLKELVVFLMIAFALIVINILRMILIYAVQYNANL
FT                   TNINMWNSILIASIGIIVSVIFANLLSLFLPLIVKKIGKDSSSVSLPLFALIIDILCVG
FT                   VFLGIGLLF"
FT   gene            207098..207508
FT                   /locus_tag="MMS_A0193"
FT   tmRNA           207098..207508
FT                   /locus_tag="MMS_A0193"
FT   gene            207679..209352
FT                   /locus_tag="MMS_A0194"
FT   CDS_pept        207679..209352
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0194"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69810"
FT                   /protein_id="ADK69810.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRSDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIVSSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNDRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHNVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEAFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            210456..210764
FT                   /locus_tag="MMS_A0195"
FT   CDS_pept        210456..210764
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0195"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69195"
FT                   /protein_id="ADK69195.1"
FT                   /translation="MLMDELGILSALITSDVSPRDLSGVKHIWNLVKIDREWYHLDATS
FT                   DRIEKNEKQEYRFFLLHDDDFTKDDVFLRNTKNFGQRFRNLKLTNFVKNKEDIDFNW"
FT   gene            210837..211349
FT                   /locus_tag="MMS_A0196"
FT   CDS_pept        210837..211349
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0196"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69984"
FT                   /protein_id="ADK69984.1"
FT                   /translation="MKTFSNSDLEVIDYKLVVSGSAYTSYKTINYMLKDNKTKTKYVKV
FT                   QKIEKYNERDKSKTLGSYAIKINLSERIVGLKPGSFNIENAMIKELKQEDNSYILYLDH
FT                   FKNFDKVTIKINGIKKRGYKFTLSNNTVEFDVQKFKEIPQAVVKAIDENEILITNVKPG
FT                   MQYRNNY"
FT   gene            211495..211689
FT                   /locus_tag="MMS_A0197"
FT   CDS_pept        211495..211689
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0197"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69339"
FT                   /protein_id="ADK69339.1"
FT                   /translation="MIKVQANTITGVDDTMQYRVINKNSQWENIISNKLENLKPGTYEI
FT                   RTKANDKELASNSHQVIIN"
FT   gene            211758..211922
FT                   /locus_tag="MMS_A0198"
FT   CDS_pept        211758..211922
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0198"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70113"
FT                   /protein_id="ADK70113.1"
FT                   /translation="MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDLRFPLSRENTQFS
FT                   AAIFFYKKI"
FT   gene            211963..213636
FT                   /locus_tag="MMS_A0199"
FT   CDS_pept        211963..213636
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0199"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69502"
FT                   /protein_id="ADK69502.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDIHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKLATKDKNNRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            213687..214247
FT                   /locus_tag="MMS_A0200"
FT   CDS_pept        213687..214247
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69197"
FT                   /protein_id="ADK69197.1"
FT                   /translation="MFSCFMLKLGNVGKKLKIVKEAKKLNIKKSTYLANKYDISVDTIE
FT                   SLVNRFEAFGIEGLINKEKKPYYSAKLKLKIVLYKLETNHSYDEVTKKFNIIYSSTIAG
FT                   WVKKYREYGFLGLNNNIGRPKKIMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKL
FT                   EAEFWKKFHTLLTKEKSTRKKQK"
FT   gene            214256..215116
FT                   /locus_tag="MMS_A0201"
FT   CDS_pept        214256..215116
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0201"
FT                   /product="putative transposase InsK for insertion sequence
FT                   IS150"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69680"
FT                   /protein_id="ADK69680.1"
FT                   /translation="MLKTHKKVKISILLKIAKLPKSSFYEWKHKLENTIDKDKELKEMI
FT                   VDIFSKSFETYGYRRLKMALKSKGYIVNHKKILRLTKELGVQCIKFRTKNGRYSSYKGT
FT                   VGKIADNVLKRNFHSLQANKLWCTDVTEFKVNGQKLYLSPIIDLYNDEIISYSIQTNPN
FT                   LNLTNSMLDKALKKVKNTNGLLIHSDQGFHYQHISWAKKLEENNITQSMSRKGNCLDNA
FT                   IIENFFGLLKQEIYYGEKYNSVEELTKRIHKYIYWYNNIRIKEKLKGLSPVQFRKQSCY
FT                   NIEKF"
FT   gene            complement(215157..215996)
FT                   /locus_tag="MMS_A0202"
FT   CDS_pept        complement(215157..215996)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0202"
FT                   /product="abortive infection protein AbiGII family protein"
FT                   /note="identified by match to protein family HMM PF08843"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69300"
FT                   /protein_id="ADK69300.1"
FT                   /translation="MNLQKLKSICKRLSSETKTNYNIILKHYFMISILEKIVKSKNKQN
FT                   FVIKGGFLLSNMMSLNERTTQDIDCLIKGINFVKENILRTISDVLRYDFTDFIKYEIKE
FT                   ITEIKKRDKYNGFRVKILCKLEKLEEIVKIDLAIGDVVTPSEIKYNFRNIFSNSSFEIQ
FT                   AYNLETILAEKIFIINNLNIQSTRIKDLYDIFLIYSFKEFEIDYNILKCACLNTFKKRN
FT                   TVFNIDLVLSLLNEINQLDIFELLWNNYRQKYFYAQKIEFKILIKSVIKFLEKLKNI"
FT   gene            complement(215996..216592)
FT                   /locus_tag="MMS_A0203"
FT   CDS_pept        complement(215996..216592)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0203"
FT                   /product="abortive infection protein AbiGI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69313"
FT                   /protein_id="ADK69313.1"
FT                   /translation="MNYKEQLIKEAKKRAGIITRKEIMNLKIPSIYITRMIRSNELEKV
FT                   DIGIYALTSENWYYDPDYNFSIRHKTPIFSYTYALTFFDFTDVIPMFRDVTVYHGYNAH
FT                   NLDPQTRVHYVSKDIYELGVVEVKTNCGNKIRAYDIERTICDFIKHRDKIEAELFAKTM
FT                   YKYSEYEKRDWKKLHEYAKKMNIGKKVYEVFQVLV"
FT   gene            complement(216802..218106)
FT                   /locus_tag="MMS_A0204"
FT   CDS_pept        complement(216802..218106)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="This ORF contains tandem Palindromic Amphipathic
FT                   Repeat Coding ELements.; identified by match to protein
FT                   family HMM PF03382; match to protein family HMM TIGR02167"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69855"
FT                   /protein_id="ADK69855.1"
FT                   /translation="MKKLLAFLSSFGLITTSSLLVISCKSNNITAVRKEKDNKEKQIDS
FT                   TPPSDQPQEDETKKEKPSGSGNSSPDTTPQTQNKHNQEKPKPKRQATEEEKKKLETIFK
FT                   EHENAFGTFHTYKDVVDQLLVYANEKGLKDITLVDGINENEYLKEDKDGKGENIVKLKL
FT                   YESDVTFKPKKVLKDEVKAIYSEDKKKIKQIGYEKILNEGIRIKKITELIEEVPVHLPL
FT                   KITSLSKVFSKSKITTVRNLDKWNTKNIKSMFFVFENAENFNQDISSWYTSNVTNMSGM
FT                   FWDATQFNKPLNEWKVHNVVDMEGMFAGASSFNQNLNKWEATSLENMEQMFWGASKFNG
FT                   NISTWNVSNVKTLHNTFAGATSFNQDISNWNFTNNCTSNVKTMQGTFSRANKFSYNLTR
FT                   WNVEKVTIAKDFNKEIQSTLGKDKLPKFTVPITYS"
FT   gene            complement(218212..220902)
FT                   /gene="alaS"
FT                   /locus_tag="MMS_A0205"
FT   CDS_pept        complement(218212..220902)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="alaS"
FT                   /locus_tag="MMS_A0205"
FT                   /product="alanine--tRNA ligase"
FT                   /EC_number="6.1.1.7"
FT                   /note="identified by match to protein family HMM PF01411;
FT                   match to protein family HMM PF07973; match to protein
FT                   family HMM TIGR00344"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69780"
FT                   /protein_id="ADK69780.1"
FT                   /translation="MKKLSTNQIRKIWLDFFISKNHYFLETVSLIPVDDPSLLWINSGV
FT                   ATLKPYFDGRKTPPSPRLTNSQKAIRTNDIENVGVTARHHTMFEMLGNFSIGDYFKKEA
FT                   IELAWELLTDKKYFDIDKNKLYITVFNEDTEAYNIWKDVIKIDEDHIFRLSRKTNFWDV
FT                   GQGPCGPNTEIFYDRGEIWDPNKIGPRLISDDIENDRYIEVWNIVFSQFNNDGNNNYVE
FT                   LPRKNIDTGAGLERFASIFQNTPTNFETDIFYPTIKKVEQLTNNQFKYSIDNYFNPNKK
FT                   QTRINTAFKVIADHIRATVFAISDGVFPGNKDRGYIIRRLIRRSCVFGKELGIKQAFLY
FT                   KLVDSVIESMKEFYPYLIDKKTLVEQTIKDEEEKFLKTLSKGYDLLENIIKTKNTVSDK
FT                   DALLLFESYGFPIEQTIEISELSNVTVDVEGFKKLLEQTKQATRNARKDLKAWDKQNEL
FT                   FTKLKVESEFTGWSETSRDNAKVIYMFTDQKQVESITNQEVFVILDKTPFYAEKGGQAA
FT                   DSGIIFNDQMKGFVIDVQQGPTHQNIHRIKVQGTLKVNDLINCRVDEEKRIYTMKNHSG
FT                   THMIHYALREVLGTSVMQSGSYNDENGLRMDFTYHRLPTNQELLKAQNLVLEKIKNKID
FT                   RQTYFCSLEESVKKHQALAFFTEKYDQIVRVIKFGDFSSELCGGTHVNNTSEIEDFIIT
FT                   GIESKGSGLYRIKCLTSFRAVNEYLNEQFKVYKDQAESIIDKYNQNKDLLKNDQLENIY
FT                   LQIKNTTINKDNLLVIKNLLDQSKEVNKDYDKKVNDLITANKLLKYKDLTPSLNKDNIN
FT                   EIRLETTDLNIKDLKQLADDLRNKYNDLIVILLSSTNENTFIVVAVSQSLQNKYKAIDI
FT                   FNNLEGYETKGGGNANLAQGKFVKK"
FT   gene            complement(220974..221468)
FT                   /locus_tag="MMS_A0206"
FT   CDS_pept        complement(220974..221468)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69159"
FT                   /protein_id="ADK69159.1"
FT                   /translation="MKKSKVFKELKDIDKFTKEQHEKQVNQTIESVYDSDDFKMNFYDY
FT                   QQAKKLRWIGWLIVFLIFIIGSLIGALVGYLTLNVSSLDNWKGINYFNVLYTTILFFIG
FT                   FVIGVIKNRQATNFFNDRRRRYQKTLELSEAKLIRLKKIFYLSGLLMLVLTIILFLVFK
FT                   I"
FT   gene            221685..222929
FT                   /locus_tag="MMS_A0207"
FT   CDS_pept        221685..222929
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0207"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69651"
FT                   /protein_id="ADK69651.1"
FT                   /translation="MKSTLKTKQEAFDLNSELLLDDFSLLNETNQQHKVSKWTTFKYWY
FT                   YDTSANIYKYFVRHPLYGYSFKRILYGLITLLLSIIILYVVIRLITPDTKYLPPDIEKT
FT                   GLSRAQQDKLLEDRMKRFGVYGPLIPQILTYLKNITPFIPKQIVLGSEVTILQNGNGII
FT                   DSSKLITETRWVYLGVTTATTIAEEGSDVLSIFLKAMPYSFAIGSVSILISYALAILIG
FT                   VRAAKKKGKLFDNVFNGISALLLAIPSIVIIIGTFIFSVAVLGNSGIYNTGSFATRFWP
FT                   IFAIVVINLPGIATFVRRYIVDEMTVDYAKFALAKGTSSNKTYYVHIFRNAGVRIIRSI
FT                   PSEIILTVFGSSMIVETQWAIPGMGRLIKESAGGNDFFVFLGFTVLSSFVSIFAKLLAD
FT                   LVHVLLDPRVSLTKD"
FT   gene            222945..223955
FT                   /locus_tag="MMS_A0208"
FT   CDS_pept        222945..223955
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0208"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69409"
FT                   /protein_id="ADK69409.1"
FT                   /translation="MKNEQLNKTDFSALLDSEREAFFKRHGLDIYQIDHSLFELVGSQA
FT                   QTSETIITKPYSYWKAVGKILITSRVFIICSIILLVLLLTSIIVPYGKEAIPLKTPGVT
FT                   QEHPSAQHWFGLGRNGEDYWIEIWLGLRSSLSFAFVMTFLQLSIGIIMGLIWGYYRKLD
FT                   ILFYQLTSLILVIPQLILIIVIMSVFGIGYWPMILGIVIQAWIGPAFSIRILVLSIRDA
FT                   DYNIASITLGTRSDKIIRKNVLPKILPVLIQVSTFSIPTAIAIESTLAYFDRGFVDGKV
FT                   NTSLGKILQSIMQSSEWQVYPHLIVLPILFICIISTLFFLVLKVFADSLDPKNHR"
FT   gene            223969..225669
FT                   /locus_tag="MMS_A0209"
FT   CDS_pept        223969..225669
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0209"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70056"
FT                   /protein_id="ADK70056.1"
FT                   /translation="MKNIILSIKDLVVKFRVRSKVLTSIRNISFDIYDGETVAIVGESG
FT                   SGKSVLTKTLTNMLESNGYIANGSIMYYPNKATRENESAVFKKDTDLVEFHKNSLESES
FT                   RKGIKKYNNKKIKDALAIIKELKESTIESLNSKIDDLQQKADMLKKYEFTNSTKRLVKR
FT                   NEYLEQIKQLKEQIEWKKDPKKLDFEIQQLEKTIQTAKKEIYNFKTVNIYKKFRYFQII
FT                   NLINKVNNNQLEDINKLEPHIKWLDEIEYKNNFESLTLEILYDIRSNQTKKLDQEKLET
FT                   LEELWDFIKRFNFWIKRSTDKNLQHLRGGTIATIFQDPMTSLNPLLSVGYQISEVLRNH
FT                   SKLNRAEAKIEAINLMKRVGIPNAEKRYKDLPGKYSGGMRQRVVIAIALACRPKILICD
FT                   EPTTALDVTIQAQILDLIKELKEEYKFTVIFITHDLGVVANIADRVAVMYAGQIIEYGT
FT                   TQDVFFNSKHPYTWALLSSLPQLGTKGEELYSISGTPPSLFKEIKADAFAPRNTFALAV
FT                   DYKYEPPMFKISDTHYAKTWLLDPRAPKIKRPKQLNNLKKAVSDSKVGE"
FT   gene            225671..227539
FT                   /locus_tag="MMS_A0210"
FT   CDS_pept        225671..227539
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0210"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69518"
FT                   /protein_id="ADK69518.1"
FT                   /translation="MIKKKSEAILKIRDLLIEFGNGRNKLKAVKGVTFDVYKGETFGLV
FT                   GESGSGKTTIGRAIIGIQPVSDGAIYFENKLLRGKSPDVYKINQKIARHLYIMQQNQLT
FT                   TSLSLNDYSNEFKRVYYKYVQSKFFDFKTQELKDYEDGKSRIIKEGVNLNTTKLVSVKK
FT                   NANLSIVIQAITDNLKRLLKIIRLQEKAARITKNISKHANVKVELQDAINKYQDFVHDS
FT                   ILKVKDLENTIYNTLQEMLAIRNNVNEGKYTSVTKFFDEMGSRLKLVIKSQKLITPQLE
FT                   DANHDQLMNLALTCPKYKNSYYLKKLKQRIDYLTINNKTELAEEYQSVIQTVQNSDFYD
FT                   NLKTAEIFKSPNKKELKENKKDMQMIFQDPSSSLNERMAVEEIIKEGLDNFPELYLNDD
FT                   VKKAYQQWFNQKNPENKIANISEIDKKDIKRFLINQLLETVGLLPEHLSRYPHEFSGGQ
FT                   RQRIGIARALIMKPKFVVADEPISALDVSIRAQIMNLLAKFQKQFDLTYIFIAHDLSVV
FT                   RFATDRIAVIYRGDIVELAESNELFDLPLHPYTRSLLSAIPLPDPIQESKKVHFVYKPE
FT                   VEHHDYLVDFPKWVEVSKNHFVYANEREIKAYKKQIKAYKEQLKNK"
FT   gene            227556..230699
FT                   /locus_tag="MMS_A0211"
FT   CDS_pept        227556..230699
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0211"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69093"
FT                   /protein_id="ADK69093.1"
FT                   /translation="MKKVLGMTLLGSIIATAAASAVSCSVRISLDKILNRKNSNTKVLR
FT                   ELTNYSLANLNSATNNTSNDADIIANLQDVLLTVNRHDHYEGALAEYWDHNSNKDYWKF
FT                   RLRKNAYWTKIENGKQVKGDLITGLDIFNTFRYVLNKNNLALTTEHFLTNFKHAPQLMD
FT                   FINKLSDPTYDKSNGQAKAHSLYDSRFNKDLPGDLRTNELSSSYWIDRAILAFNIKPDN
FT                   EQEAKNLALNASMSTKDLVKKSFAEGKIVNDGKSSTNDDKSQDGLDQSIFDIGFYLSKK
FT                   ISYFESVISYLAFAPIPEIALFYANDKDQVSNIYAGTNYGKPLGKKSGYNGLWYSGPYV
FT                   IEDYFPGSNLNLTRNEFYYNKENVYIEKINYSYVNKADAATRRFLFETGDVSSTKINAN
FT                   DLAGWQKYVGKDEENPVFSGTNVLKQKPTTTWAFGFNFHTEGTQIYDNIQLNSEGSLVE
FT                   TGKKRTRTPEEDSILNRALALKSVRILARYALNRSLYAKFYSEARDGVDRPTSTQLRNT
FT                   FTSKYVSTFEDKSHQVLDKDLKETVADYADFLAKDYYDIRKYDDNNNPKNNSSSSSSTS
FT                   TTRSRRDVSSTSSSASNAEEKSWSDWIIDVLKEKQLHKPENIKNWGNRFGKVNDSKHPN
FT                   SKTKVSVYNEGNDAFLENDLLAFTAFLEEDQLQPINGGSGNGKGNGLFNLNRDPKTVKF
FT                   KNESLAKEFANLIGVYDKGYNPKIDTKKQDSVLQNLYKKINLLKRQVKEDLEKIAGIKN
FT                   YNKPITIPFLLNPTGADDFKIKVAQFFGSFNYLVRKHDSNDIDSPIVFDIDKPIDFSNY
FT                   LKELRAGKYGLAAFGWSPDYDDPTNYLATLKYDGVYEHIQSWTKVFNKSKLTSSNGANG
FT                   QKREKDIKLELKDNDKTVTKEVLEKAYSDLKNILQHFTNELTYIDENEADIYKRYTQLA
FT                   KLENYYTLSSAIIIPTHTHLADTLPSISYVDEFSKPTWPTGSHAKRYVGVRIFYKIVTK
FT                   EDFAKQQKEYEQEKTSGYKSLNPMKFDDKTGKNIYFDHFKGDWRTQWKDQYNKEKKAK"
FT   gene            230981..231565
FT                   /locus_tag="MMS_A0212"
FT   CDS_pept        230981..231565
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0212"
FT                   /product="ApaLI-like restriction endonuclease"
FT                   /note="identified by match to protein family HMM PF09499"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69080"
FT                   /protein_id="ADK69080.1"
FT                   /translation="MNAYDVIYKKIKEIANKYSNKLNSQFQKRIVEMQNDDKSHHLIYR
FT                   VLGIPYDVGNEIDYYQNQVRFLYKYAGSFLEEVTILCFKEKYPFASKTKVKNTISNIPK
FT                   TFEIDCLVNNNAYEIKWRDATTDNDHIIKEHTRVKTLISYNYKPIRIMFYYPNRVNSMR
FT                   IQETLETLYKGVGGEYYYGDSAWSYVKKLQE"
FT   gene            231611..233569
FT                   /locus_tag="MMS_A0213"
FT   CDS_pept        231611..233569
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0213"
FT                   /product="DNA (cytosine-5-)-methyltransferase"
FT                   /note="identified by match to protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69194"
FT                   /protein_id="ADK69194.1"
FT                   /translation="MIKLNQVYNIDCLDGLKQLKDNSIDLVYLDPPFFTQKAHFLVDKT
FT                   NKKYFFNDIWKDLKEYQEFLKIRLIEIKRVLKSTGSVFVHCDKTANHIIRVLLDEIFGS
FT                   INFRSEIIWVYKRWSNSKKGLLDSHQNIYHYSKTNDFKFNVIYTDYSLTTNIDQILQLR
FT                   VKDKNNKIVYKKDKNNNVVFSDLKKGVPLSDVWNIPFLNPKAKERTSYPTQKPIELLER
FT                   IISLVTNENDVVLDPFVGSGTSVVASKLLNRNFIGFDINIDAIDITNQRLKNPIKSESN
FT                   LLKNGIDKYDTKTKQQKQILSRYDCDIVWRNKGLDAILKQKINNKTVGIKIQKDSETLK
FT                   QSQKLLFNCMKSKNLESEIRQTIRDNNNSFNRISSKLTDTKSIPEHIWNTTINVNLKID
FT                   DSNKNSVLSSTSINNVSIGVYDIDEITTRKNIWIDIDELKKLVHNSNSEQQKEKLFHYL
FT                   KKNNPTITDESVFNRDSYNYDFSNTELKEVVTSTESGPITLSGKQTIHHYYFSGMNYKQ
FT                   SWYQTKLKINKNNSNKNFVDWNNKDTIELTFYVFIPVPTKVGFENRDYLRPFKIGDLDG
FT                   AFIIIDKDGSERRVIRKTLLVKDTEDDWNEEYEYKKWKKQGWKVEEIINWNHILKRHKL
FT                   PYTIKRFPDTELNDYPF"
FT   gene            233875..235041
FT                   /locus_tag="MMS_A0214"
FT   CDS_pept        233875..235041
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0214"
FT                   /product="e3-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69431"
FT                   /protein_id="ADK69431.1"
FT                   /translation="MFQAIKNFINTAGRIFKNLPNFLLWSLLLPLLAIPAGLAVIVDFF
FT                   GRNLIKLLIFGGDDFDVSKLPQAFKTIAIIAAAIAIISFIFFFVFLIAKEDSRRHIKQT
FT                   IKGIVIATLFVSTMPIAFFLLQYVVSIFFDLIKLAFGLENQSASQTVIENILKTGLKVP
FT                   KLKHDFFSISLNMKIEMFLDWVEDVNPVFPLITTVLVIWTYIQFSIAIMQKSMELFTLF
FT                   ITSPIYGITGVFDAQKIFKKYIREKIIGKSFAVLGLMFIWNVSFLFLNYFTNRLLDPIV
FT                   AAITSSGKARHISNFGESIIKSLVTLVGIVSSATFVSKGANLLGDLTGESISVSSPAAV
FT                   LKLAGKVTTAGIGAGLSKFKNKKITHHLIQLIHLKLQVLQQQTIILLQ"
FT   gene            235099..235860
FT                   /locus_tag="MMS_A0215"
FT   CDS_pept        235099..235860
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0215"
FT                   /product="e3 binding domain protein"
FT                   /note="identified by match to protein family HMM PF02817"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69806"
FT                   /protein_id="ADK69806.1"
FT                   /translation="MWILKGESSIAAVNQKRINNSKNLAELARSNFFEDKIKTPPKAYS
FT                   QAQQLAKANNVDLSTITGSGQNGRILKSDVQNAINNQKAINTLTTPNSFNTNSDDKKIT
FT                   KGDSNNSIVDKLQAKEGKVNRTQPTKNNDEDIEKKKSTLEKFKENYKKLSEKEDKKLML
FT                   QELKKLNKSIEKFAKQLNKSKVKSNDSDKIDKTKRFKLFDFNKFNNTNPSFEIKQLNLS
FT                   LQNNQNINDKKIGSKLNKLNIFKKKDKEVKK"
FT   gene            235860..236321
FT                   /locus_tag="MMS_A0216"
FT   CDS_pept        235860..236321
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0216"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69909"
FT                   /protein_id="ADK69909.1"
FT                   /translation="MRSKAMFPERLREVKFYIWKSLTLLDTLYISFCIALGFVLYKTLT
FT                   IIPLWNYRLVPGIFVPLILLVFILPVNFKKPEIRVYHQAKWLILFIITPKRFKKETESK
FT                   ITNHLKVFKITSNKKNNLLKANLVNDDLIKETEQLTQMIKEQIKNIKRK"
FT   gene            236403..236924
FT                   /locus_tag="MMS_A0217"
FT   CDS_pept        236403..236924
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69425"
FT                   /protein_id="ADK69425.1"
FT                   /translation="MNNILSFIKTKKEHLLNKKSDDIKNQQDFKDKHNFLDKKVKELQA
FT                   ELELKETRIIDLTSQNQILDSTIIKLDDRILFLENDIDQLKKDNQNLEQQLYSNKILLN
FT                   NSKVHINQLVKDNLNLVEIINNSKQIIDEAYQLSLKSTNLSKQNSEFLTNNLSNSKDFS
FT                   ENKQENIERI"
FT   gene            236930..239374
FT                   /locus_tag="MMS_A0218"
FT   CDS_pept        236930..239374
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0218"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69155"
FT                   /protein_id="ADK69155.1"
FT                   /translation="MAISPNVLIPYNNVYDQTTITTYSEGFKSLEYIKAFEIFGNDISS
FT                   YTLEENQRRLTHFFNLFKFLKSNLSFVIMNKIINIKDYLNILNKQIKDIKKDTLSKKVK
FT                   KSKIQTIYETIDILSSREDKEILTKKYYVFYYNKNLEELNLDTIFLHEHLLNTGLNCKQ
FT                   LEFYEILTVLKDIIEPSTNDFNEKQFENINYQDIEIADVLEPNKLSFTSDSYKTNKNII
FT                   LNISVVDRYPLFPERFWALDLVNTDSTVIIKISQNDAKEFTRNLNRAIENIELQKRDIK
FT                   KRNVVEISAKEVEINNLLNLVSLINDSKEIIKNVNIYLITRTNSFHLKKTLKLIEKDIN
FT                   IDGFSLNNLTFRQLDAFKSMFPRTDDELSENFRIETTTSTLSESYPFVNQALIQNKGVL
FT                   LGKNNLGELIIWNPFENLEQNSSFLNANTTIIAKPGSGKTASTLAIADRLISQNKTKMM
FT                   FIDPDNDYLKLCSKYNGKHINLGSGFESRINPLQILYHLKDETKKNKSHLKGESDVKLI
FT                   NSNEVVISNHIAFLEHFFDIINPNYEINRYILKMIKSLYTRWDFISKDLFNLKTTDWPT
FT                   INDLINEFYDFKKDRKKEDEYVNEAMWNNALEFLKDEFTGFGKLSHLYNGHSTLNTQDS
FT                   EVIVFDIKTLIESNNFKIIQAQIMLLTAFTQNEFELNSKLSNKNTILVIDEAHLLIDAQ
FT                   NPIALEFIKKTTKRVRKKRGGIWLITQNINDFSDPRILAQSRAILSNMQYKLFLQMDSE
FT                   EIEKLAELLINEGGLTQSQKEFLLFCEKGQGLFIFRRSVSQKITIAPTKLSKSVWIHKK
FT                   NK"
FT   gene            239502..240422
FT                   /locus_tag="MMS_A0219"
FT   CDS_pept        239502..240422
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0219"
FT                   /product="Fic family protein"
FT                   /note="identified by match to protein family HMM PF02661"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69764"
FT                   /protein_id="ADK69764.1"
FT                   /translation="MYISLQEASKKWKISQDDILKLIKDNKILGYIKENNEYRIPLDLD
FT                   NPLDLLDTDLLKLIDDRKKIIDSYRPLSKEETKRLYEEFLIDYTYNTNAIEGSTLTERE
FT                   TYLILKKGVTIDGKSLQYHFDAIGHQEAFWLMVDLANKDTKISQRDIKDIHNLVLMSNR
FT                   ANAGVYRKIPVYISGSKHNVTQPYLIESKLEQLIDWYHNSNEHIIKKIAKFHLDFEAIH
FT                   PFIDGNGRTGRLIINLELMKNGFYPIDIKFTNRNLYYQAFDDYHTKKDMSTMINLIANY
FT                   ELMRLNFFIRIFKEKEMALKENNER"
FT   gene            240412..240552
FT                   /locus_tag="MMS_A0220"
FT   CDS_pept        240412..240552
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69861"
FT                   /protein_id="ADK69861.1"
FT                   /translation="MKDNNSRFIPWDSISEEELLENAKRKIDDTFNDKEFIALLKKLEK
FT                   M"
FT   gene            240824..241276
FT                   /locus_tag="MMS_A0221"
FT   CDS_pept        240824..241276
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69432"
FT                   /protein_id="ADK69432.1"
FT                   /translation="MRPKYSYKNISDWFLSKESMTPKKLQKLTYYAEAWAYALFDEGIL
FT                   SDTSFQAWIHGPVSPELWREYKDYGWNEIPKKENNDYKLDKNTLELLDAVWSTYGERTG
FT                   YELEAISHSETPWINARKGLEELETSTKLIKPEDMKNYYRSIYTGD"
FT   gene            complement(241800..242954)
FT                   /locus_tag="MMS_A0222"
FT   CDS_pept        complement(241800..242954)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69429"
FT                   /protein_id="ADK69429.1"
FT                   /translation="MNKLIELNKNNIKKLGYDSLSAKEFLNELNLVKNKEERAGRNRFI
FT                   KNYTFDIISKNNSKIFKGTLTGKFQSPNNTNIVEKARIDNIFKHNTVIRLKKIDQPESK
FT                   EYFWNKIIEHFNDSISRLTFKPEKDEFEIEIQKKSNSYYEIIITAKNENKHFTGSTNIF
FT                   FIEDSTINEKIKPELPDEDKSPEPGYNEFSPNDSDLSTEDSNNRNNGENPQGDENRPGN
FT                   NSGDNSSRNPNNRTPDSNSNRDGSSSNSNGTNDSRPNNENETSSNPTNPPNEDQPGDYL
FT                   NPYKPGNGSPNNGTNTDDKWWEKEDEIVQPTPTPKQPENEIKPEDKWILGLTKKDRNWI
FT                   IAAGVLTLGIGWVVSYFWWRRRKLIKKNKVIKITNKKKKDKKLK"
FT   gene            complement(242988..244274)
FT                   /locus_tag="MMS_A0223"
FT   CDS_pept        complement(242988..244274)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0223"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70039"
FT                   /protein_id="ADK70039.1"
FT                   /translation="MPVNSHNNNSIGGLWHYRITLKDYIKPEYNEKGIQKVPSPIDTII
FT                   KPTEYLPGTTIHKYVYIDHKYTDNVDTNFDPELELYSKDFLSLKDFKQLQENNKNSQWK
FT                   FKNFWQTSQAKHFIAFYSNLGMSTSELKRLDYEQLVYLWKKYISSIIQSKSSDLINVVK
FT                   RDLRQIEDLNLKLVKNKTEAKKLIEDHILRNFNWLSETKITLDDLNIQIVNSFGQVKEL
FT                   NENNISDDFINFDKSNKNKKMSIQVSASDFSTILKRNQFKVFTVTNSLYDLTSLNDFSF
FT                   YDVNTNFDKLNEQDIRKFITNTVSSQINSKYNKSIIKNKKQDEDITLTLGKDYQFFLAK
FT                   KEETDQQLEKSIKSNQTFASQNINDFFTKGNSSNYRIVVYALENSQYISSSNKKWFIND
FT                   NKKFNAPSTIFEQLDVKELFKITDLGWVN"
FT   gene            complement(244522..246045)
FT                   /locus_tag="MMS_A0224"
FT   CDS_pept        complement(244522..246045)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0224"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69196"
FT                   /protein_id="ADK69196.1"
FT                   /translation="MSESYNQKEVIFVAGKTLADKIEIQPNFKYWDNLMQEDKTYHLNK
FT                   FTFNSETSDIINDEKSYKVGTGEKTKSNKELVLDKFKEELNSFKSKNYSSLTETFFNRA
FT                   FPNFDEMLDDRYLESHLKFEKNKVILPINSSAKWPFTERPFNIPTQFELPVEINFNPTS
FT                   FISEINNKFNQLSSDINIMADYSTDITDRTVKNEVINKDEITGQTYGSNLYTNYTLVHK
FT                   IIEDRIQKLFVEPIKNNFSEEDLNNLFEHTITFDTIKNKINVNFISNSKYKKDILDIEN
FT                   NKVKTIYINCNVSGSNEYNKKINLGNGLTLESGKYFDTKTNKFIKDIPEIKETQTNSKP
FT                   ELNTKLKTYIYHSDVTLEWKSDDPSDVLVVNGEIKELSDNNTFRETFNIPLINKWNDET
FT                   QKEWKIHITSKNPERKQKIDYQFNIKIEPIVKENLEIKNLGWKPDEKADKNTKEYNQWL
FT                   ITQEFLFDKDGNRQPNPKFVPNLNPKTGFISNFIFYKTQYNWSNPKLRI"
FT   gene            complement(246123..246806)
FT                   /locus_tag="MMS_A0225"
FT   CDS_pept        complement(246123..246806)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0225"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69851"
FT                   /protein_id="ADK69851.1"
FT                   /translation="MKKLLTFLAISTFTTTSVGLPLLVFNNKTSLDKLTFKNLSSSESN
FT                   YIQAPTFRVGKTWDPFSNFTPYIFTTSWKYGSSSLDEWTDEKRLKGSQKSLNGYWAAEE
FT                   HFFAKTGEIDLTELGLSNLGDLRLISPEINISFSIERYYIEADIYDSTFEHKSIPNIKW
FT                   GYSGYGSPGGEVYFNVIDSYRLHGYTDLIKNHSKITKTFKIDDLKNQEDWIELEYFEKK
FT                   VNQTN"
FT   gene            complement(247174..247569)
FT                   /locus_tag="MMS_A0226"
FT   CDS_pept        complement(247174..247569)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69088"
FT                   /protein_id="ADK69088.1"
FT                   /translation="MNINKFTVDELKKVLSKDISLDDNLVKKICVKLNNRLFKSNIKQH
FT                   LKIIKLVKYILYKSRSFDENICDFLLDEIIFSSYKFELEKLIKIKECICLLKKFTNNKD
FT                   LNQFAINNNLFTYEQYLKENEKELLEN"
FT   gene            complement(247573..248241)
FT                   /locus_tag="MMS_A0227"
FT   CDS_pept        complement(247573..248241)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0227"
FT                   /product="D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /note="identified by match to protein family HMM PF02086"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69698"
FT                   /protein_id="ADK69698.1"
FT                   /translation="MKNIKPVISYYGLKYRMLKNIFSVLNLNSSDIFLDLFAGSGIVGV
FT                   NAKHLFNCQTIINDYDNVLPLNLTYALKNILSFEGNLKNYTKKRLDYFIKRLDNGWIDK
FT                   LNQYNKILQTIDITLFDYKQILKNIINNKNKVTKLYADPPYFNKTGMYKNSFTIQDHID
FT                   LYNLLSELKIQTKIVISYNDEPFIKELYKDWNIIEINKTNVCGINKNSSKVKELLITNI
FT                   "
FT   gene            complement(248242..249045)
FT                   /locus_tag="MMS_A0228"
FT   CDS_pept        complement(248242..249045)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0228"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69472"
FT                   /protein_id="ADK69472.1"
FT                   /translation="MKIIEEIVGQEKILNKLEIIIKEHKQNKTPFPFILIIGKQGMGKF
FT                   KISKWIHSHFDSNAIGVMSALFFNKDSLPFLVHFSQREIDHTSCLFKPEKVDKNSQKFL
FT                   DFIFKRDLKNINKTLIKIDKLNKSSTCQYNTELLPITLEQLNNFRFICFSESKNDLSKN
FT                   LLNKFDYIFEIEPYTYKGIKSILHKDLMHTNNYFTNNSIKHIIYHSRLNPEIAKLLLKF
FT                   TDVKLDNDELVSKADLKELFNKFNIYNLTNDQILDLCFKHNCMVY"
FT   gene            complement(249124..249537)
FT                   /locus_tag="MMS_A0229"
FT   CDS_pept        complement(249124..249537)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0229"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70057"
FT                   /protein_id="ADK70057.1"
FT                   /translation="MKEIKTILYYPQEIQKRLEDDKFDLFDSIIQELRDKDIIEEYLEQ
FT                   IYQFKPVSDFSSPKLLDFLENHNLGGFEDWIYIDKEENKLKVYEKTYVESIILADVLAE
FT                   LASYIAYRKDEILDFDYKEITLDKVDKKLLELE"
FT   gene            complement(249597..250199)
FT                   /locus_tag="MMS_A0230"
FT   CDS_pept        complement(249597..250199)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="This ORF contains tandem Palindromic Amphipathic
FT                   Repeat Coding ELements.; identified by match to protein
FT                   family HMM PF03382; match to protein family HMM TIGR02167"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69824"
FT                   /protein_id="ADK69824.1"
FT                   /translation="MSENIKQAIYNFDQTECLEIGYFTNDKDKIQIEQFKSTTKKVPSV
FT                   LPKEITSLAQAFKDNQNESIDGIQYWDTSNVTDMYSMFFNASSFNQDISNWNTSNVTDM
FT                   GEMFCFAESFNQPIGKWETSKVKNMRYMFCWAYKFNQPISNWNVLNVTNMDSMFYYAEK
FT                   FNQDLSNWNVLKVKREFQNIGASNPNWKPKHKPKFNK"
FT   gene            complement(250541..250885)
FT                   /locus_tag="MMS_A0231"
FT   CDS_pept        complement(250541..250885)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0231"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69874"
FT                   /protein_id="ADK69874.1"
FT                   /translation="MNSINTNIMALNPKNVINTFLGPVSIIIIIIQIITCVFLTLQAIK
FT                   AYIAYSNAEDVTKKRHELKRMIGLIVGIVLVASAWPIIQAALKTVDTNQKFVLNAINFL
FT                   PIVLPSLHLK"
FT   gene            complement(250872..251453)
FT                   /locus_tag="MMS_A0232"
FT   CDS_pept        complement(250872..251453)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0232"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70076"
FT                   /protein_id="ADK70076.1"
FT                   /translation="MDLQNDLKNEEILEQIKKARVKFEQQIYATSPNKVEKQFVQQLSN
FT                   LDNESFFKILEIPLTSSFERIEQAYKVLIFKKMTLNEQQIDFSNNQEIKVYDLPFNSTH
FT                   NEVIELPLKTNDFKEIEVETNKVKPEYESVEQEINNDFVGEVETNDSQQNEQENPIDSN
FT                   NQFKLPFKKTKSKRQKINKKYERINKYEFN"
FT   gene            complement(251590..251865)
FT                   /locus_tag="MMS_A0233"
FT   CDS_pept        complement(251590..251865)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0233"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69549"
FT                   /protein_id="ADK69549.1"
FT                   /translation="MFCSFYWIYYSKIIQVKKKYVQFYSNKQAKAELKLEKHQSKHKYQ
FT                   QLKKQTRLTINQTKLEKQKMKSENSKTNQQINFAKKQDCLDRKETI"
FT   gene            complement(251985..252101)
FT                   /locus_tag="MMS_A0234"
FT   CDS_pept        complement(251985..252101)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0234"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69510"
FT                   /protein_id="ADK69510.1"
FT                   /translation="MNQSIEYVNNNSYSKIIETSEQAKERIKKQKKLILYLL"
FT   gene            complement(252165..252470)
FT                   /locus_tag="MMS_A0235"
FT   CDS_pept        complement(252165..252470)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0235"
FT                   /product="single-strand binding family protein"
FT                   /note="identified by match to protein family HMM PF00436"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69624"
FT                   /protein_id="ADK69624.1"
FT                   /translation="MNLVNIVGQIEGDATVAYTSKDGAKKFYKFIVKVPKPYKSKEVDS
FT                   FDYINIKTWSNAVDDEFLLHDQAVVGIEGRIESFTSNNDLTNIRNEIFANRILYLN"
FT   gene            complement(252583..253068)
FT                   /locus_tag="MMS_A0236"
FT   CDS_pept        complement(252583..253068)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="This ORF contains tandem Palindromic Amphipathic
FT                   Repeat Coding ELements.; identified by match to protein
FT                   family HMM PF03382; match to protein family HMM TIGR02167"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69168"
FT                   /protein_id="ADK69168.1"
FT                   /translation="MAIILKQAIYNADKTECLEIGYFLNSKSEIQIQHMPITIKKVPSA
FT                   LPKEITSLKEAFQANLNKFIDGIQYWDTSNVTDMSFMFNGAQNFNQDISSWKTSKVKNM
FT                   SFMFSGCRCFNQNISKWDFSRVINISYMFEATNSFKKTYLNLILISYLLEKIERKTL"
FT   gene            complement(253122..254414)
FT                   /locus_tag="MMS_A0237"
FT   CDS_pept        complement(253122..254414)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="This ORF contains tandem Palindromic Amphipathic
FT                   Repeat Coding ELements.; identified by match to protein
FT                   family HMM PF03382; match to protein family HMM TIGR02167"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69236"
FT                   /protein_id="ADK69236.1"
FT                   /translation="MKKLLAILSSFTLASSITPMIVSCSWFFNGISGNSFLNSRNINSS
FT                   SNNNNTHKNNPRSNDNSTETKNLDSSLLVSLESNNFEVQPFNNSWEETSKIYQKEVTEL
FT                   ISELANWEIELFREEELSLDEIKSSYNELIYPSKIQIQWWKSVIKQVEYEQNKTQTNLR
FT                   NLIIQLKRTIDYIDNQKHLNSDINDNNKSADSIKTLNNLKTFLTNQLENFKKQLSNEKL
FT                   ERETLYDSNDETICTQIGYFTNHKGEIQIEQFKSTTKKVPKDLPKEITSLKAAFADNKN
FT                   ITIDGIESWDTSNITNMSELFTKATLFNQNISNWNTSNVTDMSFMFEDSNSFNQDISNW
FT                   DTSNVKNMNKMFSNAKSFNQEISTKKIGDESNQYIGWNTSFVKNMVGMFSGADSFNQNI
FT                   SNWNILNLENLNNFSSSDSKWKPEYKPKFNK"
FT   gene            complement(254469..254600)
FT                   /locus_tag="MMS_A0238"
FT   CDS_pept        complement(254469..254600)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69610"
FT                   /protein_id="ADK69610.1"
FT                   /translation="MNKKELISEIFFKRKTGEQIIIPASKTAKFKPAKKLKELLTEQ"
FT   gene            complement(255119..255979)
FT                   /locus_tag="MMS_A0239"
FT   CDS_pept        complement(255119..255979)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0239"
FT                   /product="putative transposase InsK for insertion sequence
FT                   IS150"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69438"
FT                   /protein_id="ADK69438.1"
FT                   /translation="MLKTHKKVKIPILLKIAKLPKSSFYEWKHKLENTIDKDKELKEMI
FT                   VDIFSKSFETYGYRRLKMALKSKGYIVNHKKILRLTKELGVQCIKFRTKNGRYSSYKGT
FT                   VGKIADNVLKRNFHSLQANKLWCTDVTEFKVNGQKLYLSPIIDLYNDEIISYSIQTNPN
FT                   LNLTNSMLDKALKKVKNTNGLLIHSDQGFHYQHISWAKKLEENNITQSMSRKGNCLDNA
FT                   IIENFFGLLKQEIYYGEKYNSVEELTKRIHKYIYWYNDIRIKEKLKGLSPVQFRKQSCY
FT                   NIEKF"
FT   gene            complement(256045..256530)
FT                   /locus_tag="MMS_A0240"
FT   CDS_pept        complement(256045..256530)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69740"
FT                   /protein_id="ADK69740.1"
FT                   /translation="MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRF
FT                   EAFGIEGLINKEKKPYYSAKLKLKIVLYKLETNHSYDEVAKKFNIIYSSTIAGWVKKYR
FT                   EYGFLGLNNNIGRPKKIMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEF"
FT   gene            256968..257576
FT                   /locus_tag="MMS_A0241"
FT   CDS_pept        256968..257576
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0241"
FT                   /product="transposase, IS3 family"
FT                   /note="ORF exhibits 99% identity to 3' terminal ORF of Tra
FT                   Island in M. leachii PG50 and 79% identity to MCAP_0315,
FT                   the 3' terminal ORF of Tra Island I of M. capricolum Kid.
FT                   ORF is apparently interrupted by IS1296 insertion
FT                   (MMS_A0239 and MMS_A0240).; identified by match to protein
FT                   family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70053"
FT                   /protein_id="ADK70053.1"
FT                   /translation="MRKYKLIVCWLKNKRHNKHKSGHNKFNIPDLIQRNFKSVIEFGKV
FT                   LYTDVTYLIYKGKKTYLSTMLDGASRQIIDYRISEKNNSNLINTNFKNAIYKLKQLNIN
FT                   TNNIIIHSDHALVYESNSFRKICKKYNILQSMGANYSCTDNAVIESYHAQLKKNTIHSN
FT                   KKNYKDFNDYLKDVSEYLKWHNQEKESKINLNKRKILKF"
FT   gene            257820..259649
FT                   /gene="typA"
FT                   /locus_tag="MMS_A0242"
FT   CDS_pept        257820..259649
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="typA"
FT                   /locus_tag="MMS_A0242"
FT                   /product="GTP-binding protein TypA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF08477;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR01394"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69812"
FT                   /protein_id="ADK69812.1"
FT                   /translation="MNNQKIINIAVIAHVDAGKSTLVDALLKQSGVFRQNQEVIEQVMD
FT                   SNDQERERGITIYSKNCSITYKDYKINIVDTPGHADFSSEVERIMKTVDTVILLVDSSE
FT                   GPMSQTRFVLQKALEIGLNPILFINKIDKKDQRSLEVVEEVIELFLELNATDEQLDFKT
FT                   LYGIAKNGIAQYSLEEQSNDLTPLFETIINQVGSYPTELSNNDLVMQVSSLAYDSFIGR
FT                   IGIGRIFEGSIKENQIVSIVKNDRIIKQGKIAKLMVYQGLNRVQVKQAFAGDIITFAGI
FT                   EDISIGDTINNLNIIKPLKPIHIEEPTMSMNFLVNTSPFAGRVGKFVTSRNIKERLEKE
FT                   VEVNVGLRIEPLINSEIEGFKVLGRGELHISVLIEAMRREGFELAISKPEVIFQRNPMT
FT                   GDLLEPIEKVIINTPTEYSGTVINKLNQRKGIMLDMDSDGIRDKITYSIPLRGLIGFRS
FT                   EFTNDTHGEGIMVKSSSGYELYKGEIVSRQNGVLVSMANGKSLPYALNNLEERGILFIG
FT                   PQVDVYEGMIIGQHSRDNDLYVNPTTAKKLTNTRASGTDDAVKLTPARKMSLEEALEYI
FT                   SNDELVEITPTDIRLRKRWLTQAEQKQHRNDKY"
FT   gene            complement(259681..260445)
FT                   /locus_tag="MMS_A0243"
FT   CDS_pept        complement(259681..260445)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0243"
FT                   /product="Eco47II restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69960"
FT                   /protein_id="ADK69960.1"
FT                   /translation="MSNEFILDFISKQDFEKHVTDTINQYKESLKSISLKKLNRNIVDP
FT                   IKLIFDKNIFNKEFKEIIELEISRQRDKTNNNVIGYFHQNIFKYIKNCKVPPQGWDVIF
FT                   QSSEYTYYVEMKNKHNTMNSVTASGIYMKMQNHLLNYDNNEKSVCALVEVIAKRSQNIP
FT                   WVMKIKNQKPIGNRRIKRISIDKFYEIVTGIKDSFKNLCLQLPITLEKLVSENVFLKVE
FT                   KDTVFEELSKINNDIVLALYKLAFSTYEGFEF"
FT   gene            complement(260438..261463)
FT                   /gene="dcm"
FT                   /locus_tag="MMS_A0244"
FT   CDS_pept        complement(260438..261463)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dcm"
FT                   /locus_tag="MMS_A0244"
FT                   /product="DNA (cytosine-5-)-methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="identified by match to protein family HMM PF00145;
FT                   match to protein family HMM TIGR00675"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69359"
FT                   /protein_id="ADK69359.1"
FT                   /translation="MSNSYKSIELFAGAGGLALGLEQAGFEHVGLVEFDKQAVETLKFN
FT                   SPNWNIVFEDVQKVSQRDLKKEFNLKERELDLLSGGAPCQSFSYAGKRLGLDDIRGTMF
FT                   YHYATFLNKLKPKMFLFENVKGLLTHNKGQTFQTICDIFSQQGYEITYKVLNALDYMVA
FT                   QKRERLIVIGIRNDLTNLIKFEFPKKHQKKLVLKDILKNVPKSECAKYSKEKQEIFKLV
FT                   PPGGCWKDIDQNIAKKYMKSCWNMEGGRTGILRRLSLDEPGLTVLTTPQMKQTERCHPL
FT                   EIRPFSIRENARIQSFPDDWVFKGTIASQYKQIGNAVPCNLAKEIGKSIIKSLQGIDVN
FT                   E"
FT   gene            complement(261456..262727)
FT                   /gene="sun"
FT                   /locus_tag="MMS_A0245"
FT   CDS_pept        complement(261456..262727)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="sun"
FT                   /locus_tag="MMS_A0245"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01029;
FT                   match to protein family HMM PF01189; match to protein
FT                   family HMM TIGR00563"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70069"
FT                   /protein_id="ADK70069.1"
FT                   /translation="MNSRYIAFDILKKVFVNKAYSNVLLNKISKKDLNQQTKDFIFNLV
FT                   HGVISNKIHLDYLLTKLIDVKKTSIDLQIILLISLYQMIYLNSIPNYAIVNESVNLIKT
FT                   TSQKQANFINAILNKFLRFKDTYLEINLDNKDLELCILHSFSYELYLMLIKQYDKDIVN
FT                   QIVVNNHQIPKLYIRLNTLKITSDQLFNKYKDIYLLKKTNVNDCLIANKTIINSNLYKN
FT                   GFITIQDKASILVSQILNPSLNTKVLDMCSAPGGKLTHLSMILKNTGNIIGNEINESKI
FT                   KLIKENINRLNCLNISLTNMDARKIKQKEEFDYVLLDAPCSGFGVFKRKPEIKLRFDQV
FT                   QVNSIINLQEELLESAYYNLKNNGEMVYSTCTINQDENQNQITKFLNRHEDMVKLYEKQ
FT                   IFGFEENTDGFYICKLKKLKENHE"
FT   gene            complement(262717..263610)
FT                   /gene="gmk"
FT                   /locus_tag="MMS_A0246"
FT   CDS_pept        complement(262717..263610)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gmk"
FT                   /locus_tag="MMS_A0246"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="identified by match to protein family HMM PF00625;
FT                   match to protein family HMM TIGR03263"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69557"
FT                   /protein_id="ADK69557.1"
FT                   /translation="MKKGKMIIISGPSGVGKGSVNGELLQNPDLHLRYSVSMTTRKPRN
FT                   GEVDGVNYFFVSNEEFAKAIVNDELIEYAHFVGNSYGTPRKYVEQELKKGNNVILEIEV
FT                   DGATQVLNKEPNVLSIFLMPPNPTELANRIRGRQTEDEEKIKARLDKALLEIPLKHNYQ
FT                   YVIENDNVPNAVAKITDVLHLEGLTDIKTPTVYERLEQIVEQIVKEKYMYFVNNWETNV
FT                   KLLAKNEEEKNKAKNFDAETYLIKLLTKKVYHKVLGHGDFSKLLDKDFVDFKIQKLMFK
FT                   INFFSVEQKHYNNDEF"
FT   gene            complement(263613..264185)
FT                   /locus_tag="MMS_A0247"
FT   CDS_pept        complement(263613..264185)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0247"
FT                   /product="RNA methyltransferase, RsmD family"
FT                   /note="identified by match to protein family HMM PF03602"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69959"
FT                   /protein_id="ADK69959.1"
FT                   /translation="MIGVIMHIISGKYKKMKLQTLDSSITRPTLTRIKEDMFNIISNYF
FT                   IFENKTSLDLFGGSGSLSIEGLSRGIKFAIINDLNKDANKIISFNLKKIPTSDYVLYQK
FT                   DYLDLLNLLKVQHQKVDLVYLDPPFKQIEYYYVVFAFLINNNLLNDWAIIISETNQKLD
FT                   LTKIKDLSLLKFKDYNKKYLYIFRLEK"
FT   gene            264244..264846
FT                   /gene="def"
FT                   /locus_tag="MMS_A0248"
FT   CDS_pept        264244..264846
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="def"
FT                   /locus_tag="MMS_A0248"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69341"
FT                   /protein_id="ADK69341.1"
FT                   /translation="MDKSYLLQDKIPSNSWLVKDHKKEIIRTKSTKIIDPTNLSNNEEL
FT                   VLKKLIDFVTFSQDENNNNINNKDYLRPAVGLAAPQIGVNKDMFYVRFQLDNNKIEQYA
FT                   MINTKLISTSTQIACLKNGEGCLSVDNYHLGFVPRHYKIVVQGYDWLTKQYLTLTLRNY
FT                   QAIVFQHEMDHNIGVLYYDHINKTDPLYKNNNWIIIE"
FT   gene            265036..265581
FT                   /gene="infC"
FT                   /locus_tag="MMS_A0249"
FT   CDS_pept        265036..265581
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="infC"
FT                   /locus_tag="MMS_A0249"
FT                   /product="translation initiation factor IF-3"
FT                   /note="identified by match to protein family HMM PF00707;
FT                   match to protein family HMM PF05198; match to protein
FT                   family HMM TIGR00168"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70078"
FT                   /protein_id="ADK70078.1"
FT                   /translation="MENRNRNSRPIKNQDPVNEFIRAHQVLVIDEDKQNLGVMSKRQAL
FT                   EIARSKNLDLYQVGVQPDGTVITRIVNFGKLKYEQQKKSKEAKKHQTKIENKEIRITVN
FT                   IGKHDLETKARKAKEFLEEGSRVKVSLKFRGREVVYLDLGQQTLNNFFELVSDVGKMEK
FT                   EAKLNGKFLDMYIVPKKN"
FT   gene            265607..265798
FT                   /gene="rpmI"
FT                   /locus_tag="MMS_A0250"
FT   CDS_pept        265607..265798
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmI"
FT                   /locus_tag="MMS_A0250"
FT                   /product="ribosomal protein L35"
FT                   /note="identified by match to protein family HMM PF01632;
FT                   match to protein family HMM TIGR00001"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69488"
FT                   /protein_id="ADK69488.1"
FT                   /translation="MPKMKTKKSLAKRVTVKSNGTLKRAKAYRSHRATGKTTKQKRQLS
FT                   KATIISKVDMKNLKGLLQ"
FT   gene            265817..266182
FT                   /gene="rplT"
FT                   /locus_tag="MMS_A0251"
FT   CDS_pept        265817..266182
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplT"
FT                   /locus_tag="MMS_A0251"
FT                   /product="ribosomal protein L20"
FT                   /note="identified by match to protein family HMM PF00453;
FT                   match to protein family HMM TIGR01032"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69673"
FT                   /protein_id="ADK69673.1"
FT                   /translation="MARVKYGKVKVTRARRKRWIKLAKGYFGTKKSSYKKAHEQVIRSM
FT                   AYAFIGRKERKRDFRSLWIVRINAAVRPEGLSYSTFMHGLKLANININRKMLSELAINN
FT                   NEEFKKIVKQAKKALNK"
FT   gene            266547..267602
FT                   /locus_tag="MMS_A0252"
FT   CDS_pept        266547..267602
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0252"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70081"
FT                   /protein_id="ADK70081.1"
FT                   /translation="MENNILELRNVTKEYDGQVVLKGISFNVKEGEFITLLGPSGCGKT
FT                   TILKIIGGSQKPNSGEILFEDKNLIPIPINKRQFNTIFQSYALFPHLNVFDNVAFGLTI
FT                   KKTKKDIIEREVMRQIRQVGLEGYENKKIDELSGGQKQRIAIARALVMKPKVLLLDEPM
FT                   AALDVKLRKTMQEELKRLQQDIGITFIMVSHDQEEALSMSDRIVVMNQGTIQQIGTPEE
FT                   IYNEPENAWVANFIGSSNIITDGIFLEDNKIKFDGKVFECIDTNFGENESSIDIIIRPE
FT                   DIIIKNPNNGFFNAKVIKTTFKGIHWEIVVETSKKRQWIIHTINEYDVDQQVSIKWKPA
FT                   NVHVMWKEVDN"
FT   gene            267602..268594
FT                   /locus_tag="MMS_A0253"
FT   CDS_pept        267602..268594
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0253"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69466"
FT                   /protein_id="ADK69466.1"
FT                   /translation="MENKNLKDNNVIENKIINQDELEQVIENIEKQKKRESLRLKVKDI
FT                   NHYLSKTKLFHFSKDKVWPILAPFILVMVILVILPLVSILIYAFIQPADGITLFKISFE
FT                   KFAKLFTSNGILYSLFLSILYAIVAGMLCVLIGYPIALMMAQMKSKILARNMWVIVTMP
FT                   MWISMLLKVLGLQTLFYLLADFAIGTPIAIIIGMTYMFLPFAIAPIYDSLESRQTDLEE
FT                   AALDLGASKFRTFWSITLRSSIPGVLTAFSLVLVQAATSLIVVHYMGGGRIYLVSAAIE
FT                   SYFFQGNDFGYGAAVSVVLAILVFGLMLVMKLISNKFEMKGNKRKWKNS"
FT   gene            268579..271707
FT                   /locus_tag="MMS_A0254"
FT   CDS_pept        268579..271707
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0254"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69788"
FT                   /protein_id="ADK69788.1"
FT                   /translation="MKKLLKRSYFAFVLLFIYAPILAMVVFSFNNGDTTIKWTHVSFSW
FT                   YESFFKNSPFIKSIITSLFVAVISTIVSLVIGTLAAIGLSRVNRVTKNKWVSIANIPLI
FT                   NADVITAVSLMIVFLIMGLKFGLLTLIMAHISFNVPYVLVTIMPRLKKIDPSLIDASYD
FT                   LGAKNHQVMFKVILPILKSAIITAAAIAFAMSFDDFIISYFTGGMQTNVSTFIYTAKKT
FT                   RPFIFVFGTCLVLVIALSIITWNAINLIKQSRLETKQKLINNNYKLKTISKLNKQLDEL
FT                   NQILKSKTIIKKSHNLSLWVKYFILKTKLYFYKLQSLDKKISKLQWKQYKLKSKIQKEE
FT                   RYYSRLKKSEEKLKQLIKQFSNEKDVKKAAKLSLQIETLQEKVEFLKDQIEVIKEREQT
FT                   ANLKVKKLQNKIKLLKQDLSEEVNPSKKTINWYNKKIKYFEEWIIELEEGKDYYKLKLV
FT                   VEKLKDLKNIKNNKISDLTDQLNELINRIYVPVLITKDIDLKIQNTTDIELLNNLNHKK
FT                   EVIIDKFTKLYNQKIDKTTFLIQKVNQKADKLKTRLLPSSDENVSHSKSFISRSWKAIL
FT                   ITFIGIGAFSGLTAAYVLNNIYDLVVANWGEYIDPSLIGQFEQQASQKHNRRIRINYQI
FT                   YNSNEILYNKLHTVDYDIMIPSDYMVQRLASENYLQKIDYSKLNIWGKFTGNGNGFNQG
FT                   NETKDNNKYKHLQVNQSLLDLMLKSPIHREDETKDIITKNPNGTYLNTNSILDYSIPYL
FT                   WGDLVIVVNPTPENIEFLKKNNIQFKNNNKDNENENKNKEVEIENSSLSWDILWKAAAA
FT                   GKKVALNNDPKNVFMLGSQKLYQKVNLTKKSEIDEVGKELSKLLSNSGVSLHSDDLISL
FT                   VVREKFDFAVMYNGDAAYANYVHNEGDDDYEKASSNINFIYGRPNKKNEKNNRHESTNV
FT                   FSDNIVLYKDAQNLDLAYEFINFLYENSTKISDYVGVTSPLDSAIEEMTAAPKEENGED
FT                   EGGTYQDFKNIYDPITHQNGSKYETNNEQLSFTYNGKIDEYLVNSFNNLLANK"
FT   gene            complement(272053..272211)
FT                   /locus_tag="MMS_A0255"
FT   CDS_pept        complement(272053..272211)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69587"
FT                   /protein_id="ADK69587.1"
FT                   /translation="MFLKVVLIEKSFALLKKDLLEIFTKFQNRFKTIEFGDILKEMGIK
FT                   LENFYQL"
FT   gene            complement(272352..273011)
FT                   /locus_tag="MMS_A0256"
FT   CDS_pept        complement(272352..273011)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0256"
FT                   /product="Abi-like protein"
FT                   /note="identified by match to protein family HMM PF07751"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69119"
FT                   /protein_id="ADK69119.1"
FT                   /translation="MKRSKEFKTFEEQIEILKSRGLIIKDEQKAIEILKQENYYNIVNG
FT                   YKDLFLRNTLNDKEDVFVENTTFDELYSLFLFDRELRSILLKYILIFERDFKTTIAYNF
FT                   SKKYNKDNRIDSYLYPENYRDNYVEVLNFISSINNIIVSKSEKSNYIRHYIENYGHIPL
FT                   WVAVNIMSFGNMSFMFKILKDEDRNQIILFYVMRFLNQNNKKVIPKNLEVKPFYLD"
FT   gene            complement(273144..273821)
FT                   /locus_tag="MMS_A0257"
FT   CDS_pept        complement(273144..273821)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69768"
FT                   /protein_id="ADK69768.1"
FT                   /translation="MLSFIAFLVTLVLLVFVSLSVFGGGQVFMPIFVWLWKSLNSWFKI
FT                   EISEEFINTVFAVSNSTPGILSPKFAAITGYMIAQGQWWGFVAMIFTYLAFVLPAIFMI
FT                   MIAIKYSQKFHQSTFFKRLIDIMNPVVAGIIIALAIEIFISCMFPYFVFNESVSEYWKF
FT                   IDPNKPSYSMKFFTGWRLIALYCYVPIGIIISLFLYLKKVPIFGLIFANIIFCLILFEP
FT                   WLG"
FT   gene            complement(273821..274009)
FT                   /locus_tag="MMS_A0258"
FT   CDS_pept        complement(273821..274009)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0258"
FT                   /product="chromate ion transporter (CHR) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69214"
FT                   /protein_id="ADK69214.1"
FT                   /translation="MKLSLWLVLFFTTLLFSLFVPTPYNVPVLVMILVIAIYSTIFIIR
FT                   SKKLKKIESNEIKKGIE"
FT   gene            complement(274009..274257)
FT                   /locus_tag="MMS_A0259"
FT   CDS_pept        complement(274009..274257)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69907"
FT                   /protein_id="ADK69907.1"
FT                   /translation="MLPGPAAIQTTAYIAFKSLSKFKAYLVVSLASMPHTFFAVGLVFA
FT                   FNKIPTQYLIVVQLGVLIAITGALLGFGYNYFKKGKK"
FT   gene            complement(274419..274556)
FT                   /locus_tag="MMS_A0260"
FT   CDS_pept        complement(274419..274556)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0260"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69412"
FT                   /protein_id="ADK69412.1"
FT                   /translation="MSKIGNFLIYWYKNIRIKEKLKGLSPVQFRKQSCYNIENFSPCLW
FT                   "
FT   gene            274766..276178
FT                   /locus_tag="MMS_A0261"
FT   CDS_pept        274766..276178
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0261"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70026"
FT                   /protein_id="ADK70026.1"
FT                   /translation="MVIPKDILKIPRPSSTRVKTTSKEGIYNVIQRTSIRKNGKIIPVE
FT                   KGVIGKIINGVFQSIEKQTYEVDIKSYGLFALNEKLNNHIFRELLNFYDFEDARKLYVI
FT                   ASLRTMFSDIKNEHLKHEYDTNFISEIYPKCALSSNTISSFLEKIGKSSSKMEDFMNKR
FT                   LEEFSNHSIVIDGMLKNNTSETNIFSEMSRKSRTKGSQNLNLIYAYDINAQEPVASSVY
FT                   PGNMLDYTAFRDFLRTYEIKNGFLILDKGFDDKECKNLMREKNIKYLIPIKINHTFKKF
FT                   NLKSGFNFTFTYDDDTIRAKKIIINNKYYFCYKSTLTEMVEKKNFISRAHKKGAYDEIK
FT                   LLERENLFGLIIFECNYDLDLKDIYVAYKKRWEIELLFKQFKNVLEQNEANVQGNYRLL
FT                   ATEFINFLSLIMLCRIKNHLLNSGVLDNRTISETFRYLSKIIKKRKSRKREEWDDVETL
FT                   KYIKEMKSILKI"
FT   gene            complement(276199..276969)
FT                   /locus_tag="MMS_A0262"
FT   CDS_pept        complement(276199..276969)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0262"
FT                   /product="putative transposase InsK for insertion sequence
FT                   IS150"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69757"
FT                   /protein_id="ADK69757.1"
FT                   /translation="MLKTHKKVKIPILLKIAKLPKSSFYEWKHKLENTIDKDKELKEMI
FT                   VDIFSKSFETYGYRRLKMALKSKGYIVNHKKILKLTKELVVQCIKFRTKNGRYSSYKGT
FT                   VGKIADNVLKRNFHSLQANKLWCTDVTEFKVNGQKLYLSPIIDLYNDEIISYSIQTNPN
FT                   LNLTNSMLDKALKKVKNTNGLLIHSDQGFHYQHISWAKKLEENNITQSMSRKGNCLDNA
FT                   IIENFFGLLKQEIYYGEKYNSVEELTKRIHKYIY"
FT   gene            complement(276978..277520)
FT                   /locus_tag="MMS_A0263"
FT   CDS_pept        complement(276978..277520)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0263"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69889"
FT                   /protein_id="ADK69889.1"
FT                   /translation="MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVKSLVNRF
FT                   EAFGIEGLINKEKKPYYSAKLKLKIVLYKLETNHSYDEVAKKFNIIYSSTIAGWVKKYR
FT                   EYGFLGLNNNIGRPKKIMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEFWK
FT                   KFHTLLTKEKSTRKKQK"
FT   gene            277768..278799
FT                   /locus_tag="MMS_A0264"
FT   CDS_pept        277768..278799
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0264"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69790"
FT                   /protein_id="ADK69790.1"
FT                   /translation="MLMIINRDFYLNQLINKMNNSKVKIITGIRRCGKSFLLFNLFYKY
FT                   LISINIPSDQIIKISLDGYDNRMYRTPTTLNNFIQSKITNKNKKYYLLIDEIQYCEPEI
FT                   NEFAPNTEKITFVDVLLSFYNNPNLDVYVTGSNSKMLSTDILTQFRGRGDEISLNTLSF
FT                   FEIYDLFENKDKALKHYMLYGGLPAIYNLKTDEEKQKYLKNTVDETYIKDILERNSLTS
FT                   ETGEILDTLLNFISSAIGSLTNPLRLANRFMSEKNIKINSTTISKYLNIFKESFLIRSS
FT                   IRYDVKGSKYFNTPLKYYFTDIGLRNAKLSFRQYEENHIMENIIYNELYRRDFNIDIGI
FT                   VEI"
FT   gene            279185..279457
FT                   /locus_tag="MMS_A0265"
FT   CDS_pept        279185..279457
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0265"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69109"
FT                   /protein_id="ADK69109.1"
FT                   /translation="MLKFNDKKEELTLVCLTDVKNKKYVVDTDLSTSFISDEKTIYMVI
FT                   KKDQKDLFRKLKIAFKNFVLENKYNINVDVDSFFNLLNECDCKEN"
FT   gene            279598..280539
FT                   /locus_tag="MMS_A0266"
FT   CDS_pept        279598..280539
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0266"
FT                   /product="cytosol aminopeptidase family, catalytic domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00883"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69603"
FT                   /protein_id="ADK69603.1"
FT                   /translation="MEFVNFARMLQDTPPNIATSEYLAEKIIQKAKEIDGLKVTVLAKK
FT                   EATKLGMNLFLAVNAGSIYEPQAVVLEYIGDENEPKKALVGKGITFDSGGYNLKPTKYL
FT                   EGMKFDMSGAAIMLSTVMALAKIKAKVNVVGIGMFTDNRIGSTATLPQSVVKSMNGLTV
FT                   EIDDTDAEGRLVLADGITYVIREKQATEIWEASTLTGSVVSALGSYATGVFTHCDKRWK
FT                   IVESVSKFSGERMWRLPLYEEHLEEVRNDAINADITNATKNYEAESSKAASFLNEFRED
FT                   KPYVHFDIAGTDSIKGRGQGVLVRTLFEIFNK"
FT   gene            280555..281238
FT                   /locus_tag="MMS_A0267"
FT   CDS_pept        280555..281238
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69536"
FT                   /protein_id="ADK69536.1"
FT                   /translation="MKLKNWTFYKAKQFVKLNESNEILKDIAVLVLRPDINKEKTLLAI
FT                   GLDKKVVNSLIIDLQNKVFEENELFEIFKENIGFVLTEEISEIDAKGLNLSNPIHPDNI
FT                   KSIIKIYNLFLNVEPIEFDTKDYQDLETIQNQEDVFTNVDFENIPLPALLQTLNVGMEN
FT                   YKQRVEEIFELDGKESINKKLELVNIQSNLIAFFDQALRKMDEIITKLSEQNAELIKKL
FT                   ESQEK"
FT   gene            281238..283028
FT                   /gene="pepF"
FT                   /locus_tag="MMS_A0268"
FT   CDS_pept        281238..283028
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pepF"
FT                   /locus_tag="MMS_A0268"
FT                   /product="oligoendopeptidase F"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01432;
FT                   match to protein family HMM PF08439; match to protein
FT                   family HMM TIGR00181"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69955"
FT                   /protein_id="ADK69955.1"
FT                   /translation="MKRPEALKEYKWDFDYLYKNQDEWKKDLDYLVEISKEFKNFKNKL
FT                   HQKETFLKCLDLDEKVNFITNKLSTYTKMGDTNQADEVYRTLEAWLMNVLQDIEIETSF
FT                   ISPETKKIGFETISKWLKETKDYQRYLYGYKKFFEQTKHILSEHDEELLSKISKGYTAI
FT                   SGMYDTLAYADRQEETINYKGIDQVLTNSLFLEILQDSDPIKDQDLRLKASAIFSKNFS
FT                   SKKHSFALIYEGILQSDHEDTKLRNYESSLQASLSSDSVPVDIYLKLLEVGKKYIKPLE
FT                   DFLLLTKKHFKLDKFYPSDKQLKLVKEYNQTFTVEQAKEHIRKALSILGEEYLKNLEIA
FT                   WGPNKIDYYEDTNKRDGAYSTGGHGVDPIILMNWDDKLNSVNTLAHECGHSVHTLFSEQ
FT                   SQVYPLSQYPIILAEVASTINEHLLFDYMYKNTKSKEEKIYLLQERIFNLVSTFYRQIQ
FT                   FADFEYRASQLVSNKTPLTSEVLNNLFKEVENDYGYKIFDKLDDNIKSGYGWPRISHFF
FT                   HSPFYVYKYAIDVTASYKLYDDIKRGNIQTTLDFLKAGGHKEPLEIMLDVGIDFNKEQT
FT                   YLPLINGISDHIKELEELLK"
FT   gene            283101..283586
FT                   /locus_tag="MMS_A0269"
FT   CDS_pept        283101..283586
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0269"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69344"
FT                   /protein_id="ADK69344.1"
FT                   /translation="MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRF
FT                   EAFGIEGLINKEKKPYYSAKLKLKIVLYKLETNHSYDEVAKKFNIIYSSTIAGWVKKYR
FT                   EYGFLGLNNNIGRPKKIMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEF"
FT   gene            283652..284512
FT                   /locus_tag="MMS_A0270"
FT   CDS_pept        283652..284512
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0270"
FT                   /product="putative transposase InsK for insertion sequence
FT                   IS150"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69963"
FT                   /protein_id="ADK69963.1"
FT                   /translation="MLKTHKKVKIPILLKIAKLPKSSFYEWKHKLENTIDKDKELKEMI
FT                   VDIFSKSFETYGYRRLKMALKSKGYIVNHKKILRLTKELGVQCIKFRTKNGRYSSYKGT
FT                   VGKIADNVLKRNFHSLQANKLWCTDVTEFKVNGQKLYLSPIIDLYNDEIISYSIQTNPN
FT                   LNLTNSMLDKALKKVKNTNGLLIHSDQGFHYQHISWAKKLEENNITQSMSRKGNCLDNA
FT                   IIENFFGLLKQEIYYGEKYNSVEELTKRIHKYIYWYNNIRIKEKLKGLSPVQFRKQSCY
FT                   NIEKF"
FT   gene            284619..286283
FT                   /locus_tag="MMS_A0271"
FT   CDS_pept        284619..286283
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR03490"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69326"
FT                   /protein_id="ADK69326.1"
FT                   /translation="MRKFNKLFLTILPISSISAFSVVSCTTNTKNNNQIPTIPNNKKPD
FT                   NRPSENKPGSTEEHTNKEPNENTNNQKQPNSSEKSEAEPSPGKPENKPDNSHNQKQPEH
FT                   NNSNPNNTDNNNSNADQPQGDHPQEEPLNKVDFSDVNKLDKEVKFEFFTTYSRMDAKSA
FT                   WVQIQGRQPAIFKEIIFKGKNEILNRYEIEFDSQKVPNIVDEKGTIDNVGIKFSKNGKS
FT                   KTREFVFTGFKKLENKIDKGKNKDEYIKPKTNIDKSLSGIFPSLVAYMLLYSEETQSNN
FT                   KYDRNIKQSGNVINFDELRNKNLELFGEDFVGFGVGTKELLFDYKDEYNKIYKDKIVAA
FT                   RYDDINGILELEAQVSNTDEYENRNDPTKNYKFTFKGFRSIDFNNTNKNVLSISLQQRF
FT                   LKKLVDNKILKTIIDQLVQHNHFNHKAPVSNINNSNLKGELFEKLTVDIIDDENYLYKS
FT                   SQTLKIGLFKKENNNKSILGLKNQMSLYPFHSRITKDSIKNIYVTINNKSAIKELELEA
FT                   EIQIPIYSSILTDLTDHTYAEEKPLKITVNQKIKLDQ"
FT   gene            complement(286317..287198)
FT                   /locus_tag="MMS_A0272"
FT   CDS_pept        complement(286317..287198)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0272"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF08282; match to protein
FT                   family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69752"
FT                   /protein_id="ADK69752.1"
FT                   /translation="MKLKDLNLKRLILIDLDGTTLTNQNDQIHKITKKAILDAQKNGHV
FT                   VCIVTGRPFRAVEHIYKELKLTTLLANFDGAHIHDPNNKLMKRVVLPINYEIIKQIINE
FT                   PVIKDNVENILIEYYDKSLLWKTDKELEDFFHLNKAKNSKDFQFIKASPYTDWKSPSNN
FT                   LVLKLKSDKHKDEVIRVLTKYQDAIKIQSDILYGITTSKTKPVITLTNKNADKGFASIF
FT                   LAQYYNKDIRDVIAFGDQLNDLEMLKTVGCSVAMKNGVNSLKFVAKGITHYTNDEGGLG
FT                   HYLNLLLDGKEV"
FT   gene            287519..287815
FT                   /locus_tag="MMS_A0273"
FT   CDS_pept        287519..287815
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0273"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69095"
FT                   /protein_id="ADK69095.1"
FT                   /translation="MQINRDYYLNKLISKKNNNKIKVITGIRRVGKSYLLFNIYKNYLL
FT                   SIGINEDQIITLKLDKWENADYRKLDSLYNYIKQRTSNPNKTYYVFIDEIQYC"
FT   gene            287933..288811
FT                   /locus_tag="MMS_A0274"
FT   CDS_pept        287933..288811
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0274"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69393"
FT                   /protein_id="ADK69393.1"
FT                   /translation="MLSSDILTNFRGRSSQIKVYPLVFNEINYLFKNDDEALDHYINYG
FT                   GLPEVYLNQTIEEKKYLTNQFEEIYLKDIKERYNIQKEITILETLLKFVSLAIGSFTNP
FT                   TKLQNRFKSEMKTDISSNTIANYLSYFENSFILSHIEKYDVKGNKHFSSINKYYFTDIG
FT                   LRNACINYRQIESNHIIENIIYNELVKRNYSVYVGSVEYQTNSENKRTTKQLEVDFVIQ
FT                   KASKKYYIQFAMNVYTKQKKEQEINSLLRIKDNFKKILIVYDDIEPRYDENGILYIGLK
FT                   QFLLDENIIDI"
FT   gene            289121..289324
FT                   /locus_tag="MMS_A0275"
FT   CDS_pept        289121..289324
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70001"
FT                   /protein_id="ADK70001.1"
FT                   /translation="MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRF
FT                   EAFGIEGLINKEKKPYYPTFPT"
FT   gene            289417..291090
FT                   /locus_tag="MMS_A0276"
FT   CDS_pept        289417..291090
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0276"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69223"
FT                   /protein_id="ADK69223.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNDRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            291141..291572
FT                   /locus_tag="MMS_A0277"
FT   CDS_pept        291141..291572
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0277"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69857"
FT                   /protein_id="ADK69857.1"
FT                   /translation="MFSCFMLKLGNVGEGLINKEKKPYYSAKLKLKIVLYKLETNHSYD
FT                   EVAKKFNIIYSSTIAGWVKKYREYGFLGLNNNIGRPKKIMKNPNKKPAKIKKSQVKINN
FT                   EQQIKELKEQVEYYKLEAEFWKKFHTLLTKEKSTRKKQK"
FT   gene            291581..292441
FT                   /locus_tag="MMS_A0278"
FT   CDS_pept        291581..292441
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0278"
FT                   /product="putative transposase InsK for insertion sequence
FT                   IS150"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69202"
FT                   /protein_id="ADK69202.1"
FT                   /translation="MLKTHKKVKIPILLKIAKLPKSSFYEWKHKLENTIDKDKELKEMI
FT                   VDIFSKSFETYGYRRLKIALKSKGYIVNHKKILRLTKELGVQCIKFRTKNGRYSSYKGT
FT                   VGKIADNVLKRNFHSLQANKLWCTDVTEFKVNGQKLYLSPIIDLYNDEIISYSIQTNPN
FT                   LNLTNSMLDKALKKVKNTNGLLIHSDQGFHYQHISWAKKLEENNITQSMSRKGNCLDNA
FT                   IIENFFGLLKQEIYYGEKYNSVEELTKRIHKYIYWYNNIRIKEKLKGLSPVQFRKQSCY
FT                   NIEKF"
FT   gene            292823..292999
FT                   /locus_tag="MMS_A0279"
FT   CDS_pept        292823..292999
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0279"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69830"
FT                   /protein_id="ADK69830.1"
FT                   /translation="MTNPKYGLKLKQIPKNVKKVPSFLLKEIISLESAFKDNGNAKIDG
FT                   IEYWDTSHIKNMY"
FT   gene            complement(293531..294439)
FT                   /gene="murQ"
FT                   /locus_tag="MMS_A0280"
FT   CDS_pept        complement(293531..294439)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="murQ"
FT                   /locus_tag="MMS_A0280"
FT                   /product="N-acetylmuramic acid 6-phosphate etherase"
FT                   /EC_number="4.2.-.-"
FT                   /note="identified by match to protein family HMM TIGR00274"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69036"
FT                   /protein_id="ADK69036.1"
FT                   /translation="MKSNNILDIETENINKNSLDIDKKSTSEIIKIINNEDIKVAYAIK
FT                   KELNQISNVIDLIFERFKKGGRLIYIGSGTSGRLGILDASEMYPTYGIDQNRIIGIIAG
FT                   GNKAIKNPIEGAEDNEKLAIVDLNKIKLNSFDTVIGIASSGKTPYVLSALKYANKKDAL
FT                   SIGLCMVKNSEMTKIANQVISIKTGAEIITGSTRMKAGTATKLVCNMITTTLMIKLGKV
FT                   YKNLMIDLVATNDKLKNRAFKIVKQLTSAKDQIIYKALAESNFSCKHAIVMILRKISYN
FT                   ESVLLLENCDNSLTKLLEEKV"
FT   gene            complement(294442..295062)
FT                   /locus_tag="MMS_A0281"
FT   CDS_pept        complement(294442..295062)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0281"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69647"
FT                   /protein_id="ADK69647.1"
FT                   /translation="MGNVGVNGLFPILAMAGMAQVGTGIALWFLANKKSLLRRQIQGAI
FT                   IPAIFGIGEPMIYGITLPRIRLFITASIAAGFGGFFLGSIYLWGNVHFGLNSMFGPSGI
FT                   LATFMMTTQDKNIGLGVLIYLLGCLVSIIFGILVTLFGYSKISRIGISKMKEIYKNDQY
FT                   KLGYKILLTVIFITIIGIFIYWIISYYKLPKQERIKLANIKVE"
FT   gene            295159..296832
FT                   /locus_tag="MMS_A0282"
FT   CDS_pept        295159..296832
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0282"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69464"
FT                   /protein_id="ADK69464.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSCNKK
FT                   RINGHFRRQIISFSQKRATKDKNDRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKIT"
FT   gene            complement(296902..298035)
FT                   /locus_tag="MMS_A0283"
FT   CDS_pept        complement(296902..298035)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0283"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69664"
FT                   /protein_id="ADK69664.1"
FT                   /translation="MTKDPKITAKEILNIIKIDNINSYTNCLTRLRLNIKKNNIDLEKL
FT                   KSIPNVLGVINVSSNELQIVLGSGFVNKVTEEFSQLLKANNSKDDKFMSASEVGDIVKQ
FT                   NLRTNKNWIQDFFTKFSKIFSPMIIGFIGAGILSGVGGIIQSSYGGTVNLKTAPAVVVS
FT                   WFNALNLILNIWKNAFIIIVGWRTCEIWGGSGVLGAMTAALFSPVFSNSILPMIVINNK
FT                   DSINYLGINITNPTTNWLTVGFRPVIKNDQIIFSYPSGNILGALLTAYASLWIEKIIRK
FT                   FTPGILDTILTPTLTLFLLLIINIFLIIPISGYLYSAVAWFFSNLYTNPFGAFVLSTIF
FT                   LLSVSFGVHQGFVPIYAILIEKTGVNGLFPILLRFPV"
FT   gene            complement(298154..298987)
FT                   /locus_tag="MMS_A0284"
FT   CDS_pept        complement(298154..298987)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0284"
FT                   /product="SIS domain protein"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69298"
FT                   /protein_id="ADK69298.1"
FT                   /translation="MTEKQIIRTIKKISLDTDHRFCFIANYVLSNLDSIEKMTINQLAK
FT                   ATYTSVATINRFVKFLNLDGYKELVHIIKYFKNSLQGDQITYSLTSNSLILNAYNNIIS
FT                   SLDETSKLTIEQQDTIKNLISKIKKALKIAVFAVGGTFNIAKDFQQKLLRIGFNITAVN
FT                   DFHNGYLLANQLNNNDLAIFVSYSGETLDLIKLAQVCTKNNVQIAVVCKATNNTLSNLS
FT                   NYLINISSNEKIDRLVSTTSRFSLLFALDLIYIFLLSTDLKNYTELLEKTMISKF"
FT   gene            298995..299108
FT                   /locus_tag="MMS_A0285"
FT   CDS_pept        298995..299108
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0285"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69759"
FT                   /protein_id="ADK69759.1"
FT                   /translation="MPFLFVFSNTNQIIISKIKPIPDIDKNIIAKLINLVK"
FT   gene            299378..300733
FT                   /gene="eno"
FT                   /locus_tag="MMS_A0286"
FT   CDS_pept        299378..300733
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="eno"
FT                   /locus_tag="MMS_A0286"
FT                   /product="phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /note="identified by match to protein family HMM PF00113;
FT                   match to protein family HMM PF03952; match to protein
FT                   family HMM TIGR01060"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69781"
FT                   /protein_id="ADK69781.1"
FT                   /translation="MSRIERIFAREILDSRGTPTVEVEVWTEFGGYGCAKAPSGASTGV
FT                   NEALELRDGDKARYNGKGVLKAVKNVNEIIAPKLIGVDALDQLTVDRIMLDLDGTEFKT
FT                   KLGANGILAVSLAVAKSAASELDIPLYKYLGGVQAKKLPVPMLNVINGGEHADSAIDFQ
FT                   EFMIMPVGAKSFSEALRWSSETFQALKSLLKSKKDITAVGDEGGFAPNFEWAYEKHDLK
FT                   SFKAKTPAEIALDLLVEAIKKAGYKPGKDGIMIAMDCASSELYLEDKKYHFKKIEKVTN
FT                   QEWSLTTDEMISYLEKLVDNYPIISIEDGLAETDWEGFTKLTQKIGDKVQIVGDDLFTT
FT                   NPKFIKQGINKKAANSTLIKLNQIGTLSETVEAITMTQKAGWTAVVSHRSGETEDTTIA
FT                   DLAVAFNTGQIKTGSMSRSDRIAKYNRLLQIESELDKNAVYDGLEAFYNLKK"
FT   gene            300800..301621
FT                   /locus_tag="MMS_A0287"
FT   CDS_pept        300800..301621
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0287"
FT                   /product="PAP2 family protein"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69964"
FT                   /protein_id="ADK69964.1"
FT                   /translation="MKNKINHYYIYSGIVFIILISLFIIGSVYDFKIASFKRSENLNLA
FT                   VFISNLGVIIPSIPLTIALIYLIKSLKLKNKLKINNIIETLIYFIIPLGFIIFNFLYEK
FT                   QSIVYSIISNLLCLIIISSLIYYFHINKEIISNPDLSIYKAVIVLITIISLLIVINILK
FT                   LTFNRPRPTNLELYRNWWNIKWTSWKHNSFPSGHTYSATTLLFVLLLFNKINKKAYLWI
FT                   SFTWILIIIIAMSRIVLNKHFLTDVVFSVLLSFTISTIILIINHKKGKLFI"
FT   gene            301623..302054
FT                   /locus_tag="MMS_A0288"
FT   CDS_pept        301623..302054
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0288"
FT                   /product="RNAse YqgF"
FT                   /note="identified by match to protein family HMM PF03652;
FT                   match to protein family HMM TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69351"
FT                   /protein_id="ADK69351.1"
FT                   /translation="MTQSIIALDIGSKTIGLAYSSGVIASSLDTIRFEEYNFDQGLRQL
FT                   ESYLKKYNPTIIVVGYPKNMNNTIGERAEMVDYVIEMFLDMYKNFNKDQIIRIDERRTT
FT                   KIAKNILIQANLTREKQKKYKDSLAAQLILELYLESRKL"
FT   gene            302060..302632
FT                   /gene="hpt_1"
FT                   /locus_tag="MMS_A0289"
FT   CDS_pept        302060..302632
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="hpt_1"
FT                   /locus_tag="MMS_A0289"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70074"
FT                   /protein_id="ADK70074.1"
FT                   /translation="MQKLHPLVKEVLFTRDQIQKRTKEIAKEVESYYKDKPLKDNSLLV
FT                   VGLLKGCVPFYTDFCMVCDLTMEMDFMVVSSYHGSTSSNSAPKINLDLNTDVKDRDILI
FT                   VEDIIDTGFTLKYVKEYLLNKGAKSVKILTMLDKPSGRKIDLTADWVCFTIDPCFVIGY
FT                   GLDYQEKIRNLPYVAVCDTTKLDDWKW"
FT   gene            complement(302677..303456)
FT                   /locus_tag="MMS_A0290"
FT   CDS_pept        complement(302677..303456)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0290"
FT                   /product="transporter, major intrinsic protein (MIP) family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00230"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69881"
FT                   /protein_id="ADK69881.1"
FT                   /translation="MLEQIILTELFGTALLVLLGNGIVANVVLKGTKGQNAGWISITAG
FT                   WGFAVFIAAGISVGLGGVAHLNPAVTIMFAIKAADNSFGFNAKALTQISGVAMFFIVLI
FT                   VQFIGAILGSIFVDLLYWKHILATKSDNDFQPRVLAIHSTGATHKAPIFNFLMEFVGTI
FT                   VLLVGIWGLNATKTSAFTAIGPLAIGLLVFGIGLSLGGTTGYAINPARDLGPRLVHTFL
FT                   PLKDKGSSEWKYSWIPGLGPIAAAIFIGLIAMAVKIA"
FT   gene            complement(303492..305009)
FT                   /gene="glpK"
FT                   /locus_tag="MMS_A0291"
FT   CDS_pept        complement(303492..305009)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="glpK"
FT                   /locus_tag="MMS_A0291"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782; match to protein
FT                   family HMM TIGR01311"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69579"
FT                   /protein_id="ADK69579.1"
FT                   /translation="MTDSKKYILTLDEGTTSARALITDKQGNIIAVEQSEFTQYFPKEG
FT                   WVEHDAIEIWNTQRSALVQVLNKSGIDPSQIEAIGITNQRETAVIWNKETGLPIYNAIV
FT                   WQDQRTADYCQTFDKDTLEMVKQRSGLIINPYFSGTKVKWILDNVPNARQLAKEGKLMF
FT                   GTINTWLIYRLTGGEVFVTDHTNAQRTLLYNIHTNDWDDELLKLFDIPRNILPEIKSCS
FT                   EVYGYTFKGLFSKGNEQRIKIASSIGDQQSALFGQLCLEKGQVKVTYGTGCFILTNTGE
FT                   EIVKSNHGLLTTVAYSFKDKVYYALEGSVMIAGAAVQWLRDNLRIVYNAIETEWYAGQV
FT                   KDDRRVYVVPSFTGLGSPYWDSFSRGAIFGLDRGTRREHIVRATLEAIAYQANDVVDAM
FT                   RKDMKKPIEIFKVDGGAANNKFLMQFQSNISQSKVIKPTNVETTAMGAAFMAGLAVGYW
FT                   ENAEELKKTYKVHFELTPELSKPEVDKLIKGWKVAVQRTFKWVEEIE"
FT   gene            complement(305026..306189)
FT                   /locus_tag="MMS_A0292"
FT   CDS_pept        complement(305026..306189)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0292"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69504"
FT                   /protein_id="ADK69504.1"
FT                   /translation="MKQTKVDICIIGGGIIGASVARELAKFDKKIVVLEANPRLALETS
FT                   SHNSGLVHGGFDPRPETLNAKLNVLGKKRYEDWIKEMDFPYLRIDSTIVAFNDEEMKHV
FT                   HMLYDRGLINGLDPKEMQVIDAKELQKREPNISKQAVGALVCNSSIAIDPVLLTTTLMR
FT                   NAIKNGVELKVNSKVVDIKKVDNIFEIKTAKDEIIQAEVVVNVAGHYADVIANMAGYGD
FT                   FKLTTRRGEYRILDKSEAGIVNSVVFMVPTIHGKGVIVAPMLDGRVMVGPTALDGVPKE
FT                   ETLLVTQQQYDNIGKIGKHLIPNINMDKTCTVYAGSRPIDIETNDFIIRPAKNDKKFIN
FT                   VAGMKSPAIASAPAIADMVCDLVKNAFDKLDKKANWQPKEEAILPWK"
FT   gene            306523..307503
FT                   /gene="pfkA"
FT                   /locus_tag="MMS_A0293"
FT   CDS_pept        306523..307503
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pfkA"
FT                   /locus_tag="MMS_A0293"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="identified by match to protein family HMM PF00365;
FT                   match to protein family HMM TIGR02482"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69606"
FT                   /protein_id="ADK69606.1"
FT                   /translation="MIKKIGILTSGGDAPGMNNAIAGVVKTAASKGIEVYGINDGYKGL
FT                   VNGWFEKLNVEKTLDILSRGGTYLGSARLPEFKELEVRQKAVANLKKAGIEALVVIGGD
FT                   GSYMGAQKLTEMGINCIGLPGTIDNDISSTDYTIGFHTALNTIVEAVDRIRDTMQSHNR
FT                   ADVVEIMGNGCGDLVTYTAVATGAEIFSPAEDLLTIEQMGQKAKQFRLLGKKSLIILVS
FT                   EKSYGISAKEIAEKIQKISGYETKATVLGHIQRGGRPTAMDRYIAFTAGMFAVEKLAEG
FT                   KGGLFIGLENNKLVARDIDSTLNMKKEDKKPFIKYLREINGYFSK"
FT   gene            307575..309011
FT                   /gene="pyk"
FT                   /locus_tag="MMS_A0294"
FT   CDS_pept        307575..309011
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pyk"
FT                   /locus_tag="MMS_A0294"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="identified by match to protein family HMM PF00224;
FT                   match to protein family HMM TIGR01064"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69491"
FT                   /protein_id="ADK69491.1"
FT                   /translation="MTKEKLQKRMKRTKVITTIGPSTHSAEAIKELFNNGMTTIRLNFS
FT                   HGSYEEHGYRIKAAKKISKALNKPISIMLDTKGPEIRLGKFKDNKQEVVKGQAITIYTD
FT                   NYSYLNKECVQGEMTVAYDMSVDLKPEDMILIDDGKLELTVDSVEPQIIKATAFNHHIV
FT                   KTNKRVNLPGIDFSLPFLSEKDEKDILFGCEQDVDYIAASFVNTAENVRQIKEILTKAN
FT                   ANHIQIISKIESQVGLDNIDEIIEESDGIMIARGDLGLEIPYYDVPYWEKIIIRKCREK
FT                   GKIVIVATQMLETMTENPSPTRAEVTDVYYATELGADATMLSGESAAGDYPFLTVHTMS
FT                   TINKRAEVEFYNKIYYQVQLDNARNSTSGPRAEIADLLATKTKDGEYKYAIVLSKTGEL
FT                   LKTISKFRPNVTILGVSPDKKLWTSFGVWHSIFMNKVDTLDNLDNNVEKLSEIAKSWGA
FT                   KFGEKVLVVRSTAIKEIEVI"
FT   gene            309278..311197
FT                   /gene="thrS"
FT                   /locus_tag="MMS_A0295"
FT   CDS_pept        309278..311197
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="thrS"
FT                   /locus_tag="MMS_A0295"
FT                   /product="threonine--tRNA ligase"
FT                   /EC_number="6.1.1.3"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02824; match to protein
FT                   family HMM PF03129; match to protein family HMM TIGR00418"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69741"
FT                   /protein_id="ADK69741.1"
FT                   /translation="MKIKLLDGSIKEYNQEISVKDISLEIGLKNVIGAKINDQLFDINY
FT                   LIKNDCSLELITNKSKEYDLMLNLTAAFITSYAINNLKPISQAENFYNADEMEFSTTFD
FT                   TNPRLVLDDLKNIQTNINQLLTSNLEIKFHIYDLNKALEILNNDYQKYLAEQMYEKYHY
FT                   VKVYSINDFYMVINNALILNPNFVKVIDVEQLTGSYWLNDKNNIMLQRVHGLCATSNSE
FT                   LKNKKVILEDRRSRDHRLINKTLNIFGFDQLVGAGLPLWLPNGFIVKNEIEKYLRQKEW
FT                   EYDYIPVETPPIGTVELYKTSGHWDHYGEDMFQPFNGGKGSDEQFILRPMNCPHHIAVY
FT                   KQEQRSYRDLPLRICEHAIQHRFESSGSLTGLERVRGMKLTDSHIFVRSDQIEDEFRST
FT                   YKLISEVLNTFNIQIDYLSLSLRDPNDKVKFYKDDLMWDKAESSLEKVLIDLGLKYEKR
FT                   IGDAAFYGPKLDIQIKTAQNHEITVSTIQLDFLMPNKFDLTYIDKDQKLVRPIMIHRGL
FT                   IGTYERFIATLLEQTKGVLPLWLVPKQVEIIPISESNLEYANLIHQKLKKEFIRSHIDL
FT                   RDERLSYKIRDAQTKKVPYQLVLGNKEVENNTITYRQYGSEKQITISIQEFVDMLKQQI
FT                   KDKK"
FT   gene            311871..313235
FT                   /locus_tag="MMS_A0296"
FT   CDS_pept        311871..313235
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0296"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69079"
FT                   /protein_id="ADK69079.1"
FT                   /translation="MKVIVLGTNHAGTTAVRTLKRLDPTCEVTTYDKNDAISFLGCGIV
FT                   LWVKGEVKDPNMLFYATPEILRSEGVNVFMNHEVLSVDDKAKTVTVKDLKTGEVKTDNY
FT                   DKLIVATGTWPLIPPIPGIDLEGVQICKNYHHAKKILEHNLDKSYKKIAVVGAGYIGVE
FT                   LVEAFNEYGKDVTLIDVANRIMPVYYDQEFTDLMQEKMTKAGVKLSLGAKVIEFKGENG
FT                   KVTQVVTDKGNIDVDYVIFSVGVRPQSAILEGICDLDDRKAIVTNDFMQTTNPDIYAIG
FT                   DCAQVYNKAMNKNVPIQLATTAVRTGVIAAFNVIKGNGLKSPGFTGANGISVFGLHMAS
FT                   VGISVEAAKRMGYDVDFINFKDLDRPEFMSTANEVLFKVVWDKKTRKIIGAQVASEKNH
FT                   TEVMYMLALGIQKDLTIDELPLVDIFFLPHFNKPFNFISLAGLEVLGLNYFKKEK"
FT   gene            313238..314242
FT                   /locus_tag="MMS_A0297"
FT   CDS_pept        313238..314242
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0297"
FT                   /product="lipoyltransferase and lipoate-protein ligase"
FT                   /note="identified by match to protein family HMM PF03099;
FT                   match to protein family HMM TIGR00545"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69364"
FT                   /protein_id="ADK69364.1"
FT                   /translation="MINLLISKYHDPAMNLAIEEYLTYHYKAKEPIVFFWQNANTIVVG
FT                   RNQNAFAEINLEAAQKDNVKIVKRNTGGGTVYQDLGNVCYSLIVDNSTDDVDYQKALQP
FT                   IITYLNQKNINAMFSGRNDMVIDGYKVSGNAQLKTNEKTLVHGTLLFDVDLSKMPKYLV
FT                   VDPEKLKHQQIRSKPARVRNIKEFFKDINIDIDLNTFINDVVSSYVQNEKIKWIELTDQ
FT                   EKQYIQSRKETKFEQWDWTFGKNTVFSLVKKQYLESKGFITLNLDVDNGVITNIKIYGD
FT                   FLGTQGTEKLEAKLIGVKFNKKDVENVLNQFDLEAIFAKNFTSDDITNLLFKD"
FT   gene            314286..315398
FT                   /gene="pdhA"
FT                   /locus_tag="MMS_A0298"
FT   CDS_pept        314286..315398
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pdhA"
FT                   /locus_tag="MMS_A0298"
FT                   /product="pyruvate dehydrogenase E1 component, alpha
FT                   subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="identified by match to protein family HMM PF00676;
FT                   match to protein family HMM TIGR03181"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69954"
FT                   /protein_id="ADK69954.1"
FT                   /translation="MTYLGKFDPLKNEKVCVLDKDGKVINPKLMPKISDQEVLEAYKIM
FT                   NLSRRQDIYQNTMQRQGRLLSFLSSTGQEACEVAYINALNKKTDHFVSGYRNNAGWLAM
FT                   GQLVRNIMLYWIGNEAGGKAPEGVNCLPPNIVIGSQYSQATGIAFADKYRKTGGVVVTT
FT                   TGDGGSSEGETYEAMNFAKLHEVPCIFVIENNKWAISTARSEQTKSINFAVKGIATGIP
FT                   SIIVDGNDYLACIGVFKEVVEYARKGNGPVLVECDTYRLGAHSSSDNPDVYRPKGEFEE
FT                   MAKFDPLIRLKQYLIDKKLWSDEQQAQLEAEQDKFIADEFAWVEQNKNYDLIDIFKYQY
FT                   DKMDIFLEEQYKEAKEFFEKYPESKEGGHH"
FT   gene            315398..316387
FT                   /locus_tag="MMS_A0299"
FT   CDS_pept        315398..316387
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0299"
FT                   /product="transketolase, pyridine binding domain protein"
FT                   /note="identified by match to protein family HMM PF02779;
FT                   match to protein family HMM PF02780"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69449"
FT                   /protein_id="ADK69449.1"
FT                   /translation="MAIINNIKAVTDALDCAMQRDPNVIVFGEDVGTEGGVFRATQGLA
FT                   VKFGNDRCFNAPISEAMFAGVGLGMAMNGMKPVVEMQFEGLGLASLQNILTNISRMRNR
FT                   TRGKYTAPMVIRTPMGGGIRALEHHSEALEAVYAHIPGVQIVCPSTPYDTKGLILAAID
FT                   SPDPVIVVEPTKLYRAFKQEVPDEHYIVPIGEAYKIQEGNDLTVVTYGAQTVDCQKAIA
FT                   LLKETHPNATIDLIDLRSIKPWDKKMVVESVKKTGRLLVVHEAVKSFSVSAEIITTVNE
FT                   ECFEYIKAPLSRCTGYDVITPFDRGEGYFQVNPKKVLVKMQELLDFKF"
FT   gene            316416..317702
FT                   /locus_tag="MMS_A0300"
FT   CDS_pept        316416..317702
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0300"
FT                   /product="2-oxo acid dehydrogenase acyltransferase
FT                   (catalytic domain)"
FT                   /note="identified by match to protein family HMM PF00198;
FT                   match to protein family HMM PF00364; match to protein
FT                   family HMM PF02817"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70102"
FT                   /protein_id="ADK70102.1"
FT                   /translation="MFKVKFADIGEGLTEGIVAEVLVKVGDVVKEGQSLYFVETDKVNS
FT                   EIPAPVAGKIAVINIKAGQEIKVGDVVMEIDEGTGASVASEPKAEAKSEAKVEVVEENA
FT                   SVVGATPVSNDLIVRKQASTVAKSSTIKATPLARKVAADLNVDLSLVTPTGPNQRILVA
FT                   DIKNYHSSSAQPVSQPAPAPVVTPTIKVVEPSAPLSWDEVPMNGVRKATVKAMTKSHTE
FT                   IAAFTGMKNTDITETHKMRTELKDHAAASGIKLTYLAFIIKAVAKSLRDMPNINVRGDF
FT                   ANNKIQFMHNINIGIAVDTPNGLMVPVIKGVDHLSVFEIAIKINELANKAKDGKLTRAE
FT                   MTEATFTVSNFGSVELDYATPIINSPESAILGVGAMSQTPLYINGELQKRFIMPLSMTC
FT                   DHRIIDGADAGRFLIKVQDYLSKPVLLFM"
FT   gene            317721..319508
FT                   /gene="lpdA"
FT                   /locus_tag="MMS_A0301"
FT   CDS_pept        317721..319508
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="lpdA"
FT                   /locus_tag="MMS_A0301"
FT                   /product="dihydrolipoyl dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF00364; match to protein
FT                   family HMM PF01134; match to protein family HMM PF02852;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR01350"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69462"
FT                   /protein_id="ADK69462.1"
FT                   /translation="MFKVKFADIGEGLTEGTVAEVLVKVGDVVKEGQPLYFVETDKVNS
FT                   EIPSPVAGKIAIINISTGQEIKVGDVVIEIDDGTSVSTSEPKVEVVEENASVVGATPVS
FT                   NDVLPSRAPKPKPEAPKVDVQIEDTFDVCVVGAGIGGYVTAIKSAQLGLKTLIIEKEYY
FT                   GGVCLNVGCIPTKTLLKTSHVYHDIMHKAKELGIVLQNTEKVVIDWAQVLQRKNGVVKK
FT                   LTGGVKYLLDKNKVTQIKGEAVALDKNTISVNNKNYRVNNLIIASGSTPNHLPLPGFDQ
FT                   GRKDGIIIDSTGILSVPKIPETLVVIGGGVIGIEFSCLFASLGTKVTVLQGLPTVLEML
FT                   DKDIIDAMTKELKNRYNIEVITNASVKEFKNGSVVYEIDDKDQMIKGEYVLESVGRKTS
FT                   ITGFENIGLELTPRKAIVVNEYQETNLDGVYAIGDVVGKVMLAHTAVKGAIVAANRIAK
FT                   KANKDHAEDIVMDYYRIPSCIYTHPEVSMIGKTEQQLKQENIEYKTFKFPFSAIGKALA
FT                   DNDTSGFVKIIIEPKYKTILGAHIIGNRATEMISEIAAVIECEGTITEIANTIHPHPTM
FT                   SEAIGEAAEALETGKAIHF"
FT   gene            319530..320498
FT                   /gene="pta"
FT                   /locus_tag="MMS_A0302"
FT   CDS_pept        319530..320498
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pta"
FT                   /locus_tag="MMS_A0302"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /note="identified by match to protein family HMM PF01515;
FT                   match to protein family HMM TIGR00651"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69278"
FT                   /protein_id="ADK69278.1"
FT                   /translation="MYTLEEIKNQLVLKSEKKSIVFPEGESEIIQSVAKTLVDEKLGLP
FT                   ILLFKSSKEVPSEIKNNSSIKTICLDEFDTKEFSEEFVKLRKGKATIEVAHQVMQLPNY
FT                   VGAMLVKLNQADCMLSGLNNTTADTIRPALQIIGTKPGYNIASSIFIMSKGDENYIFTD
FT                   CALNIRPTSEQLVEITQMAVDFAKTLNVKNVEAALLSYSTKGSGKGEDVDRVHKAVEIL
FT                   KSSQNDYVCEGEIQFDAAFDKKTRDKKFKNCLLTKQTPDIFVFPDINAGNIGYKIAQRM
FT                   GGFEAIGPFVLGLNQPINDLSRGATFIDVLNTAIMTLHLSY"
FT   gene            320511..321692
FT                   /gene="ackA"
FT                   /locus_tag="MMS_A0303"
FT   CDS_pept        320511..321692
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ackA"
FT                   /locus_tag="MMS_A0303"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="identified by match to protein family HMM PF00871;
FT                   match to protein family HMM TIGR00016"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69765"
FT                   /protein_id="ADK69765.1"
FT                   /translation="MILVINSGSSSIKFKLFDTSKTIEPILDGLAERIGIDGFLKFEHN
FT                   NQKYKFEDPLPDHEHAIQLILNKLLELKIISNIDEINGVGFRVVHGGEISHSSIITDEI
FT                   LSKIQDSVKLAPLHNPAAIIAIKAVKKLMPNTSMVACFDTAFHQTMPEVNYLYTVPYKW
FT                   YEEFGVRKYGFHGISYEYIVNKSSEILNKKKENLNLIVCHLGNGASISCIKDGKSYDTS
FT                   MGLTPLAGLMMGTRSGDIDVSICEYIAKQTNTDIFSITQTLNKQSGLLGLSQVSADMRD
FT                   VLEQYDRNDKKAVVAVEKYVQIVADFIVKYANYLDNIDAVVFTAGIGENADVIRDLICK
FT                   KVKLLNLQIDQDKNQAKYSDYKLISSEKSKIPVYAIRTNEEKMICLDTLNLIK"
FT   gene            321762..323717
FT                   /locus_tag="MMS_A0304"
FT   CDS_pept        321762..323717
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0304"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF01732"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69165"
FT                   /protein_id="ADK69165.1"
FT                   /translation="MKKSLKYLSSLSLILVPLVTISCTHTNKIKPGFIPTINSSNKKNI
FT                   IDLSNKLEEFKSILENNPRIDKNLKDKIVKKLTEINTKSISLNNLANIKNILFGLKNFS
FT                   NNFNSDNLLSFLKKVKELLLELEINELVNEVDQHINKITNDKQNNQPIINADSNVEDKF
FT                   IEGSVYSPANHSYPEFANKFTPVPAEEIYKELYDRTFSIKFLTRLNNGDSLSNGTGTGW
FT                   LLDYHKYNNENKYKLFLATNLHVLSEFSNSLTEEQNKEFNYYEPSNNKVIAIGLGKAEN
FT                   VNDFSSKNNKKDFQNKISKYYLSNQDFKNYSQIDYSNSNSELTTAISEPKIVFGAVDFM
FT                   NRKAVEKYDDAIKQSAEEYYKYKKDKLNDNEKIAWEDYFKTKNIPIMVDFAVFEIDVDL
FT                   NKTDNTLKSWINDAIKGLDKYLERLKNTNNLPNQDKNISNYLQSKDYISALFTKDNNSN
FT                   NLYNAKNIYIAGYPVNNKTTYWMKNNPTERSSDKSDIDWRTSKSNREIFGFANEFQSSI
FT                   SIVPNFRIFDNYWHRVFATFYGYQYNVNFSSLYYGASGSLAYNEFGQMIGIYNNVRSNV
FT                   EFGDLLQHATIAPFLQSDNIKIGDNIIYAYNLIDGTDKTRYKYQKSSFRENLQKLYPNG
FT                   FSDNSKSTKLFDNIFN"
FT   gene            323727..324149
FT                   /gene="coaD"
FT                   /locus_tag="MMS_A0305"
FT   CDS_pept        323727..324149
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="coaD"
FT                   /locus_tag="MMS_A0305"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR01510"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69836"
FT                   /protein_id="ADK69836.1"
FT                   /translation="MKTAIYPGSFNPFHNGHLNILKKAILLFDKVYVVVSKNINKSLDP
FT                   DLQSRVKNIKNLIRDFNNVEIIINENKLTTTIAKELNASFIIRGLRSQTDFEYEIKYYD
FT                   GFKSLYPNIEVIYFISDYDKRSLSSTILREIEFYKK"
FT   gene            324243..325964
FT                   /gene="ptsP"
FT                   /locus_tag="MMS_A0306"
FT   CDS_pept        324243..325964
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ptsP"
FT                   /locus_tag="MMS_A0306"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="identified by match to protein family HMM PF00391;
FT                   match to protein family HMM PF02896; match to protein
FT                   family HMM PF05524; match to protein family HMM TIGR01417"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69099"
FT                   /protein_id="ADK69099.1"
FT                   /translation="MSKQIKGIAASEGISLARALVIKEIKLDVQKQLIDDVDQQIAKLE
FT                   QAINQTITDLKKIQKITLEKLGEEKAAIFDAHQDIANDPAIKEEVVQLIKTEKVNAEYA
FT                   LFIVSNNYFEMFSQLGDPYFKERSADIKDISSRIISHILGLEIHDLSTIDKEVIIISDD
FT                   LTPSQTAQLNKKFVKGFLTNVGGRTSHAAIMARSLEIPAILGLKNITELVKTDDLIALD
FT                   GSSGIVELDLNDNDIKNYQTKVKQYLELKDQLKKFKDKPSLTKDKIKKLIEANIGSTND
FT                   IQSVLDSGAEGIGLFRTEFLYMNNDHFPTEEEQFEAYKKVVSQINHLVVFRTLDIGGDK
FT                   KLSYFKFDEEMNPFLGYRAIRFTLDRKDIFKDQIRALLKASAFGKLGIMFPMIATIDEF
FT                   KQAKAFVEECKIELDKEGIKYDKQVQIGMMVEIPSAAILADQFAKYADFFSIGTNDLIQ
FT                   YSFASDRMNQNVSYLYQPLNPSLLRLIQLTISGAHKHNKWVGMCGEMAGDSKALPILLG
FT                   LDLDAFSMSATSVLKARSLMSKIESIKAKDLANKALEYQTSQQVNELVEEFLKNLD"
FT   gene            326044..326508
FT                   /gene="ptbA"
FT                   /locus_tag="MMS_A0307"
FT   CDS_pept        326044..326508
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ptbA"
FT                   /locus_tag="MMS_A0307"
FT                   /product="PTS system, glucose subfamily, IIA component"
FT                   /note="identified by match to protein family HMM PF00358;
FT                   match to protein family HMM TIGR00830"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69704"
FT                   /protein_id="ADK69704.1"
FT                   /translation="MWFFNKNLKVLAPCDGKIITLDEVEDDVFRERMLGDGLAIYPTSN
FT                   DFHAPVSGKLVTAFPTKHAFGIQTKNGVEILLHIGLDTVSLDGNGFESYVIQDQEVNAG
FT                   DKLVTVDLQEVSKKVPSIKSPIIFTNNGGKTLEIVKMGEVKKGDIVAILK"
FT   gene            326872..327498
FT                   /gene="dhaL"
FT                   /locus_tag="MMS_A0308"
FT   CDS_pept        326872..327498
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dhaL"
FT                   /locus_tag="MMS_A0308"
FT                   /product="dihydroxyacetone kinase, L subunit"
FT                   /EC_number="2.7.-.-"
FT                   /note="identified by match to protein family HMM PF02734;
FT                   match to protein family HMM TIGR02365"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70071"
FT                   /protein_id="ADK70071.1"
FT                   /translation="MSLKIEAVKQILLKIAEVIDNNKEELTKLDQIIGDGDHGHNLSRG
FT                   FLKVKEDLENNSYTDISSMFKKVGMVLVSNVGGASGPLYGTAFLKASMSLNDKTEMNID
FT                   DFSVCLNDAVSGIKLRGKANIGDKTMVDVLEPVSDLIKELINKNESAKEILNKAVQLAY
FT                   LKVEETKNIIAKKGRASYLGQRSVGHIDPGSYSSYLILKCISENI"
FT   gene            327506..327901
FT                   /locus_tag="MMS_A0309"
FT   CDS_pept        327506..327901
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0309"
FT                   /product="dihydroxyacetone kinase, phosphotransfer subunit"
FT                   /note="identified by match to protein family HMM PF03610;
FT                   match to protein family HMM TIGR02364"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69567"
FT                   /protein_id="ADK69567.1"
FT                   /translation="MVGIVVISHSNKIANGVVDLAKQMADEVKIIPAGGTKDNLIGTDI
FT                   DLIIDAINKAWDPNDGVILLFDLGSALMNAQMAIEMLEPDKQNKIKIIDAALVEGTILA
FT                   AINSSMNKNIDQIQQELINLKLNKIEE"
FT   gene            complement(327946..328572)
FT                   /gene="rpsD"
FT                   /locus_tag="MMS_A0310"
FT   CDS_pept        complement(327946..328572)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsD"
FT                   /locus_tag="MMS_A0310"
FT                   /product="ribosomal protein S4"
FT                   /note="identified by match to protein family HMM PF00163;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR01017"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69935"
FT                   /protein_id="ADK69935.1"
FT                   /translation="MSRFIGSTFKKSRRFGFSILETGKEFSKGKKRITTPGQHGKERAK
FT                   VKVSEYGQQLQEKQKVKFMYGLSERQFRNTFAKAKKMQGILGTNFLVLLESRLDNIVYR
FT                   LGFSATRQGARQLVNHGHILVNGKKVDIPSYLLSVGDLVEVKASMKKNEKVLEALQNNE
FT                   ATLEFVKVNKNEVKGEFVRLPERTELSSEISESLIVEWYNRLIKK"
FT   gene            328827..330614
FT                   /locus_tag="MMS_A0311"
FT   CDS_pept        328827..330614
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69193"
FT                   /protein_id="ADK69193.1"
FT                   /translation="MWFELMLIITKLSETKAINIVFLTIFLLAFFCSLFTIFKLYVYRN
FT                   TLKKLHFTFLNIEKTLKHPLANRLVRMQFIVTNSNNQNLSKALEIWKIKYNQIYNVELD
FT                   ILIKQTKEHFDLNSYSKKILFRVLSIKNFYRTRKLYKTSKVIYQKINLMYSETQQVTNI
FT                   EFLLRDYRIILQKHINDLFDIVFKEQENNQLNIDKKIINNYQESIFKKMIVCEYYIKIG
FT                   NFKEAFSKLNLLSNNVIEYIKFLDDHYKITKFLEFNGILDSKLQEIKNKVQLAIDQKNN
FT                   QLIKYKINLLEQQFIDQKQAVEKLLFQGKNNQAFLIIETLIKNIQNLDVILKYDQQILS
FT                   LVKTNVKNIRTILLSFNTELLKTEELINFNNNLNNDISDIKIQFDQLKTSFNNITTEFD
FT                   KEYQKISSNFIRFNSLIVDYLNYIRNVLIDIKKHYTQLIDIKTLLKNKSLVLRDLETKY
FT                   DNIKILLFLSQAIIKKYEKVIDWSVYKELINNKFLIINFIYKNLELEANTFTNDYDALL
FT                   VLNNQLDNQIEQVEQLHLNIEQVVVIYKIAQQIIIYIAKNLAYIPNNNAFEEILTKFKE
FT                   KNHKKVINLAIHLIRKNQL"
FT   gene            330622..331809
FT                   /gene="thiI"
FT                   /locus_tag="MMS_A0312"
FT   CDS_pept        330622..331809
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="thiI"
FT                   /locus_tag="MMS_A0312"
FT                   /product="thiamine biosynthesis/tRNA modification protein
FT                   ThiI"
FT                   /note="identified by match to protein family HMM PF02568;
FT                   match to protein family HMM PF02926; match to protein
FT                   family HMM PF06508; match to protein family HMM TIGR00342"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70060"
FT                   /protein_id="ADK70060.1"
FT                   /translation="MKYILIRYGELTLKGNNRFQFIDKLISNIKFKLKQFDKENIKFIK
FT                   DHNSLTLEIKDELETQIIEQLKTVFGIYSISIINYVNKDLEQIKKAVLQIAKNSKAKTF
FT                   KLEVSRKDKSFNYTSIELKQVLATEILKNTNHLSVDVHNPELVIEIVVKKDHVDVFDNR
FT                   IDGLKGLPVGISDKGLCLLSGGIDSPVSAFLTLKRGMQVDFIHFMTPPHTSYQALDKVF
FT                   NLAKKLAKYNLSNFKLHICDFNLLLQELQHLIDPSYKITIMRRMFLRIANIIAKNNNNK
FT                   AIITGESLGQVASQTIQSINVINNVSDLAILRPVITYDKEEIIKIAKFIDTYDTSILPF
FT                   DDVCSMFVPKDPIIKPKLDIANKLEENIYWNELLEETTKNNIKTFVYKNGKFVEE"
FT   gene            331942..333852
FT                   /locus_tag="MMS_A0313"
FT   CDS_pept        331942..333852
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0313"
FT                   /product="peptidase, S41 family"
FT                   /note="identified by match to protein family HMM PF03572"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69439"
FT                   /protein_id="ADK69439.1"
FT                   /translation="MKLVTKLSAISLGAFSIFAPIAVINNLTTENNLLISKRFLSSSNS
FT                   DFELKAYDYVNLIDNKYINTKINLHNHNGVAYIGVKEFLKALDGLISFSKIIVKPTHNS
FT                   TFFKEKEITYKFNKDKVTLNSVTKYSNNNKTTNYQLEIDSKNKTITVSDNDFFTDIFTF
FT                   YRRGEEDLNIDFLDTKILNKNKHIVFDLNKYGIEILNDQNDLYLPLVLINQLFLNQSNI
FT                   QLYFNGERINLFAYSKTLRRVDFLKQLKHSYLNNQNHIPVGLKDFQHKYLGFLFDHFYG
FT                   IKLDKNASYKDLFKKYEKYIKADNTTHYLTSRYLIGQLDDLHSSYLLTGYYNKDLETIN
FT                   KAVLKTTTPRSDRFKDIARRLSAYYGKLNYKNVYTPDRKTSVISFKNFEPNSAFKIEES
FT                   LKQAQRDGIKNIVLDVSFNSGGLLGTAYEIMGFLTDKPFKSYSYNPLTKEQKVETIKSR
FT                   FKKYDFNYYVLTSPFSFSAGNIFSQLVKDNNVAKVIGFKTAGGASAISQAILPTGDIIQ
FT                   LSSNYVLTNKSHQSLEYGVNPDITLGFDPFKQTEKFFDSAYIQQAINKDTNTLNSIPAT
FT                   HSSVIEPNYVHELVEKPQPLQLSRKTDQTERKDAYFVLGALGVVISLAIPFVIIKKLLK
FT                   K"
FT   gene            333969..334787
FT                   /locus_tag="MMS_A0314"
FT   CDS_pept        333969..334787
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0314"
FT                   /product="membrane family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70017"
FT                   /protein_id="ADK70017.1"
FT                   /translation="MKKALKVFSIYSLDPVYKLKQINKKIDNKKLSFKKILKIVSSLGL
FT                   VLFSTTFLVVLNFDKLNFSNNKNLEQQLESYKTELNNKISSLKISYNDQIDQIKEFKKN
FT                   HNLLKTISLKELEDKVSNLDDQNKKALKQIEHNDKLLKANQDKLNYLTNLKNQYSKQIT
FT                   TLEQNKNENLKQINQINLQTKSLETKIINLNQQIKQTNELLINKTNQNNQLKTQITTSS
FT                   NQIIDNNALIRNTNQLISDIQAEKNKLLEQLDQLVNKLNEAKNSTKQKSQ"
FT   gene            335665..336321
FT                   /locus_tag="MMS_A0315"
FT   CDS_pept        335665..336321
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0315"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69511"
FT                   /protein_id="ADK69511.1"
FT                   /translation="MKKLLYTLSTLVVGVFSTVSLVSCTKKNNNEPEQLSKLEQLKNEI
FT                   SSLETNVNQYDEQINKTELEKQQLLEEIQKIEQEIINLKTEENNKTKELSLLTNKKNSI
FT                   NQQIDNLNSQIISIDKTSKKEKEKINLLTEEIQKIKNNLTNATNQKNINLEQISNLENQ
FT                   VNQLKTKTSQLEKELLEKKLNKEQLLLNKKETESKVNKFKAALDNSNKQKEDLIN"
FT   gene            complement(336384..336773)
FT                   /locus_tag="MMS_A0316"
FT   CDS_pept        complement(336384..336773)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0316"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69583"
FT                   /protein_id="ADK69583.1"
FT                   /translation="MSWICFSIFLLFSNCCWYRSLISFVFCSVWFTFLLISFSWSWTFL
FT                   ASVFLEINRSCFSFICFSNSSFCLFNWFSWECVWFFNSSSFVNSSELFLLLFFNSLIFW
FT                   LFSLSFFSSFLISTDKWSNLFFNFK"
FT   gene            337495..337950
FT                   /locus_tag="MMS_A0317"
FT   CDS_pept        337495..337950
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="This ORF contains tandem Palindromic Amphipathic
FT                   Repeat Coding ELements."
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69134"
FT                   /protein_id="ADK69134.1"
FT                   /translation="MDLNNWNTSEIRNMKKAFYNSSFCCGDISNWDTSQVIDMTETFSK
FT                   IDQIIKIDLSTKRVTKTLFHDPPRNRLAYQIQWTAWDVSNVETMRNLFYKFTYSNSLQT
FT                   WNVLNIIYLYDFWPNYIQHKWFPKWKWPKNTKGRDPYFWENISPIIL"
FT   gene            338106..340247
FT                   /locus_tag="MMS_A0318"
FT   CDS_pept        338106..340247
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0318"
FT                   /product="regulatory protein PfoR"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69847"
FT                   /protein_id="ADK69847.1"
FT                   /translation="MNFIIVFSQSVSFGQQAVAFLKGTSLLMLVLVFFTIFSYYVPKGK
FT                   RAMSGLSGAVCATFLIEVFNFWVLGRIPVIGDFTKVIGSVAGTLAAPACTILVIILMGG
FT                   NPLFAILCGTAVFGVGLSVDVDGISKSIAKTLINTKTPDGQKLLAEDNAIRVIAEWVKG
FT                   NTLQNEMQKTFDTIKSNLVINEQKDILKTIFSTQYMPSFAMHLRTTVGAFNILAGLVAG
FT                   YTMYWALLLLQKYAPDGLDLIIALLIIAPLTALTAKFGANVVAPLLKGIGSSIEVAINL
FT                   SPIPMAIVVGGFLTVVGTSPLSSMALAVGLGLQGSAMAVGSVSAMGSSFMNGVLFARMK
FT                   YGEKKQTIACSVEPLSQADIISMNPVSVYITNFIGAAATGILVIVYGQNILNIEQTVFM
FT                   INSNSYEVVRGFTQQGVGLATPFGPVAMFGQGGGQTAEVLTKTSTQYATWQLNMHLAIL
FT                   LVLTAILNVVAGLLGGYMFRNSRRTTYFEIYNSPLPLKHQYLLEEIELFQTNKRRFAWQ
FT                   WKTIIFFSKVKQTIRVKTIIYIKTFIDCFNQFLTEKEKAIKTKKEELLHISTSKQEFKI
FT                   NFKKEKQQIITDLKNKWIDNYKLEIQKEKQQYKDLLLHFKNELEVLNQLVVKNKKMTQS
FT                   LTNDDKLGYQKLKSDFKKTQKQNHDLAKAALKGSVGKDRLTKLHNKKMQALQDKINFYK
FT                   EVSKFYPQKRFIIKTSLKS"
FT   gene            complement(340274..343180)
FT                   /locus_tag="MMS_A0319"
FT   CDS_pept        complement(340274..343180)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0319"
FT                   /product="E1-E2 ATPase"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00690; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69879"
FT                   /protein_id="ADK69879.1"
FT                   /translation="MDNLEQKTIREVQQELNTNIKTGLSNQTASELLIKNGKNELAKNK
FT                   QTPAILIFLKSLIQPIQIVLFIAAIISVIAPLISSKHFEVKFDDFIDFIVIMGVILLDA
FT                   TLETIQQIKARKSVDALKSLSKPSAVVLRDSVVKEIDASELVVGDIVILEAGKYVPADL
FT                   RLLESSDCMIEESILTGESVPVEKSSKPIKQTNILAEKKNICFMSTFVTSGRAIGVVIK
FT                   TGIDTEIGKISKTISDNEEQVTPLEKKMNKFSYLISILAIIISIFVFISFMISSNKSNW
FT                   ATYLMISITLAIGVIPESLSAIVSIALSFATKRMAKNNVIVKKLESIETLGSVNVICTD
FT                   KTGTLTQNKMAIKKLIWNNEIILADEFINKTKNEQAKDLFLKSLILPNDSITENDERIG
FT                   DPTELALVDFAEQMKIDEQEFRKKYPRIFEIPFDSERKLMTTVNVLENEQQFVFTKGAL
FT                   DQILKKCTKIFINNKVVKLTNTHKKEIKKLSTSLSDDTLRVLGFGVKQIITQDQKTEDD
FT                   LIFIGAVGMIDPIRKEALIAIQQAKAAGIKTIMITGDHAITALAIARDLDLAYTQYEVM
FT                   SSEKLEQYTDQELESAIDNIKIFARVNPEHKVRIVQALQKKGYIVSMTGDGVNDAPSLA
FT                   IADIGVAMGVSGTDVAKQAADVILTNDDLNTMMVGVLEGRNVYQKIRRAIVLLLGFNFA
FT                   NVISIVIISLLLKISPLTATNILFINLVVDSCLAFGIGMSPIDRTLLKNKSQLRNKSIL
FT                   NEIIWPLFKVGLSLSVAQIISFIIGMSATNLDYYNNLSSYTKAQNWFLFIQENNQILLS
FT                   NIEDMHDFVVFGRTNMFITSIISPILFTHLIKLTNWKDTKKIDWTISKPLIYSCIIALL
FT                   ISIIVFSIPVFNSKVFGLAGINDTKAYINWSSKNMWILFSSLACALIPFTFILITDAIE
FT                   FYSYHLSNRTWEKRQKLIKQIIDQEQKEKLREDKKNQG"
FT   gene            complement(343189..343779)
FT                   /gene="ysxC"
FT                   /locus_tag="MMS_A0320"
FT   CDS_pept        complement(343189..343779)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ysxC"
FT                   /locus_tag="MMS_A0320"
FT                   /product="ribosome biogenesis GTP-binding protein YsxC"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR03598"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69373"
FT                   /protein_id="ADK69373.1"
FT                   /translation="MIKQASFITSSANKSNWIDDDVSEICLIGRSNVGKSSFINSLTNN
FT                   NKLAKISNTPGKTRLLNFFEINKGEYRLVDAPGYGYAKVDDNLKIQFAKMMEEYFINRR
FT                   NLKGVFLLLDLRHKPSNDDIMMYQFLKHYNIPVVIIGTKLDKLKKSEYVKNEKMIKETI
FT                   SFYQEDDFVKISNLNKTNIIKCYELIDKLLGSK"
FT   gene            complement(343773..344333)
FT                   /locus_tag="MMS_A0321"
FT   CDS_pept        complement(343773..344333)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69882"
FT                   /protein_id="ADK69882.1"
FT                   /translation="MKVDYSASIVLSFTVFILTLILFLINFYWLSKVKKIYNQIKDQNL
FT                   EFNFNKNRYSNIKLINIFNCIFWLCILVIFTILKFKNLLNESFLYELIIMGSIICKFFI
FT                   FIILTYLISNLIFVKTEKYLVIVNRLIDLRSVFKIEISERFIKVIYINAFHTKSRLWFY
FT                   NTNNLDQWFETHFKELIRKDSQW"
FT   gene            complement(344335..344913)
FT                   /locus_tag="MMS_A0322"
FT   CDS_pept        complement(344335..344913)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69767"
FT                   /protein_id="ADK69767.1"
FT                   /translation="MSSKLIAIIIFIVIYLIFLLITFILTYFYQIKNKDFIEFNKKYLN
FT                   EWNKYKFDNKNSTLNQIDFKYQLPENEIGLFQKELLISGINQKIKDYKDYFDDDYLVLK
FT                   KSLSLYQTTSYDFKQVKLYLTNLHLVIDDNNQFYKYKISEIKSCSICVIRDKNLLQKGC
FT                   VLKTNDQNLTILGDVFLLVLSIKKLKKEF"
FT   gene            complement(344916..345605)
FT                   /locus_tag="MMS_A0323"
FT   CDS_pept        complement(344916..345605)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0323"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69448"
FT                   /protein_id="ADK69448.1"
FT                   /translation="MNKKEIFNTDFFESGLAYILTNLDFIQEELEQEKLQTSLVEKLIT
FT                   DFEDVEEYETWDLLTNNLIQSKNKILEEILKIKDSTKFNLLNSYFLAKNLAIYLKSNSF
FT                   LIEQINKLQMNSPDDLSEDKKEEFINNLKQEILKNNSELYKQNERLFKEIFDKKVEFKK
FT                   IYQLLIKETEFEDFNYANELLFNMLNNNFKFNNKQDLLKLEVLNNAQSLIDFLTFYESS
FT                   LFNNEEE"
FT   gene            345687..346379
FT                   /locus_tag="MMS_A0324"
FT   CDS_pept        345687..346379
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0324"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69657"
FT                   /protein_id="ADK69657.1"
FT                   /translation="MIEIYRLRELKSKDLNSYSHINPWWNKKINKLIFKLKKFISHFNL
FT                   NPNDYLDFNTIEQVSLDKFFRSTNNYLHFFNPKLSHILTNKKLLAKFQNQIRTYIRLVG
FT                   FNFAILAMIDFYNQLDDDQILNKKELVLMISNKTLKDKFQRFTIEVLKLIPNQYKSNLK
FT                   DLYNENINNQLFNSIEFVRWTNKYVTRLYKTKKIKELDYLKIVYYCILENEFNHSFNLL
FT                   IKEFINRL"
FT   gene            complement(346380..347102)
FT                   /locus_tag="MMS_A0325"
FT   CDS_pept        complement(346380..347102)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0325"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69334"
FT                   /protein_id="ADK69334.1"
FT                   /translation="MKKLVVITGASSGIGLACAKYFSNKGHPLLILARRKELLDDLNLP
FT                   NTLTARVDVRDFDQLDQAIKQAENIYGPVDLLINNAGIMILEKYQDQKLEDKYNMIDIN
FT                   IKGVINGMDAVLKSMLKQNHGTIVNISSVAARYTYTDHSVYCGSKYAINAITEQLRREL
FT                   SNTNIRFTLIEPAIVNTNLLNSTTNKQVKDDYQKSIDEINGGLKPEQIAQTIYYVYCLP
FT                   DDVMIPELMIAHTNESEV"
FT   gene            complement(347145..347618)
FT                   /locus_tag="MMS_A0326"
FT   CDS_pept        complement(347145..347618)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0326"
FT                   /product="putative transcription elongation factor GreA"
FT                   /note="identified by match to protein family HMM PF01272;
FT                   match to protein family HMM PF03449; match to protein
FT                   family HMM TIGR01462"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70109"
FT                   /protein_id="ADK70109.1"
FT                   /translation="MSKEIILTQEGLEELKAELKHLLKVVRPKVIEELVEARNQGDLSE
FT                   NADYDAARNRQAEVEARIKEVETLINRAKVIDDSKTHSTGEVKIGSTVQFVSSLDNKLK
FT                   EIKIVGAIEADPFSNLISNESPIAKAIIGKKVNTTVEIKDISKPYKITIKSIK"
FT   gene            complement(347741..349495)
FT                   /gene="uvrC"
FT                   /locus_tag="MMS_A0327"
FT   CDS_pept        complement(347741..349495)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="uvrC"
FT                   /locus_tag="MMS_A0327"
FT                   /product="excinuclease ABC, C subunit"
FT                   /EC_number="3.1.25.-"
FT                   /note="identified by match to protein family HMM PF01541;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM PF08459; match to protein family HMM TIGR00194"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69799"
FT                   /protein_id="ADK69799.1"
FT                   /translation="MSLKQQVDLLPNKPGCYLFFNKDNDVIYVGKAKNLKKRVSTYFNK
FT                   AYNIKTTRLVREITDLKYFIVDNEKESLLLEKNLIKKYHPKYNVLLNDDKTYPYIIITN
FT                   QKDPMYKYVRKYDKKALKNYGPLPIGSNARSILLTLQRLFPLRMCQGNLNKPCLYYHLN
FT                   QCSGACFKQVDPSYYEYQIKQVDKFFKGEINQVKQTLVKQMQKASDNLQFEQAQRIKDQ
FT                   ITSLDFITAKQNVDIVTNKNIDVVNYEINQDKICFVILFYRLGQLTYKDEYIQNYEGQN
FT                   LSELFNSYLQQIYQKNIYPDVLLIPNEIELLDLDQNLLEFSSYSLNKQDDVFIKLAKQN
FT                   AIDSLNKSVISHNVNSGDEIEILEQLKQISNASKYLKRIEVFDISNIYSQFITGACIVY
FT                   INAKPIRNEFRKYNIDPSYTSDFSRMKFMLEKRFLKQIKEKEQLPDLVIVDGGIIQIHA
FT                   AKEVLNKLNLKIDVIGLSKDDHHKTRYLIDIFEQTIDIKNFKKLYNFLTSLQIRVDEYA
FT                   KSGFRKKYHNQLNDQILLIKGVGKKTNLKLYKHFKTIDNIKNASFDELNKVINNKKITN
FT                   LIISNLNK"
FT   gene            complement(349505..350566)
FT                   /locus_tag="MMS_A0328"
FT   CDS_pept        complement(349505..350566)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69983"
FT                   /protein_id="ADK69983.1"
FT                   /translation="MKKIKKDQNFKSKMFLIYKTDFKKTKIIAILMLVLLIISMFRLTL
FT                   VGQFLDDLLFSFLFGWFKYLLYFWLFFINFCLFKKLLISVKWKQFLKTSFFIMILASFL
FT                   TLNFLIIQFVNNQTKTNNFNIYALWQNDILLQVIKFYDYHWYQNSIFLIDFKNWLNYFF
FT                   NTNTYFNLYLFGGFISYLVCGIIWYTTLPAAYLTLVILLIINLVWLKTNDPFYLFKNKK
FT                   NSVKTTTNLNNKIITNNQTNDEKLVIFENKLDDDLKQPVYKNEENILLTNLENVFLDTN
FT                   FIDKMLFLKLEQTNFNKDEIFENKNKTNITDQFKQNHKSGILTDSEISPFKRNKPVKKI
FT                   SDNDFFNELFDEK"
FT   gene            complement(350631..352211)
FT                   /locus_tag="MMS_A0329"
FT   CDS_pept        complement(350631..352211)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0329"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69771"
FT                   /protein_id="ADK69771.1"
FT                   /translation="MGFNYTVGVGFIGNLAIFSNIVDSKGNINVQSTGLHIFWIFGLLG
FT                   FIASICALAFAKLSTIHKSDNNGGTYLYARTAFGRFTGLMVAFIQYVMLPFIIASQIWE
FT                   LLKTFLLTNLSGLDWGFDKIPNLGNWSSLVLDVLGIIIYFAFALVIFGGMKWFKKMANY
FT                   SSAVKWATSFVLILAGIVIAFMNGTSNYQMWNNNYNESIHNLSFNAFSKAFVSCFFFFS
FT                   GFESFATAGKNIKDPEKNLAKGIMIIMLVSSIFYIVIMAIFFAAVNPKQGFSQNMTTRL
FT                   WNIHPISQIKWLSVLGVVIMFISQIALRANTSVQNALYGGTMLQPMAVEGFISEKYNKL
FT                   NKDNIPVKASLLNIYVILLVSFIWLIIPDIIYGFQKPGTKLIFNVAQLTEASSAIIISL
FT                   YIISVLALIKTAALKYIKLRIWEWISFSFALILLIVLFFYHYYALFDVIVKYANKNPSI
FT                   ELEDLIGAIVELLFVIISLTFAIIWYFTYYNKKLKQRLSTTQGRKLQRQLDAEFVLINT
FT                   QKPYIRTKK"
FT   gene            complement(352358..354109)
FT                   /locus_tag="MMS_A0330"
FT   CDS_pept        complement(352358..354109)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69059"
FT                   /protein_id="ADK69059.1"
FT                   /translation="MPDIKFTALGGQDERGKNLYVLEIDNDFFILDAGVKYPEKDILGI
FT                   DTVIPKFDYIKQNKKKIKGIFLTNPSAYNMGAVPYLLKEIKAPIYCNEITELIAKIKFQ
FT                   KLRLKNKDHILKVVHDKDVLKIGNTKVEIFRTTSSSPQSFGYVFHTELGSIVYAGDYII
FT                   DGKEQSYFSTDYTHLSQIAKNGVLALISDAEFASRKDFTVPNHKIDKYILVPFKEKKTK
FT                   IIVAIFEEDIHKLSQICMAAKENNRKIAVYGRTMDAVLRSNLIHEDLVIKPEDLMSIQE
FT                   YVNSDNGVLIISGTGDDLYSKLAKIATSNDSLVEFTEKDLIILTNTPVAGVEKRHAQIL
FT                   DELARTDARLLALSDKNIWSMRASYEDIKMLTSILNPKYFIPVKALYKDFLNAEKAAIE
FT                   AGVNNQNIGIIDNGEILKLSKNHLAISEHSAEHGNVYVDGSGIGDVGSIVLNERKQLAT
FT                   DGVIIVGATIDSRNKELISLIDTQMRGVLYIQEDNPIFKILQREITNLILEGQALYKKE
FT                   PKKYDLNEIKKDITSKIKQLIKQESGKTPIVLVIINESDGKAYVPRNNKKRYNNNNKST
FT                   KSKKDKS"
FT   gene            complement(354235..354954)
FT                   /locus_tag="MMS_A0331"
FT   CDS_pept        complement(354235..354954)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0331"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69878"
FT                   /protein_id="ADK69878.1"
FT                   /translation="MKPLVVITGASSGIGLACAKYFSNKGYPLLILARRKEILDNLNLP
FT                   NTITAKVDVRDFNQLNDAIKKAENIYGPVDLLINNAGIMPMDQYVDQSLEDKYNTLDVN
FT                   IKGVTNGMDAVLKSMLKQNHGTIVNISSVAGRYTYADHSIYNGSKFAVNAITEQVRREL
FT                   SDTNIRFSLIEPAIVDTNLLSTTKNQKILDSYIARKNSLNGGLKPEQLAEVIYYIYSLP
FT                   QDVVIPELMISHTNQKV"
FT   gene            complement(354966..355763)
FT                   /locus_tag="MMS_A0332"
FT   CDS_pept        complement(354966..355763)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0332"
FT                   /product="NAD(+)/NADH kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF01513"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69486"
FT                   /protein_id="ADK69486.1"
FT                   /translation="MKYSFITNKYEESSDIVDELLNILKNTDFKKDQNNPDICFVIGGD
FT                   GTFLYAVHKYQSILDKLIFIPIKFGGIGFYTNKNRVDDLKKIDLNKIIEQPNITELGLI
FT                   EVNYDDQKVYAINEIKITNQVRPLNLDIYINNEFLEQFKGTGLVFSTPSGSTGFMKSAN
FT                   GAIIYPVVSLFEMQELMPISTNKFRTLNAPIIFSDNEHINLKLEDLNNVTLSADTYEYQ
FT                   FKNKELLIKLSRKKIKLLNLNKDKFNKIKILRDIFVLNDKTKN"
FT   gene            complement(355874..358492)
FT                   /gene="valS"
FT                   /locus_tag="MMS_A0333"
FT   CDS_pept        complement(355874..358492)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="valS"
FT                   /locus_tag="MMS_A0333"
FT                   /product="valine--tRNA ligase"
FT                   /EC_number="6.1.1.9"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00422"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69594"
FT                   /protein_id="ADK69594.1"
FT                   /translation="MKKQLNPKYDHLQVEKDKYQYWLDKNLFKADINSNKPKFSIILPP
FT                   PNVTGKLHIGHAWDTSLQDAIIRFKKLTGYDTLFLPGMDHSGISTQVKVEAKLKQQGID
FT                   KNKLGREKFLLEAWKWKEEYANIIRKQWAKLGLSLDYSTEKFTLDEDINQIVKEIFVKF
FT                   YNDQIIYKDKQIVNWDPEQKTAISNVEVIYKETQSKMYYFKYILEDSNEYLTVATTRPE
FT                   TMFADQCLVVNPNDSRYQKYINKKVINPVNKQVIPIISDEYVDIEFGTGVMKCTPAHDL
FT                   NDYHLGIKHNLKMPICLNIDGSVNQLGGKYQGLDRFVARKKIIKNAIKEDLFVKEEDII
FT                   NQVGFSERSNAIVEPYLSDQWFVKMDKFKNMVIDLQNSDNKINFYPNRFSDVLNRWMTD
FT                   AHDWCISRQLWWGHQIPCWYHKKTNEMYVGINPPSDIENWTQDQDVLDTWFSSGLWAFS
FT                   TLLNNKGLESEYFKNYFPTSVLVTGYDIIFFWVARMIFQTLEYTKQIPFKDVLIHGLVR
FT                   DESNRKMSKSLGNGIDPMDVINNNGCDSLRLFLLTNSTPGQDIRYSNEKILASWNFINK
FT                   LWNASRYVFLNLDEDFKFDPNFYKTDLEITNQWILTQLSKTQTYVYEKMNKYEFSLAGN
FT                   HLWDFVWNKYCSWYIEFSKVNLNNDKFTHQTKQTLFYVLKEILIMLHPLIPFVSEEIYL
FT                   NMMLKESILLEQWTNLNSNYDTSFIDDVIKMITSIREFRNTKNIKNDVCLSVNISNTNQ
FT                   NHTKLFKKHFDQIYNFLFNFCNTKLVDEAIKNKTSLSIDEYFIEIANDSFINKNELIKE
FT                   LEQKQNYLNNEITRSQKILNNQEFIKKAKPEKIQSEKIKYQNYLDQLQAIKDKLKELTN
FT                   D"
FT   gene            complement(358579..359205)
FT                   /locus_tag="MMS_A0334"
FT   CDS_pept        complement(358579..359205)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0334"
FT                   /product="thiamine diphosphokinase"
FT                   /EC_number="2.7.6.2"
FT                   /note="identified by match to protein family HMM PF04263;
FT                   match to protein family HMM TIGR01378"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70089"
FT                   /protein_id="ADK70089.1"
FT                   /translation="MNYKTILIVTAKTNLNLEIFNNDSTYVIGVERGCLDLISRNMKID
FT                   YAIGDFDKVTDKELELIKSKIKNVEIWSPEKDYFDGELAILKGLKASKDAKIIFIANAT
FT                   KRYDKNYSIFHFIFKYDLTFINDDSILFRFDKGTNILKFEDYQDYTYVSFIAKDNTKIT
FT                   IKNLKYECENLSLSAYSNSCLSNAFLPYKDGIIWSNNPIICILTK"
FT   gene            complement(359195..359872)
FT                   /locus_tag="MMS_A0335"
FT   CDS_pept        complement(359195..359872)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0335"
FT                   /product="putative ribulose-phosphate 3-epimerase"
FT                   /note="identified by match to protein family HMM PF00834"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69725"
FT                   /protein_id="ADK69725.1"
FT                   /translation="MKKYIIAPSVLSANFMDLKNELELCKKNNINWIHYDVMDFDFVPN
FT                   LTFGSKILHDIKKNIDINVDVHFMVSVKTKQFEDFFSDYIKAKPEMMTMHIESLKDNNT
FT                   IIKFIDLCKKNNILASLAISPKTDVSLVYPYLDKLDNVLVMSVEPGFGGQKFISSSLEK
FT                   IQILDQLRKEKKYKYIIEVDGGINEQTSVLVKQAGVDMIVAGSYLFGSGDFTKRAKGLF
FT                   DEL"
FT   gene            complement(359874..360776)
FT                   /gene="rsgA"
FT                   /locus_tag="MMS_A0336"
FT   CDS_pept        complement(359874..360776)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rsgA"
FT                   /locus_tag="MMS_A0336"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF03193;
FT                   match to protein family HMM TIGR00157"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69131"
FT                   /protein_id="ADK69131.1"
FT                   /translation="MQGILIKKDSNESYVFYKNNIYKVYAKGNLKKELKPKVGDIVEFS
FT                   ILEDGNGYIKEVKPRKNSLDRPKIANVDQVLIVTALYEPLFSSFLLNKYIMMLETLKIK
FT                   PILIFTKVDLLKQTQYYQEVMHKINWYKKMHYQVLIINNKDDLENKKEIILKLKELLKN
FT                   KISVFTGQTGAGKSTTLNNFLDINSQIKTNEISKKLNRGKHTTTSIQLYNLENDIFIAD
FT                   TPGFSAFDLNNIDIEHILYSWETFIPFLNKCKFVDCTHTHETKCEVKKAVAEHLLPTFI
FT                   YNDYVKVYEELKQNRKNKY"
FT   gene            complement(360786..361901)
FT                   /locus_tag="MMS_A0337"
FT   CDS_pept        complement(360786..361901)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0337"
FT                   /product="kinase domain protein"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69521"
FT                   /protein_id="ADK69521.1"
FT                   /translation="MPKTKKDLRINKEELLNQVVNNRYKLIKYLNSGASAVVFKALDLD
FT                   ASVLEKKDVFIAVKIILKAKNKNIETIKKRLFLETNIFAKLSFSKNIVKMKDVFSWQNY
FT                   YVIVMELIEGVDLNKKFNAYNNVLSNKEFIYYFLEITKGLKEIHDNNIIHKDVKPANIL
FT                   ITNDSKVRISDFGISIIKSIILDDHHNHISPGTPRYTAPEQFINFESRKDALYFESDIY
FT                   STGVIMYEFLTGSMLYLNYGSNHTSSKEKELTNFQQHILKDITRPREINPNISQALENI
FT                   IMKCLAKDYKNRYHTFDQIIKDLEQAKQQPDVNIDFPNMWWEDENYLNIKNNNTLKYKY
FT                   FFKNTNFKYFLFWISIVISLFIIFLIVLILK"
FT   gene            complement(361901..362230)
FT                   /locus_tag="MMS_A0338"
FT   CDS_pept        complement(361901..362230)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70015"
FT                   /protein_id="ADK70015.1"
FT                   /translation="MNSNYDIQKIRQQAESYYGTKFNENTYWKSLTSALGPAKKLKIDS
FT                   YFLKNSNGLFCLTTDGIHDFIDSKTFKDYLDLKSSLKTKAKNIIKYSINNLSTDNLSII
FT                   LLEVL"
FT   gene            complement(362220..362645)
FT                   /locus_tag="MMS_A0339"
FT   CDS_pept        complement(362220..362645)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69234"
FT                   /protein_id="ADK69234.1"
FT                   /translation="MKIKAVGLSEKGNFRKENQDFLNYYKNSNGSFLAIICDGMGGHKH
FT                   GEIASRLAVNTLVDLFKKTTFDKKESKEIFSWLEKSVSYIINVMKKYVEDFIEAKDMGT
FT                   TLSAILIANNNAHIITNLSFKRSKFKSNYNWSKFNEF"
FT   gene            complement(362859..363044)
FT                   /locus_tag="MMS_A0340"
FT   CDS_pept        complement(362859..363044)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0340"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69990"
FT                   /protein_id="ADK69990.1"
FT                   /translation="MFLTAFDTEVKDNILIIKPKKEYEYKFYNQKQILLKFKDENINTI
FT                   NSDTNNQNKLTNSNIN"
FT   gene            complement(363318..364082)
FT                   /locus_tag="MMS_A0341"
FT   CDS_pept        complement(363318..364082)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0341"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69050"
FT                   /protein_id="ADK69050.1"
FT                   /translation="MFLILLSSMNLTNIKEPNLIKTNIIQNYRSEFNLSEKVNISRTIK
FT                   ASNTPSKNNDNNFYILKSSANFYNQTVETILKGFNFKLSDEYISFIKDGFKLEISLTVN
FT                   LEFINTKDQYFNNKYDLVFYLSNNSFTNQSSKDIIWKNVRYQTSDKMITDYIDTKNHWQ
FT                   FSFNKELYLFNLKHVFNKKYNFRFTDFNNLYSFNSLKYNIDTIKYRFYTQLSLYSQIKD
FT                   FNFNINKDNISVNDIKKQIYIQQTNLKNSEIL"
FT   gene            364202..364618
FT                   /locus_tag="MMS_A0342"
FT   CDS_pept        364202..364618
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0342"
FT                   /product="ATPase, YjeE family"
FT                   /note="identified by match to protein family HMM PF02367;
FT                   match to protein family HMM TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69667"
FT                   /protein_id="ADK69667.1"
FT                   /translation="MKVKVNNLEQTYKIAKKIKKIIQNQKIPFYILLKGDLGAGKTTFT
FT                   KALLEQFNIKDNIISPSFVIMNQYFIDDLKINHMDAYRLNNDSEIEMYLDEFLDGLNII
FT                   EWYENLDLDLNAINKLIIEIKIIDENQRLFFIGE"
FT   gene            364620..365183
FT                   /gene="yeaZ"
FT                   /locus_tag="MMS_A0343"
FT   CDS_pept        364620..365183
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="yeaZ"
FT                   /locus_tag="MMS_A0343"
FT                   /product="universal bacterial protein YeaZ"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR03725"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70014"
FT                   /protein_id="ADK70014.1"
FT                   /translation="MNLFIDTTNWKLIYLLEKDNQIIDSLIILNNKKLSDIAILKLEEF
FT                   LKNNNLTLNDLKAFYLTIGPGSYTGVRVGLTIVKTLKVLNNNFDVFIINSLLYQAGSNK
FT                   IISCIDARSNKYYVSVYNNAKQLLDISLIDQDQINNLINQYQDYKLVNDYQFDYLKHYL
FT                   DLKKHFIKIDDDNKLNPLYIKSFI"
FT   gene            365261..365509
FT                   /locus_tag="MMS_A0345"
FT   CDS_pept        365261..365509
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69485"
FT                   /protein_id="ADK69485.1"
FT                   /translation="MLLVEIHIAMKNENKTIIKQANKDHHCTDIGIEILLITSSLFNNI
FT                   IGRKILLIVKIITNILKIFVIPKTYQIVCLYDPYFLT"
FT   gene            complement(365460..367301)
FT                   /locus_tag="MMS_A0344"
FT   CDS_pept        complement(365460..367301)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0344"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69535"
FT                   /protein_id="ADK69535.1"
FT                   /translation="MFSPYSNNLKTNYQILGLDKTQNSFKIDDQLKNKVFLSNSDIQNI
FT                   YQIINSPYQKQGDDLISSSTNQILYSRKTNTSNVPTILNQTLNNHFLNNQNILDNISSY
FT                   NSQLMYKTKSNDFKILPKQAWLYDDTDYLNTKYVTKHAKWMDQPIQSINDQNNYSSYGY
FT                   KIVENNNKKHYYLNPYNLDVNKFTQRQVIDLWSDKNENNKDLSIEKQIDNIVENSPIFG
FT                   DFVINKNGEIIKSFLRPYYQLRNLKLFIPISDEISWEDFAKYALGWGNNQEPNDDWKAN
FT                   LEKQDEHTREYIQPALKKLKIDQVPLSVKNAWDSVLTNKNITDYIEVRPYDFSIEQERR
FT                   IDRRHIYFQFTPGYINIKGVLKSAPTTSLDNLILNGSALFYRRTLGKRKNIAPILKLEN
FT                   NKVNYVNKDLKIKLTNIGVSDIYGKSYAIIDSDLANMIYGYDISRSINYDYKPFDTSKI
FT                   IKRNQLFNTYNTTNWQKQNIIDPWKNTYLKSKNVYDYSPHYYYNTIFSNSNEPLTITSS
FT                   ISIIPEKRLGLAIIDLLNLSDYKTAISNVNFINQTKQLIDQLTKTSIYIAIIIITAISL
FT                   SASLLIMLITNIYISQYKSFMIMLRSMGHTNKQFDMF"
FT   gene            complement(367355..367477)
FT                   /locus_tag="MMS_A0346"
FT   CDS_pept        complement(367355..367477)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0346"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70091"
FT                   /protein_id="ADK70091.1"
FT                   /translation="MFDNKVQKNTDWKDKILNLVLGYAPTFIKSYLTNDSKKLN"
FT   gene            complement(367915..370029)
FT                   /locus_tag="MMS_A0347"
FT   CDS_pept        complement(367915..370029)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0347"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69100"
FT                   /protein_id="ADK69100.1"
FT                   /translation="MIDLLNKNDQSISNTVISKYTKTNPNWFKHFLKDDKPFTWLEFLN
FT                   NKELINKLKKERPEELKIYYYSYYAFESFSQYLFKTIRTFIRHDQWKDQTENIAKIIYE
FT                   FLFGIEFDHNLKHDFQKEYITTNTNKYTTHFNKTVLKTEFEKMNFLNTNKEDTFFYDII
FT                   KKGFKGILRPLIVYYLEDDNYIDIQKVSQYSETNELRGFLSSSNVYTQNVDKLPDIFKN
FT                   NELVDLLVLNTNPFLNITNKASGFFISNDDIKRSTNKDFMISAAFLTHHKLVAIANGYD
FT                   LYIRPETIFNDPITKKTFRIINISDQNHTNYLVLNGNKPINASQITVSRQFAKANKIKI
FT                   GSSLNLGQAVGLVVSGYAVDTYSFFPTSDPNVPLPKSDSGGLIYASDKTIDQIIGDQTD
FT                   PSNNDQTTIYNFFLIKKQSDANLNNLYLDHFSKSTKIRENINAYNNKNKANTFYKTYDF
FT                   DKSWYSLNWTLYQKITFYYSLATFLTAGLIALIAALAVFVGVIKSIQANAKQIGILKAN
FT                   GVYSKTIASSYIWYALILILISIPIGWMFGTVLQVPFVGIFKDYFSLKVEVIEFDWISV
FT                   LISVAIFGFLIGLFSFIVALFNIHKPVLQVINHTKKWSKPRLTDWFKKYLFKKIKFNNL
FT                   LMLKLTESGKKPFSLLLILTFIATLFISIGIAVPSIAIHTKNNYFKNINLITSIKFLTT
FT                   LLILHLEKIL"
FT   gene            370737..373877
FT                   /locus_tag="MMS_A0348"
FT   CDS_pept        370737..373877
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69687"
FT                   /protein_id="ADK69687.1"
FT                   /translation="MKKSIKKAKPWLISLIVMFAFISGFLFFIRSYVDSSKQNYLNKIQ
FT                   SYIDASSYLTKSKILKSVEDLNEDYVNKKLSEQYLEQEFGKDFIWKPDKIDANLKNKVS
FT                   DIYRTYFGKSIDVIEKDLKLQYRDNNKNLVDITDLKNGEFIPKNIDKITALTRSSEDFL
FT                   NGFSPSLASLGLSFFQSQALENEDDLNKIKNNNILKSVVDFINNNQSLIKLLSKIFSTK
FT                   NVDKSFYKDLTIKQVFNKNINLITSSFTKKTYSDNNNDYFADDISDLVISDVKNIVLQE
FT                   WNKDKKNIEILDKFKTIFNKVKDYFLKFDYLKILDNLFRYVQSELYFSMYYVINEQYSN
FT                   PSQLLNQKIEDKRFDPLINNKLDFSLLINGFSKVLEDKKYTTRLLDFLFKRTDKTKIYF
FT                   DHKTIPQNIGTSSLILDVINLIQKTILKTNQLIKEAIEGVENYIKENMYELREKIRNTI
FT                   LSVLKNKVNSFSHSVHFGYIHTNEDYNKLTVQIYTNLWLTKFYYVDANIYIFGKNGLVT
FT                   KIFDLFKQIGNSISTTSSDAFNFLKSVLYRDLDSNIGFKDNFEEISKLINIGHNLFSDQ
FT                   KMLKIDLSLGSLKQIASIKDLYGILNLPNELDTLKNLLNTFGLSSFISKVEKGVEPLQK
FT                   ILDLLKDFGFISDTKKFIQQFDTYIKKIIKYIPDKYQSVNMQLNYDLISNLYPNTKTNT
FT                   NFISDFTTRLAEFLFPKNNKNEDDELLLPIIRLIRNDKDKKITSVEQIKKDLTNYSEKI
FT                   LSKDSLFKNIIDIRDLKIQLPDNLLKHLKIENIKDLTVLELLQITSKYVNQFLKNNPDK
FT                   SLTFDLSSIGFILKALSASVNITYIDNKKITNKNLFKALYDDLDSFNHKNDENNKGRKE
FT                   ESFYNWSSIVLNLGDGIKRTIDLKQIKNDFSYSPLHLLLGIDLNKVQYIKNTIGYALAT
FT                   LIGGINITDPNYELANQNRKSVITIFAILNFVLQNQESILKNLEYQKAGIYYKKDSWTT
FT                   KLINSNDKEIKYYLIRNLTSESEINKRVGNCFEVTLTNDNNSSYWKISNIVALDYKN"
FT   gene            373892..374161
FT                   /locus_tag="MMS_A0349"
FT   CDS_pept        373892..374161
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0349"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69848"
FT                   /protein_id="ADK69848.1"
FT                   /translation="MKKLLTILGSIILITTTSFSVIACKNIKQLEFKNKETEEDKKESK
FT                   ESRDDKQKEKANESKNDSKPNEHPQGDQPHNAQPSDYLEKIMKN"
FT   gene            374176..374538
FT                   /locus_tag="MMS_A0350"
FT   CDS_pept        374176..374538
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69082"
FT                   /protein_id="ADK69082.1"
FT                   /translation="MNFDLIKKYGKEFFELFSSLPKDKAKKISENPKNTNGLTVAGKIL
FT                   NVYKKLKSYSNFDNFQYKLKEELNKSGSKFSDSISTLEKDWTKIVKDYEKEKENILKIL
FT                   KETGSPGLLNKKTSIK"
FT   gene            374656..376329
FT                   /locus_tag="MMS_A0351"
FT   CDS_pept        374656..376329
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0351"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69319"
FT                   /protein_id="ADK69319.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRSDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNDRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            complement(376710..376838)
FT                   /locus_tag="MMS_A0352"
FT   CDS_pept        complement(376710..376838)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0352"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69644"
FT                   /protein_id="ADK69644.1"
FT                   /translation="MNQVYLIGRLISDDFYIKEYEKPNQQLGQVLKFKIATLRNSK"
FT   gene            complement(377564..378433)
FT                   /locus_tag="MMS_A0353"
FT   CDS_pept        complement(377564..378433)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0353"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69604"
FT                   /protein_id="ADK69604.1"
FT                   /translation="MKNKKYILVLIIFTVFLISFLMILLPYLKIKQTTQISNNQILLKQ
FT                   DKSESKWDTFTKFEYIDYILNAIYPNKNDTDAKKKYIEEQKELDKNNYFNTAKEALFYA
FT                   NNIFSNHFRDAASDPQKKPYAWKYHKQEVIKDLFSKNWLWTLFNIDRFIYVMYNENDQI
FT                   QNNITGDQTQKNSLEFGAFRKLKSNKFSQYRIQEDSNNEIVVHLLSSNNIIFKVNINKG
FT                   TKTVDVYNYIYIYPKLAKNTTESKSFDFDKYIEASIITYKDNLKSDKAKFDELYGGKPL
FT                   SLTVVDIE"
FT   gene            complement(378423..379283)
FT                   /locus_tag="MMS_A0354"
FT   CDS_pept        complement(378423..379283)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69540"
FT                   /protein_id="ADK69540.1"
FT                   /translation="MDKKKKIIIGFSLFLAAIQIIILPVALFYSIKGNPNELLLKIPTG
FT                   FEVSGVDYNSKAEKTKSIINNIKNLVFGNNKNEELIFVESQKKEKELLEEVKKLSDKYL
FT                   HDMSFDNYSNLKEFFNKNWLFTISNIEKFNLNFHKYWYFEKDKKTEAEHTRNFLDKVQN
FT                   KKPSKTNFSIENKYFDNFQIGEESNHSDNNFLYIRQSKIIFRIIVSKLRQEKQKYEVKF
FT                   DKIIFFPDSNTERISVQTISDTIHVALYHHNEEGYKKFERDIVGEYGLAWDSILTLKEE
FT                   KKNEK"
FT   gene            complement(379276..380403)
FT                   /locus_tag="MMS_A0355"
FT   CDS_pept        complement(379276..380403)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69925"
FT                   /protein_id="ADK69925.1"
FT                   /translation="MKKLLITSLSLFMLAIPVTSCVVKNNNINQIKQEDSEFKLYTNKS
FT                   IKKMLEVYTKKDKSYDLYIDQQENKPYSKYDELRFALTFYPIFSPLSVDKNSQYEAINL
FT                   TAKSVIENTLSNDWYWVINNINKFQYTFNPYGDRYKKNDDDKKEINGIIYNDEFLFNKT
FT                   KELFKSSVQKIENKVPIELIRFDIKDITDKDLKELKDQTSDLDYTNITFKEKSVYEKKQ
FT                   AWYLVFDNYKVLKIWKYEFKNKVYFKILPDLLILKNSSTKEQLKQQLKDLETTIHKKRI
FT                   DELNRKIKNEEINFDPEDEDYDDIKSDSKFSIQKYLDKKYKDNDELFMKFQETHQYNDI
FT                   LMQSINEINKKALQRKENTKHELDIFRFSMRYIYG"
FT   gene            complement(380381..381085)
FT                   /locus_tag="MMS_A0356"
FT   CDS_pept        complement(380381..381085)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0356"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69434"
FT                   /protein_id="ADK69434.1"
FT                   /translation="MKKILEIRNLTKIYSKTNRGVFNISMNLFDGDFHAFIGENGAGKT
FT                   TTIKTIIGAHTEYKGHILINNINIKKAEAKSFVGYVPEIALFPKELTSFEYLYNLAILS
FT                   NISKKEAKQKIYDFLKMFNILNLMNEKPYNFSSGQKKKILLIQALLHDPKVLILDEPAA
FT                   NLDPTARFELFNFLQKINKEKNITILISSHILSEIDKYVNSVTLIHHGNILYSGIKNKN
FT                   LEELFYEKVINN"
FT   gene            complement(381088..382920)
FT                   /locus_tag="MMS_A0357"
FT   CDS_pept        complement(381088..382920)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0357"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69406"
FT                   /protein_id="ADK69406.1"
FT                   /translation="MSNTLLRYAFFAFNITFKKKSSIFMPGVITVISFIIGLVFKFVVS
FT                   DKYLELSGFLYTIALILTTVVFSSIKSLNIFKDLENEGIEIITLSKPISRKNIVLGKLA
FT                   SLTFFGLLWSFVLFICGLISLYAIHSFKDLILYSLLLMFVSLVTYLMVGLLVALLSNKL
FT                   NQKISMTIPLVLFVPLILTGSIISANVSSNVNIASSYINRKFPYHHSGNELNVEPFYLN
FT                   NNKDELLLISNGPEYKGFGDEQEEYLTSVVKYSNNSSSSWQIYSLISVPYQLVNIFNIR
FT                   NKNIFSPINNNASNLSDYVYYNNLDDISYKYKLEKKAKQKKYLVIDENKEKQKYIVPGL
FT                   LKANSVIKTDSVNRNIIYAREGADTDKTDFPEDEQQFSNDNSLAGRIKWEFVHQALKDK
FT                   KFNEIAKKFVNNSINKNLKNDLIENHHKIIESISKYVNNKQSDINKYNNHNVTIFNPRA
FT                   IKEQILQTEIERKIYLVVSLLNYIYFNYQDTVLFDSLIKNPENKGFSNFQVNIKINEFN
FT                   YKIGGYEKYEPTIFVKDKNSINSATSKKEYNVKKRFKLRKSKDNFLFQSNDELFSIVRS
FT                   KRVVNNNILVFVWILIIIGLFGIVFKIYLRKEYK"
FT   gene            383275..383664
FT                   /locus_tag="MMS_A0358"
FT   CDS_pept        383275..383664
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0358"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69217"
FT                   /protein_id="ADK69217.1"
FT                   /translation="MRIAIFGTTGAGKTTLLKNLKKLLNESYVYVAETSLECPYYEQAY
FT                   NDNSPNLQDLNYKLDLWMLADRMRSFKDYANNDYVIYDRSVLDSMVFAQTDHSYGRLND
FT                   VDYEVFKDYFMTCVLPNLFDKDSHN"
FT   gene            384105..384305
FT                   /locus_tag="MMS_A0359"
FT   CDS_pept        384105..384305
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0359"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69831"
FT                   /protein_id="ADK69831.1"
FT                   /translation="MFDFLAWLTIPATIVTFILSILCLVPSLRNNKGLVITTGIFALFW
FT                   AALIPGILLIVGRAKINKNSL"
FT   gene            384470..384559
FT                   /locus_tag="MMS_A0360"
FT   tRNA            384470..384559
FT                   /locus_tag="MMS_A0360"
FT                   /product="tRNA-Ser"
FT   gene            384679..385359
FT                   /locus_tag="MMS_A0361"
FT   CDS_pept        384679..385359
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69132"
FT                   /protein_id="ADK69132.1"
FT                   /translation="MNKKVDKNIKNQSKNTKGFWSKLMFWKSKNDLTQQNYFENILYPF
FT                   FITKENEKKNVLDFINKQDIQYFLFYTNSKNWLNILQYGICPVKEIKLKADEEYVVWSF
FT                   QQKDYSIGLAFDISSRAQFWKWLKDTDIKTDQFLTIAINSNTLYRVTKKDWVWDKSLSM
FT                   VFINEAIQIECIEWILFRDYDLYKKAEEYLRKTLLNDSIRIYYKNNDQFEQIESNNDNE
FT                   KATR"
FT   gene            385340..386764
FT                   /gene="proS"
FT                   /locus_tag="MMS_A0362"
FT   CDS_pept        385340..386764
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="proS"
FT                   /locus_tag="MMS_A0362"
FT                   /product="proline--tRNA ligase"
FT                   /EC_number="6.1.1.15"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF09180; match to protein family HMM TIGR00408"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69138"
FT                   /protein_id="ADK69138.1"
FT                   /translation="MKKQLDKITPRNIDFSQWYTDIVLNTKLASYGPVKGTMIFRPYGY
FT                   RIWELIQKYLDEEFKKVNVDNVYFPLLIPESLFNKEKDHIEGFSPEIATVTRVGQKKLE
FT                   ENLFIRPTSEVVMMDYFSNEINSYRDLPLIYNQWCNVMRWEKTTRPFLRTSEFLWQEGH
FT                   TVHSSYNEAENFCLKILNIYEKFAKEILLLPVICGKKTEKEKFAGAKDTYTIESLMFDG
FT                   QALQCGTSHFFADNFTKVYDIKFQNKENKLEHAYSTSWGVSTRLIGALIMTHSDDNGLV
FT                   LPSKISPIQIQIIQIKNTEQIDQVVENIKDKLSDYRIDVDNSDKSFGFKISEAEIKGIP
FT                   IRIEIGPRDLENNQITISRRDQQENKIKIDYKDVKKVVDQMIKDYDLSLYNSALENRKN
FT                   RTFKANTIEEYIEILKQNQGFVLVPFCGRVECEQDIKTKTATNSRCIPFDQKEVKAKCF
FT                   NCKKDTCLQVIFARAY"
FT   gene            386777..387394
FT                   /gene="rnhA"
FT                   /locus_tag="MMS_A0363"
FT   CDS_pept        386777..387394
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rnhA"
FT                   /locus_tag="MMS_A0363"
FT                   /product="ribonuclease HI"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF00075"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70036"
FT                   /protein_id="ADK70036.1"
FT                   /translation="MSKKYYAIKKGLKPGIYTTWNEAKKQVENYSNAIYKSFSTLKEAE
FT                   DFLNDNNKQSNNLNSDKNSCIAYTDGSYNTLDNTFSYGVVIFWKNREFHLSQRFDNQNI
FT                   SSLRNVAGEVLAVKQTIMFCVANKIKKVLICHDYQGVSKWALDQWKTNLDFTKEYKEFF
FT                   NKNKDQVEVEFKWIKSHTNNKYNDLADKLAKNASLEFVLKEV"
FT   gene            387699..388283
FT                   /locus_tag="MMS_A0364"
FT   CDS_pept        387699..388283
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69561"
FT                   /protein_id="ADK69561.1"
FT                   /translation="MFSHSITCVFSKAYAIKYSETINGLILSNFIKLNKTVIFKEIIRL
FT                   TFIKLFFKNKKPYSLYQDTYTQTFLQEFNKNNEFLSDNLNRYLDLLEDDFISKKFEIIS
FT                   LLDIYKTMYFNLKTKRFSFIRKNLPILLIVNDNNFDEEKYYLKSSYKLLKQFLKKDYFI
FT                   QLNYVNDLKNKMFSNATQLENQIVTFINKHH"
FT   gene            388307..390109
FT                   /gene="lepA"
FT                   /locus_tag="MMS_A0365"
FT   CDS_pept        388307..390109
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="lepA"
FT                   /locus_tag="MMS_A0365"
FT                   /product="GTP-binding protein LepA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF06421;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR01393"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69515"
FT                   /protein_id="ADK69515.1"
FT                   /translation="MDKSKIRNFSIIAHIDHGKSTLADRILELTNTVEKREMQDQLLDS
FT                   MDIERERGITIKLNSVQLKYHSKDNQDYIFNLIDTPGHVDFTYEVSRSLAACEGAILVV
FT                   DASQGVEAQTLANVYLAIDSNLEIIPVINKIDLPSADVDKVKHEIEEIIGLDCSKSPLI
FT                   SAKTGLNVEDVLQAIVEKIPSPSDAIDNAPLKALIFDSYYDKYLGVVMSIRLKQGMLKV
FT                   GDKIKLMSTNAEYEVTSLGIKTPKIVKKDFLEAGEVGWVAASIKTIKDVNVGDTITSVL
FT                   NPADEPLDGYKKLKPMVYCGIYPIDTNKYQDFKEALEKIELSDSSLVYEPETSQALGFG
FT                   FRCGFLGLLHMEVIQERLEREYNLELIATAPSVVYKVHLTNKQVIELDNPALLPEAQKI
FT                   SKIEEPFVEIKIATPSEYIGDLMNLCQNKLGIYKNMEVIDNNRRILIYQMPLAEIIFDF
FT                   FNKLKSISKGYASFEYELIGYKESKLVRMDIKLNGEMVDAFSMIVNQKFAYQRGSALTL
FT                   KLKELIPRQNFEVPVQATIGNKVISRETIKAYRKDVTWKLHAADKSRRKKLLEKQKEGK
FT                   KKMKEIGTVEVPQEAFVAILKIDD"
FT   gene            390136..390993
FT                   /locus_tag="MMS_A0366"
FT   CDS_pept        390136..390993
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0366"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69869"
FT                   /protein_id="ADK69869.1"
FT                   /translation="MFKYHGNFLKILVDELYLISQQSGKKISEFSKKAVEQWLKKPNIS
FT                   TFRKWINQIESKTTPKFVVADLKKIIQSDFYEIIVIRLQKLLSLFNDFSFWYKTFDKKN
FT                   PNFCDEYGVDLNIRETFLYLTRTYLTNSLKTLIDLNPSTKLEYMRYDLVELIKIALESD
FT                   TNEIFIEYLYEIDEVLSECIDEIDDDDFWYIKNQLDLANEFIKFIIIFQTYLYYAILIF
FT                   ELLEFDQLLNIGIFDFANKVYVAKRMQQIDWDKNFWWLYDGKKSRVLDPTFTFYLTIFL
FT                   RFPV"
FT   gene            complement(391063..392736)
FT                   /locus_tag="MMS_A0367"
FT   CDS_pept        complement(391063..392736)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0367"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69370"
FT                   /protein_id="ADK69370.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNDRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            complement(392848..394572)
FT                   /gene="aspS"
FT                   /locus_tag="MMS_A0368"
FT   CDS_pept        complement(392848..394572)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="aspS"
FT                   /locus_tag="MMS_A0368"
FT                   /product="aspartate--tRNA ligase"
FT                   /EC_number="6.1.1.12"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF00587; match to protein
FT                   family HMM PF01336; match to protein family HMM PF02938;
FT                   match to protein family HMM TIGR00459"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69180"
FT                   /protein_id="ADK69180.1"
FT                   /translation="MKRTHTCGELTINNIDQEVILQGWVKKIRKLGAMVFIDLKDRYGI
FT                   TQLVVDQQHIDLINNVKNEYVIEIKGNVVKRKSINKELVTGDIEVIVKELFIINKSELT
FT                   PFVLENDVNVNEDTRLTYRYLDLRRPVMQNNLIIRAKINHIIRNFLTDSNFLEVETPYF
FT                   AKSTPEGARDFLVPSRLNKNKFYALPQSPQLFKQLLMISGIDRYYQIVRCFRDEDLRID
FT                   RQPEFTQLDLEMSFATSEDVMQISESLIKKILKEVKNFEIKEPLLRLSYKDAIDLYGSD
FT                   KPDLRYDLKIHTLNDIFKNTNIKFLNNPDLFIRAICIDQLLSKKQLEDLNQQAKQFHFN
FT                   SIAFIKFENNNWSGSLASQLTENEKELLIKEFDIKNKATIVLNIGKYEQISQLMGAIRI
FT                   SLAKMFNLETKDDFKLLWVVDFPLFEFSEQENRYVAAHHPFTSPKEECLTDFDTNKKDA
FT                   LTCAYDLVMNGFEIGGGSQRITNPEIQQRMFDAVELTTQQVETNFGWFMNAYKYGAPYH
FT                   AGIAWGLDRISMIVTDSNSIRDVIAFPKNSLGIDMMSNAPDLVSEKQLEELNIKIVK"
FT   gene            complement(394581..395825)
FT                   /gene="hisS"
FT                   /locus_tag="MMS_A0369"
FT   CDS_pept        complement(394581..395825)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="hisS"
FT                   /locus_tag="MMS_A0369"
FT                   /product="histidine--tRNA ligase"
FT                   /EC_number="6.1.1.21"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM TIGR00442"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69222"
FT                   /protein_id="ADK69222.1"
FT                   /translation="MLQKPRGTQDFFLDEAKLWNKVETKLKEILDQFNYSEIRTPMFES
FT                   KELFIRSIGSTTDIVSKEMYEFVDKKNRSLVLKPEGTASVVRAVIENKLYAEENLPLKV
FT                   YYISPMFRYERPQNGRYRQFHQLGIEVFGSDSIQQDYEVLNIATKIINQFKLNKNIKIY
FT                   TNFLITGKNREDYILELKKYLSDFKLCNDCNTRLEKNPLRVLDCKIDDKQFKNVPSMQD
FT                   FLTKEQKTRYDQTLELFKKTNISVIHDDKLVRGLDYYTGFIFEIKYLNNNNEQTIIAGG
FT                   RYNNLVNEIGNINLAACGFGMGLERFINIIKEQNSSLVNQKTNIDLYTICIDDLAIELN
FT                   QQILDLTRSIGLKADSNYYHLSLKSALKKADKLNPKYVIILGSNEAKTNEFIIKDQINK
FT                   TQIKTTLTKFIKDLK"
FT   gene            396010..396363
FT                   /gene="rbfA"
FT                   /locus_tag="MMS_A0370"
FT   CDS_pept        396010..396363
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rbfA"
FT                   /locus_tag="MMS_A0370"
FT                   /product="ribosome-binding factor A"
FT                   /note="identified by match to protein family HMM PF02033;
FT                   match to protein family HMM TIGR00082"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69835"
FT                   /protein_id="ADK69835.1"
FT                   /translation="MVNIKTQKRKESLLLRELNLILQREIKSEILKSVSVVETRLSADN
FT                   SHVKIFYQFIPIPEDLTIQSIEEELENKLKEIRMILASKLDWRTVPELTFVYDTSLDRA
FT                   NQIDKILKEDKNK"
FT   gene            396413..397291
FT                   /gene="truB"
FT                   /locus_tag="MMS_A0371"
FT   CDS_pept        396413..397291
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="truB"
FT                   /locus_tag="MMS_A0371"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="5.4.99.-"
FT                   /note="identified by match to protein family HMM PF01509;
FT                   match to protein family HMM TIGR00431"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69068"
FT                   /protein_id="ADK69068.1"
FT                   /translation="MQKSGIFILNKPSNISTYQLINQVKKKLNIKKVGHCGTLDLLATG
FT                   VVICLVNNATKISDYLLNANKAYQVKIKLFTLTDSFDAEGNIIQTQTPFNISLDQINKV
FT                   ISKYNNYTYNQYPPIYSSIKVDGKKLYEYALTNQNVEIKSRKVTIYKTSLLSYDQKNYE
FT                   IFLDVKCSKGTYIRSLAVDICKDLNTIGYVVYLNRTLSGNFKLENAIDLNNISWDHLIS
FT                   INDAIRTNDFKVVKYQNSLEIIQGKKIILNDINDDLVFISDDQNNILAVYQKYDNNIFK
FT                   IKRGGLNNDIY"
FT   gene            397278..397832
FT                   /locus_tag="MMS_A0372"
FT   CDS_pept        397278..397832
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0372"
FT                   /product="riboflavin kinase"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM PF06574"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69678"
FT                   /protein_id="ADK69678.1"
FT                   /translation="MIYINDSFDKLEKLNTKKAIITIGNFDGFHIFHQKIINQVINIAK
FT                   QENLTSIVMSFDKKIKNNKTYTNLATKKQKLEFINTKLTDLDYFIDIKVDDSLIKTTKD
FT                   QFIDILLSKLNVIKIVEGQDFTFGYLSQGNINDLIRVFSKENVIIFKRDNDISSTKIKK
FT                   LLDENLVDKAQELLGIDLKLK"
FT   gene            398183..398503
FT                   /locus_tag="MMS_A0373"
FT   CDS_pept        398183..398503
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0373"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69705"
FT                   /protein_id="ADK69705.1"
FT                   /translation="MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRF
FT                   EAFGIEGLINKEKKPYYSAKLKLKIVLYKLETNHSYDEVAKKFNIIPTFPSLSIKQENI
FT                   LM"
FT   gene            complement(398544..398696)
FT                   /locus_tag="MMS_A0374"
FT   CDS_pept        complement(398544..398696)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0374"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69096"
FT                   /protein_id="ADK69096.1"
FT                   /translation="MINVIKEVKEIEVFVNKQKIETIQVYNDELQESWQTYQILLELLT
FT                   KEKVT"
FT   gene            complement(398698..400221)
FT                   /locus_tag="MMS_A0375"
FT   CDS_pept        complement(398698..400221)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0375"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69330"
FT                   /protein_id="ADK69330.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRSDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNDRGILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   GTVPNVFINLKPYCWLHLFMFHFISVFKLHHLHSKFKIRTDWKKQNHWA"
FT   gene            400436..400615
FT                   /locus_tag="MMS_A0376"
FT   CDS_pept        400436..400615
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0376"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69264"
FT                   /protein_id="ADK69264.1"
FT                   /translation="MKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEFWKKFH
FT                   TLLTKEKSTRKKQK"
FT   gene            400624..401484
FT                   /locus_tag="MMS_A0377"
FT   CDS_pept        400624..401484
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0377"
FT                   /product="putative transposase InsK for insertion sequence
FT                   IS150"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69505"
FT                   /protein_id="ADK69505.1"
FT                   /translation="MLKTHKKVKIPILLKIAKLPKSSFYEWKHKLENTIDKDKELKEMI
FT                   VDIFSKSFETYGYRRLKMALKSKGYIVNHKKILRLTKELGVQCIKFRTKNGRYSSYKGT
FT                   VGKIADNVLKRNFHSLQANKLWCTDVTEFKVNGQKLYLSPIIDLYNDEIISYSIQTNPN
FT                   LNLTNSMLDKALKKVKNTNGLLIHSDPGFHYQHISWAKKLEENNITQSMSRKGNCLDNA
FT                   IIENFFGLLKQEIYYGEKYNSVEELTKRIHKYIYWYNNIRIKEKLKGLSPVQFRKQSCY
FT                   NIEKF"
FT   gene            402114..403787
FT                   /locus_tag="MMS_A0378"
FT   CDS_pept        402114..403787
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0378"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69977"
FT                   /protein_id="ADK69977.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRSDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNDRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            complement(403829..404698)
FT                   /locus_tag="MMS_A0379"
FT   CDS_pept        complement(403829..404698)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0379"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69058"
FT                   /protein_id="ADK69058.1"
FT                   /translation="MLKDNKDIYLPIVLLNQIFLSDSNIQVYFNQGEVNVFRFADSLKD
FT                   FFSIANLKMSKDMQTEIPKNLKEFQYKYLSFLFDHYYGIKLNNKSYKEFFKKYESKILG
FT                   SNDSHYLATKQIIADLDDPHSAFSMDGYFNKGMEYTKTKIESKSKEHREKIWNETLHLL
FT                   AKFDPNKIEYQNNFISSDTSVISFKKFEETTASHIKKSLEEAQTKGIKNIIFNVTQNGG
FT                   GFIGAAYEIMGFLTDKPFKVYNYNPLSKEQKVETIKSKYNKFNFNYYILTSPPTFPSLS
FT                   IKQENILM"
FT   gene            complement(404908..405189)
FT                   /locus_tag="MMS_A0380"
FT   CDS_pept        complement(404908..405189)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70085"
FT                   /protein_id="ADK70085.1"
FT                   /translation="MKLFLSSLFLLSNTITPSLANSINVVNNQNSSINLKEYNLNYLAK
FT                   NIKDTKKKKINIHNHKDVAYVSINEFLDSIEPIIKRNEITHELKITKL"
FT   gene            complement(405214..406992)
FT                   /locus_tag="MMS_A0381"
FT   CDS_pept        complement(405214..406992)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03572"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69305"
FT                   /protein_id="ADK69305.1"
FT                   /translation="MKKAAIFLIPTLSLVLVGCTNNKQNNNLVQKQPNITNVYKKTIKD
FT                   KEQNIENKLKKITEQNNKFQVFEDTQYSVKSLLNSISFSNNKININKYKDINYVGLDQY
FT                   LNLLKDIIEINSKSKNVFYNNVSYTLTKELKKETNNNITTITLINKYSLKDKNKNSDFT
FT                   LSEFVKFDYLTQQITISSVNFYNLLNPYEDETNLEYKYSKTLDKNPLIIDLNKYNIYIF
FT                   NKNNQLYLPLLVLNQVFLTESETQIYFNNKDLFVFEVFDLYDHRNNETKTKLSSNKQDT
FT                   ELSNDLKEFSYNYLWFLLDNFYPLKQENKNYKDYLEKYKKELMSNKLNHFKATNLLIRD
FT                   LNDIHTKVLLQSPLYDLKTKNEDLLVKESIRTDRVGNFRKYERELIRESGDLMEKDIRY
FT                   TKDNKTAIIKIDIISRDTIAGVKKQLEEIKNKNTFKNVIFDLTLNRGGSLPSTFILLGY
FT                   LTNQSFKYHKFYPNTNNKEILDIKSKIGKFDFKYYILTSPINYSAGNVFAAVSKTNKIA
FT                   KIIGYQSAGGASEVRLNVLPNGMIIRKSSMYTLTDNNWNSYEFGTQPDIEFDKSKGYDF
FT                   KKLFDLDYIQNIVNKN"
FT   gene            407205..407471
FT                   /gene="rpsO"
FT                   /locus_tag="MMS_A0382"
FT   CDS_pept        407205..407471
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsO"
FT                   /locus_tag="MMS_A0382"
FT                   /product="ribosomal protein S15"
FT                   /note="identified by match to protein family HMM PF00312;
FT                   match to protein family HMM TIGR00952"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69347"
FT                   /protein_id="ADK69347.1"
FT                   /translation="MVSKEQKLALIKEFGGDEKNTGLAEVQIAILTAEISNLTEHLKMH
FT                   KKDIPTRRTLLKKVAQRRHFLDYLVKKDVNRYKEVIGKLGIRK"
FT   gene            407531..407604
FT                   /locus_tag="MMS_A0383"
FT   tRNA            407531..407604
FT                   /locus_tag="MMS_A0383"
FT                   /product="tRNA-Gly"
FT   gene            407703..408347
FT                   /locus_tag="MMS_A0384"
FT   CDS_pept        407703..408347
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0384"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69965"
FT                   /protein_id="ADK69965.1"
FT                   /translation="MENQNKEQLLDNIKFNNTRTPFWINLLVQLFTTIGLFLIILFFIG
FT                   ADLQNYSWNHFNKLGKLTYLYLFLICLTYLIILFLINLLLVLFKVVKSDSFTYSFGLAF
FT                   VGILIILTGNLFYYWNTTLVIKTILRFVLVIISMVLGVLFGTFISIIFKNKEYQKEEEN
FT                   LAILNAYLNNQIVPTKKQLKQIKKQEYKLSKQKEYEELLKFKENLYKKKTD"
FT   gene            complement(408366..410228)
FT                   /gene="infB"
FT                   /locus_tag="MMS_A0385"
FT   CDS_pept        complement(408366..410228)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="infB"
FT                   /locus_tag="MMS_A0385"
FT                   /product="translation initiation factor IF-2"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03144; match to protein
FT                   family HMM PF04760; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00487"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69545"
FT                   /protein_id="ADK69545.1"
FT                   /translation="MKKQVKNIKKQKAQNQTKNIKKQLKEEVNTGLIDGIFVYTEPLSV
FT                   IEFATKINKPLTAILKHYFNQGLLLNQNTLLTEEQMGELCLEFGFDFKKETTVTKENIL
FT                   QTLLETVDDEKHLKERPPIVTIMGHVDHGKTTLLDSIKNSNVVANEAGGITQAIGAYQI
FT                   TTNHNKKITFIDTPGHEAFTEMRSRGANVTDIVVLIVAADDGVMPQTEEAIDHAKLANV
FT                   PIIVFINKIDKPEADPNRVKTELMKYGLVAEEFGGDIPFIEGSAIKKINLDKLQDTIIL
FT                   ISELENLKANPDKFASGVVLEAHLDKAKGPVASVLVQQGTLEIKDIMIAGTTFGSIKHI
FT                   EDEFKHKVLKAEPSKPVVVYGLNQVPKAGDKFVVINDEKMAREISEAQLKKQQEEERRT
FT                   KQAFTLDAIKQHIDEGELKNITLIIKADTQGSVEALKNSLSKINISGVKINIIRASVGA
FT                   ISLSDISLASTVRDGLVIVYGFNVRPDAIVRKKAEEDHIEIKLHNIIYKVIEELEDAAK
FT                   GILDPEVKELVLGQAQVRALFRHSAIGTIGGFYVLDGIIPRNAKIRVIRNGVVVYDGEI
FT                   NSLQHQKQDAKEIKAGFEGGLTIKNFNDIKEEDIFEAYKIEQIK"
FT   gene            complement(410250..410549)
FT                   /locus_tag="MMS_A0386"
FT   CDS_pept        complement(410250..410549)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0386"
FT                   /product="ribosomal protein L7Ae"
FT                   /note="identified by match to protein family HMM PF01248"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70117"
FT                   /protein_id="ADK70117.1"
FT                   /translation="MQKDKLLKAIGMAYTSNNLITGFRLLEEIKLKKVKFVILSSDMGL
FT                   AQQKKYINKCLSRNIECVFNVLTKQELSKACGKDILVAIGLKDDNFIKLIKSNL"
FT   gene            complement(410536..410805)
FT                   /locus_tag="MMS_A0387"
FT   CDS_pept        complement(410536..410805)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04296"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69506"
FT                   /protein_id="ADK69506.1"
FT                   /translation="MINKNKNLRKDIASNQMLEKHQLIRIVKNKNNEIFIDTTYKANGR
FT                   GVYLKPDLNSLNIARHKNLIAKSLKSKIDVSIYDQIEEFINAKR"
FT   gene            complement(410798..412552)
FT                   /gene="nusA"
FT                   /locus_tag="MMS_A0388"
FT   CDS_pept        complement(410798..412552)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="nusA"
FT                   /locus_tag="MMS_A0388"
FT                   /product="transcription termination factor NusA"
FT                   /note="identified by match to protein family HMM PF08529;
FT                   match to protein family HMM TIGR01953"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69595"
FT                   /protein_id="ADK69595.1"
FT                   /translation="MLNGTELLESIKLIEKEKGISKESIINGLKEGLQKAYERFYDTDA
FT                   IIKIDINENTGLITMHQELKVVDDEQLDDDWLEITLSKAKLKNPDIQIGDTIYKPIEFS
FT                   EEFSRMVVNQVRQIFQQKIREAERARIYEQFVSLEGEVVQAKIVGMNRENNYVLDINGT
FT                   TAYLWKSKTINNEIFQINEIIDVYIEVVEKESKLSQISISRTAPNFLTKLIEREVPEVR
FT                   MGIVEIKAVSREPGKRSKVAVITHNNNVEPIGAIIGVGGNRINRISDILKGEKIDIIRW
FT                   DEDQITYLINAMTPVKVISINKIGDEYDIVVPDTQLSLAIGKQGVAAKLIASLLKTKIN
FT                   IFSYSTALKENMDILWNGDTTKQEVETNTYIPKTKTTKKEEKPVITTIKKPVKQTIKKE
FT                   ENQIDVDALIAFQAEVEHEQELKDQEELLKQEYIYKEYENNFNDFENEKEIVLAEKQLE
FT                   SQNQIIKEPVVEVQEVEIEKQSKTEDQIIENKQPETRTEVETKPNTVEQVNKLNTNKPN
FT                   NKFEQNRFSYKKQKQKEEELELGFDIKNEPDIDEIDANLKAFNDAILKQEDDEDLDIDL
FT                   DDYDKYYD"
FT   gene            complement(412561..413055)
FT                   /locus_tag="MMS_A0389"
FT   CDS_pept        complement(412561..413055)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69258"
FT                   /protein_id="ADK69258.1"
FT                   /translation="MKDFESLKFQINELVNKELEVLNLKVYQINNLKEFENDMIQILVE
FT                   DSLQANKPLDFDILIKANDLVSNKIDQLIKTKDKYLLEISSSGIEKQIRSQEELLKALE
FT                   QWVYVQLNNEIKKVKEFEGYVTKYNDQTNTFTFSFFIKGQKKNLDVKFDDIKFIRYAVR
FT                   F"
FT   gene            complement(413169..413819)
FT                   /locus_tag="MMS_A0390"
FT   CDS_pept        complement(413169..413819)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0390"
FT                   /product="nitroreductase family protein"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69777"
FT                   /protein_id="ADK69777.1"
FT                   /translation="MQKEYIKELMLNRKSARDFDLNKSISDQDLEIILTSMRMSPSAFN
FT                   LMNLRLLIIDRNCGFKTELSPLFYNQLNFINADKVILFVSDKTNKILNHTIDKTVNKMF
FT                   NETQVEIANKFKKNVINATSQLAQMNELDNWSKTTAHITAGIATIAAASLNIDSCIIGG
FT                   FNAKVLETFFIQKNYLSEDEQIVLTMSFGYMSKSIKPKSKIRIDENEYITFVK"
FT   gene            complement(413832..418280)
FT                   /gene="polC"
FT                   /locus_tag="MMS_A0391"
FT   CDS_pept        complement(413832..418280)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="polC"
FT                   /locus_tag="MMS_A0391"
FT                   /product="DNA polymerase III, alpha subunit, Gram-positive
FT                   type"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00929;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM PF02811; match to protein family HMM PF07733;
FT                   match to protein family HMM TIGR00573; match to protein
FT                   family HMM TIGR01405"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69287"
FT                   /protein_id="ADK69287.1"
FT                   /translation="MQTKILGIFKKIGIELDQTDYIYFKDAILVETPRISQIKNKGYLH
FT                   VEIKDFLPIDVLKKIEDKLKNNQYFNFKLIIDVKNQQFNKDLLIQYLEFIKMHKSLFNN
FT                   RASWKLLDIYNFELINNQLVFLVNSQTIKNEISLELDYCLAKLNQFGFKDLSYLINVNE
FT                   ISLDTLDTKQQINKTYDKPEYEQQIIKPIEKKPSVNNSYKNKRPSLDKPSYNSLLDVED
FT                   DAQNIVIQGMVINKEFKLSKTGRKIFYIDITDFQSSIRCMYFAKSDALCEFDDLTEDEL
FT                   KSKEIEQIKENKIQINDWISVKGKTSLSVYDQEQIFYIDDFKKIKKQVGLRIDDAKIKR
FT                   VELHAHTKMSVMDGVSDPIDYLELISSWNHKAIAFTDHTNVQAFPDIYKALNSVNKKRS
FT                   DQDKIKAIYGLEMNMLNNDLWYVKNPKNQKLKDARMVFFDLETTGLSPELDEIIEFGAI
FT                   EYNLKTGERKKIDILIKPKTKLKAFTQKLTNITEKMLEDKPSIEQAFKQINEIIKDAIL
FT                   VAHNANFDFTFLSYWSEKLGYSKLENTIIDTLTISRIIYPDLKSHRLGSLAKRVNISYD
FT                   PSIAHRGDYDADILADIYERMLDETRKKIKIITDSDWNKIDPINYADNLNYYKNKGFHT
FT                   NILVKNQAGLKELYKLVTKSHTTNFYSSPKIFKDDLIQIKQNNNLLFGASCVNSEIFEL
FT                   ARTSTLENLKQAISFYDYIEVQPISVYKNLLQNDSLDLDQLKEIITNIINIAKQENKLV
FT                   VASSDCHYTNPELKQIREVYINAKGLGGIRHPLFDFNNRVKDYPDQHLRTTKEMLKEFE
FT                   WLNDDDLINEIVITNSNKIADMIDSNVIPIKDGLFTPKIANVNEKLKDKCYQTAKQMYG
FT                   EMLPEIVEKRLEKELGSITKHGFAIVYWISHLLVKQSLDDGYLVGSRGSVGSSFVATMA
FT                   QITEVNPLKAHYRCLNCKYSDFNTDPAYKCGYDLPEKNCPNCNQKLIGDGHDIPFETFL
FT                   GFNGDKVPDIDLNFSGEYQNQAHNFTKKMFGENNVFRAGTISTVAEKTAFGYVKTYFEE
FT                   TKRDASLPRKTEINRLAKLAQGVKRTTGQHPGGIIILPNEYEIEDFTPVNYPADDLNST
FT                   WKTTHFDFHSIHDNLLKMDILGHDDPTALKMLRDLTNIDPITIPTDDKNVYSLFSSLQA
FT                   LNLTSDKINDEITGAIGIPEFGTGFVRNMLKETQPKTFADLVQISGLSHGTDVWLGNAR
FT                   DLIKDKKADISTVIGCRDDIMVYLINMGLESSLAFMIMESVRKGKGLKKEWIDVMKQYN
FT                   VPDWYIDSCLKIKYMFPKAHATAYVLMAYRIAWYKIYYPTEYYATYLTTRADVFDLKTV
FT                   LGGYDAVLLKLKSQQQRVKNGEKLSKKEEDLEVVYEVLLEMFARGIKFSNIDFEKSEAT
FT                   KFKVDILQDNSKIIIPPFNVIDSLGEAVALSIINARNTKPITSVNDLKNRTQTTQTQIK
FT                   IFEEFNILDSLSVDEQLAFDF"
FT   gene            complement(418289..419314)
FT                   /gene="cdsA"
FT                   /locus_tag="MMS_A0392"
FT   CDS_pept        complement(418289..419314)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="cdsA"
FT                   /locus_tag="MMS_A0392"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="identified by match to protein family HMM PF01148"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69354"
FT                   /protein_id="ADK69354.1"
FT                   /translation="MNTIITKDENKIKQIKKNLKTRLISATILVLLLGVYLAFPILYYF
FT                   TNDSSSKLIITYNVISLVWSSCVLFLSIRELLISFEIKNLDQKLFIEILTVILFWIPFS
FT                   NIETKIPVYNDLNLKEYWYLIVIAIGLYLFLITFFLMKFCNKNIYQATKIVFVLLIMVL
FT                   AFKAINFLGFLKAHNKILYGFSSIIWIWATIILTDSFAYLFGIRFGKHKLAPTISPKKT
FT                   WEGAIGGFFSSVIINLIWVLTIFFIPWTKSFAPFIGMYDLLLKDDNLMLITYIFLTVLV
FT                   SLFTQFGDLIFSYIKRSIDIKDFSNLIPGHGGILDRLDSFYFVFFIIYIILHISLTFNR
FT                   I"
FT   gene            complement(419514..420590)
FT                   /locus_tag="MMS_A0393"
FT   CDS_pept        complement(419514..420590)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0393"
FT                   /product="peptidase, M24 family"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM PF01321"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69979"
FT                   /protein_id="ADK69979.1"
FT                   /translation="MTKHEIINELLEKNNADAILLYSPENRYWFSKFHSSLGYLIITKT
FT                   QSHLFLDGRYITAARNNKNINKDIQLHHFSKSLKQDLIDILNQNNVKTLAFESDWTYFE
FT                   QYQAYKDHWFKDFNLIGINCSKIRMIKDDWEIANIKKACDITDQVFQAALDFIKPGITE
FT                   KQLQRFIDDKFLEFGADKISFDTIIASGVNGSMPHAVPSDKVINNNELITIDMGCFYNG
FT                   YCSDQTRTIALGDVDPKLVEIYNIVYEAQSLGISLVKEGVIAGDIHKQVYDFIDKKGYG
FT                   KYFDHGLGHGIGVEIHEEPSVGSTGSEVLKENMTITIEPGIYIPDLGGVRIEDDVLVTK
FT                   TGCKLLTSSPRILLKLQK"
FT   gene            420735..421745
FT                   /gene="trpS"
FT                   /locus_tag="MMS_A0394"
FT   CDS_pept        420735..421745
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trpS"
FT                   /locus_tag="MMS_A0394"
FT                   /product="tryptophan--tRNA ligase"
FT                   /EC_number="6.1.1.2"
FT                   /note="identified by match to protein family HMM PF00579;
FT                   match to protein family HMM TIGR00233"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70107"
FT                   /protein_id="ADK70107.1"
FT                   /translation="MQKQIMVSGITPSGAMTLGNYLGVVKRFIQYQNEYDLFIFIANLH
FT                   AITVPQEKEKLKKNTKEIAALYFACGLDINKTTIFLQSDVLEHAQLGWILTTNTSMGEL
FT                   SRMTQFKDKSLKAESINGKGYIPTGLFTYPALMAADILLYDPKYVPVGIDQKQHIEITR
FT                   DIAIRMNNKYGEMFKIPEPLINSEIKIMDLQDPTKKMSKSSTNPKAIITMLDSIDEIKS
FT                   KIKAAVTDSENLIKYDPINKPGISNLITIYCQLKNISIKQAEKHWENKNYKDLKDDVTQ
FT                   VLIDEIIPIQTKFKELYNSKQVEQWLELGANKARHIANKKLNKVQNLMGLNYNRK"
FT   gene            complement(421774..422643)
FT                   /locus_tag="MMS_A0395"
FT   CDS_pept        complement(421774..422643)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0395"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69887"
FT                   /protein_id="ADK69887.1"
FT                   /translation="MENKKSNYFSDIEILLTYDYDSCVLFLLNKYGQVQGDYIKYSYSR
FT                   FVKTIEENLDIKKSLYGLEIHHIDEDKIPNLSSKENRTKYIEYQRADRLVYCNLIEHLL
FT                   LHIKIYEKNKNNLSKNGIRLIIRKINDYYSYHQFDDDRNKLFYQSIKDKKLDYFNCLAY
FT                   INNHKILTGNKWYARSLLEDEHNNLYQLSVLYDEIDLYLKARVLPSKVDDSINRPKTFK
FT                   LEKLDDLDYYVEQRKRKMQQQKQSRIRISNNTNKPSESNKSSYKWSVIILTFLALLIVI
FT                   FIFFVFLR"
FT   gene            422756..423388
FT                   /locus_tag="MMS_A0396"
FT   CDS_pept        422756..423388
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69800"
FT                   /protein_id="ADK69800.1"
FT                   /translation="MKEIRSFDLLEFVNRFSLFKLLRYEFENQKTLTDKEKEFLDIAKQ
FT                   YTLTYPLKVSIDDMLKQIESNKIENDDVKWEAQISVIKHWIASELIDIFLKDSKTKKTI
FT                   VDNKNLTEQWMFDYLKKVYEQLFINKLKEFKTECEKYQDVLFVDLFITKLEEWINDKND
FT                   IKTFEWYLNKNWDGFNYFYSYLYKKEFKDSTIMNKKDDFINILFCVF"
FT   gene            complement(423618..424688)
FT                   /gene="rmuC"
FT                   /locus_tag="MMS_A0397"
FT   CDS_pept        complement(423618..424688)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rmuC"
FT                   /locus_tag="MMS_A0397"
FT                   /product="RmuC domain protein"
FT                   /note="identified by match to protein family HMM PF02646"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69179"
FT                   /protein_id="ADK69179.1"
FT                   /translation="MNLTIILIILISILTIVCISILFYLIKTKNNDSKIDLTSLNNKFD
FT                   TNKELITKEIEKDTEITKTNLINLKETVNKQKEDLTKSLDKLEENIKKFNEITNNINTI
FT                   DKKVDTSVKNINELSLIFKNSKTRGNLGEFTLEWILSNVLGEKTDNGIWQTQYKYKNSN
FT                   VIVDAIIKTQINDKKIAIDSKFPLTKANVLISENTDNYLYKQAEDEFKKTIKNMIKELN
FT                   NKYISNSENVSSVIMFIPSEAIFELIWSKFTDIFSEAIKNKIWICSPTTLPAVLYSQQI
FT                   SIKEYKISKNINEIQKLIKTITDDVKRLLDRNEKMSKIYEKYKTETEEVFKEFQTSANK
FT                   IDKNYSKLEAINIDDN"
FT   gene            425177..425686
FT                   /locus_tag="MMS_A0398"
FT   CDS_pept        425177..425686
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0398"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69690"
FT                   /protein_id="ADK69690.1"
FT                   /translation="MINNNEMYDLSEASIAVQLENRIANGAIFFDFHNALKNGVAFESD
FT                   FIFSDLYYLPNSGIYYKKILDLYKPKFIHNLANNNKLQMVIFDRYNIKNKLNDIKHHIS
FT                   NNSALMVGIEYWTIKSNDSNSKKTSEMDVQIYLDNLNITDKFKITNNNVTPTFPSLSIK
FT                   QENILM"
FT   gene            complement(425727..427400)
FT                   /locus_tag="MMS_A0399"
FT   CDS_pept        complement(425727..427400)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0399"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69666"
FT                   /protein_id="ADK69666.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNDRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKDAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            427525..427689
FT                   /locus_tag="MMS_A0400"
FT   CDS_pept        427525..427689
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0400"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69565"
FT                   /protein_id="ADK69565.1"
FT                   /translation="MDVQIYLDNLNITDKFKITNNNVTNVSYENKSNKLNQVLIQLNYK
FT                   YKSKSDLIN"
FT   gene            428130..428252
FT                   /locus_tag="MMS_A0401"
FT   CDS_pept        428130..428252
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0401"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70043"
FT                   /protein_id="ADK70043.1"
FT                   /translation="MYFDTNNRQLNNLVNEVVLENNNSFKWYLDSNIDTNLKIK"
FT   gene            complement(428740..429210)
FT                   /locus_tag="MMS_A0402"
FT   CDS_pept        complement(428740..429210)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0402"
FT                   /product="putative lipoprotein"
FT                   /note="Tandem dinucleotide repeats of TA occur 5' of the
FT                   ORF in a putative promoter region; this tract is possibly
FT                   subject to indels governing phase variable expression of
FT                   the gene."
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69445"
FT                   /protein_id="ADK69445.1"
FT                   /translation="MKKINKIIISLSSIISISSMPLITASCSNKNRINESITNNTTPQT
FT                   QDNHNQENKNKKEEEDPKDLLNQLEEIQKDYEEAKKGNEELIKKSDYFDDLKQWFENIV
FT                   PGSNHKWNYYLDFKNKVKNDGKIGSFEYVKDFIKKYKTLIKKSLQKKQEILE"
FT   gene            complement(429389..430120)
FT                   /locus_tag="MMS_A0403"
FT   CDS_pept        complement(429389..430120)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0403"
FT                   /product="putative transposase InsK for insertion sequence
FT                   IS150"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69345"
FT                   /protein_id="ADK69345.1"
FT                   /translation="MIVDIFSKSFETYGYRRLKMALKSKGYIVNHKKILRLTKELGVQC
FT                   IKFRTKNGRYSSYKGTVGKIADNVLKRNFHSLQANKLWCTDVTEFKVNGQKLYLSPIID
FT                   LYNDEIISYSIQTNPNLNLTNSMLDKALKKVKNTNGLLIHSDQGFHYQHISWAKKLEEN
FT                   NITQSMSRKGNCLDNAIIENFFGLLKQEIYYGEKYNSVEELTKRIHKYIYWYNNIRIKE
FT                   KLKGLSPVQFRKQSCYNIEKF"
FT   gene            complement(430258..430800)
FT                   /locus_tag="MMS_A0404"
FT   CDS_pept        complement(430258..430800)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69927"
FT                   /protein_id="ADK69927.1"
FT                   /translation="MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRF
FT                   EAFGIEGLINKEKKPYYSAKLKLKIVLYKLETNHSYDEVAKKFNIIYSSTIAGWVKKYR
FT                   EYGFLGLNNNIGRPKKIMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEFWK
FT                   KFHTLLTKEKSTRKKQK"
FT   gene            complement(431232..431537)
FT                   /locus_tag="MMS_A0405"
FT   CDS_pept        complement(431232..431537)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0405"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70108"
FT                   /protein_id="ADK70108.1"
FT                   /translation="MNIQKNRVDKLTLLKGISYEKLLTLLDSFALIASSAAITVACKTP
FT                   SQEIKADESDKAKKGETKEEEKFEPKFSDVENKILGNFEPNNKNIVSQGDIKKRIS"
FT   gene            complement(431635..432420)
FT                   /locus_tag="MMS_A0406"
FT   CDS_pept        complement(431635..432420)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69331"
FT                   /protein_id="ADK69331.1"
FT                   /translation="MSIIYDYEFVFKNNNNDKQNIVFCHGFNSKLTSLNGFSNYWTKSN
FT                   YYALQFPGSNIIKPIKNHQISVEQFSDLLIEFVKQNNLKNVILIGKSLGAGVISLAYLK
FT                   QPLLFKKLILITPINQTQLSLEFWKKDYVFINSFNDYLTKFVPYIYYNYNNSNWVNNAK
FT                   SKFNLNYYTNKYILQLAKGLTDINLHNKITKAYQSINIPTLVVLAKNDRIIDCDDSLNF
FT                   FNKTIKNVKTVVINNASHMVYKDQSEKLNQIIDDFITNN"
FT   gene            complement(432429..432575)
FT                   /locus_tag="MMS_A0407"
FT   CDS_pept        complement(432429..432575)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0407"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69708"
FT                   /protein_id="ADK69708.1"
FT                   /translation="MQYKLKNNGSWTDITKNKVSDLASGTYQIRIKPLKNALASEIIEV
FT                   NID"
FT   gene            complement(432651..434195)
FT                   /locus_tag="MMS_A0408"
FT   CDS_pept        complement(432651..434195)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69476"
FT                   /protein_id="ADK69476.1"
FT                   /translation="MAIIDQLFDWQKELIIKNKHKNQLGLFLDMGSGKTILSLGFCEIN
FT                   QVDAIIVIASRSKTLETIEQNASFTNYLQNDLNFKVYLKTDLKNADFKNNQKEAIIINY
FT                   HSFLLNINKENFFNYLAKFISVHKNQKIAIIIDESQNIKNSRALISISIKNFVDLVKKL
FT                   AFKTYLYLLSGTPQTTGAIDMFNQLRFLGLKMTRYQFEDQFCIKTKFNNAYRRVYKING
FT                   YKNIKQLEQLINQFALTSKNIPPIYLPKQQFIGIKLPISSEFELFTNKKITEYDLLTFC
FT                   NKNNIKSNYKPNELNLIKNPYYKNLSYPDDKWIAGDDATFWLRTRQIPIGFQGNSKDYY
FT                   WFDYSRLNKLEQLLTDKIDNYIIFYNYDPEFDEIYKICKKLDYKIDIWNGNKKNITNYL
FT                   EFLNLDQNNKNSSKKRVIIANYFSASTGNNWQEYDKTILFSLATYGYHIQALKRNHRIG
FT                   TKNTITYYLFLQDNYLDKSMWGSIQKRQIYNTEIFIKTTKEFNKLKSQYKNLTFNF"
FT   gene            complement(434262..434507)
FT                   /locus_tag="MMS_A0409"
FT   CDS_pept        complement(434262..434507)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03672"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69164"
FT                   /protein_id="ADK69164.1"
FT                   /translation="MLLTTTFSSGALAAMLIGVIIAAIIIGLILGFVITRYMVKKQLKD
FT                   NPPITEKQIRAMYMSMGRKPSEADIKKTMNAIKRAK"
FT   gene            complement(434523..436493)
FT                   /gene="tkt"
FT                   /locus_tag="MMS_A0410"
FT   CDS_pept        complement(434523..436493)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tkt"
FT                   /locus_tag="MMS_A0410"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="identified by match to protein family HMM PF00456;
FT                   match to protein family HMM PF02779; match to protein
FT                   family HMM PF02780; match to protein family HMM TIGR00232"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69655"
FT                   /protein_id="ADK69655.1"
FT                   /translation="MKTSKNDNLNALRILGVSAINKAKSGHPGIVLGAAGIVYVLFNKI
FT                   MNFNPKNPEWFNRDRFILSAGHGSALLYSALHLSGYDLSIDDLKQFRQWDSKTPGHPEK
FT                   TLTCGVEVTTGPLGQGVGMGVGMAVAEAHLASVYNKHDFNLIHHYTYVLCGDGDLQEGI
FT                   SQEAISFAGKHRLNKLILIHDSNDVQLDSNVVDVQIEDMHKRFKACNWNTIKVSDGEDL
FT                   NSIYKAIRKAQLSDKPTYIEVKTVIGLGSTKQGTKDVHGAPLNDDITKVKKYFDWDYDD
FT                   FIIPDSVYKHWSINAKKGEIKEEYWNQLKAKYSLKYPELSSYLDNAINKNITFDFSSLL
FT                   KDIPNNDEATRLSSGKIFEKIADNEKMLIGGSADLSSSTRIKGADNQFTNLNKTGRNIM
FT                   YGVREFGMGAINNGIAAHKGLIPVASGFFVFADYLKPAMRLASIMQLQQLYVFTHDSIA
FT                   VGEDGPTHQPIEQLAMLRTIPNHVVLRPADFSETIACYKVALTKLTKTPASIILTRQNV
FT                   KQLQHNDVLNQVERGAYIISDQTDATISLIASGSEVGLAIDVQKELLNHNIKSKVISMV
FT                   STNLFDKQDKEYQDLIINKNTKRIAIEMGSNAIWYKYVGDDGLVFGIDRFGESAPANSV
FT                   IKEFGFTKENLTKKILEYLNK"
FT   gene            complement(436552..436704)
FT                   /locus_tag="MMS_A0411"
FT   CDS_pept        complement(436552..436704)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69212"
FT                   /protein_id="ADK69212.1"
FT                   /translation="MSDNIKDLPFDEIIKRIKFYADLKAKNLITEEQNQEYELLKSWYL
FT                   EIVLK"
FT   gene            complement(436826..437560)
FT                   /locus_tag="MMS_A0412"
FT   CDS_pept        complement(436826..437560)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0412"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69825"
FT                   /protein_id="ADK69825.1"
FT                   /translation="MLFFLTNGAAICVIILLFAIAYMMDPKFLKTITTIKLTMMAMQVA
FT                   LIVLLTNFLGYSGVFGARLMFGNFVLFLSGMLFGPMGGALVGALSYTAGMINPNIFIHF
FT                   SFMAAYMIYAMLGSLVFIKKQKSRLSFMISVFVLLFIASFTLTFISHPIAMLAIGKNAY
FT                   VYVTLVKKFIVFPIDAVIEPILIISTFEVSILVLKRVPNTWNQLWCTRFDSLEFLNKQE
FT                   KKSKKDLKITQNKPIITGQPSN"
FT   gene            complement(437665..438939)
FT                   /gene="gidA_1"
FT                   /locus_tag="MMS_A0413"
FT   CDS_pept        complement(437665..438939)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gidA_1"
FT                   /locus_tag="MMS_A0413"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /note="identified by match to protein family HMM PF01134"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69454"
FT                   /protein_id="ADK69454.1"
FT                   /translation="MKTIRIIGAGLSGCEAAYYLLKKGYFVELYEIKTIKKNPIQHYDY
FT                   FCELAYSDSFRSTDLNTSVGTLKKELELLDSLIIKAAKYASINQNNELVVNRIEFSKYI
FT                   TNYLKTFNNLKIIEQEYLNIDLNIPTIIAIGPISTPSFLTNLKKIINKKNLKLFDTVEP
FT                   TILKQSINKNICYSLDNNLDYLYCDLNKEQFEKFYNALISAKTFNSPLKNEIKLLEKNN
FT                   YFSIESLAKNKQEFINHFKPINNNAYITITLKKDSVIDNLYTIVNFQTSLMWNEQLKVF
FT                   SLIPGLENLKIMRYGVMHKNNYINTKKLLNLGVQLKTNKNIFFAGQIIGVDGYVESVCS
FT                   GLISAINLDRYLNNKKMILPNKNSTIGSLYNYLLKTDSNFNPMRINWALVDLIDGFELS
FT                   DNSKKFYSKRAIELIKQYLKKINYK"
FT   gene            complement(439310..439522)
FT                   /locus_tag="MMS_A0414"
FT   CDS_pept        complement(439310..439522)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0414"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69541"
FT                   /protein_id="ADK69541.1"
FT                   /translation="MLLEWVVVDDLSSDIISNDQLNNNTSSQNVSVLNNNSNDISNNKE
FT                   DKNQILEKISNITQKQQYKKLIHFE"
FT   gene            439811..440230
FT                   /locus_tag="MMS_A0415"
FT   CDS_pept        439811..440230
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0415"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70077"
FT                   /protein_id="ADK70077.1"
FT                   /translation="MKKILTILGSVCLVATTSAAVIACGDRTPSIKSNEKVENKEKTKP
FT                   SETPKKEDSKKEEKKEEKKAKPAATTTTVARKEVKAKSDAEIASELTKELFLLMGDSNS
FT                   KSKNNQLTSSTENILKKTRRKCLKISFSKSCTKKR"
FT   gene            440840..441271
FT                   /locus_tag="MMS_A0416"
FT   CDS_pept        440840..441271
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0416"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69335"
FT                   /protein_id="ADK69335.1"
FT                   /translation="MRYDDQTHIASRDEIFSLGLSGKNLSYDALQTDISWNSATFNLLN
FT                   SYFKELGIRIIEDYNDLVSLELAKNNVLTNAGALLADQKFIKHSLVFATYWNDFEKSNN
FT                   KTGKSMDNFDGNLLEILKNSQQFIENKSNVDLKKQILNV"
FT   gene            441524..441946
FT                   /locus_tag="MMS_A0417"
FT   CDS_pept        441524..441946
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69656"
FT                   /protein_id="ADK69656.1"
FT                   /translation="MELKEILNIYAIQENYSLKHTPEFISDDKSFIVILKNLNYEQDQS
FT                   SNISVSEYLNKIDTKIHSNIKQDIDTDENKSRSTTTEQIEIVLEFAKKHSKFKRIDIDK
FT                   LLNVSPTRSREILNQLVKKNKLITIGSFKDKEYLLA"
FT   gene            complement(442047..442595)
FT                   /locus_tag="MMS_A0418"
FT   CDS_pept        complement(442047..442595)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0418"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69508"
FT                   /protein_id="ADK69508.1"
FT                   /translation="MNKDNLVSCDDLAGSKKYRFFKPINKGAFYELDIEKIQEDQKYDG
FT                   YYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLSLRPMYLSTWNHIVGYICLCFI
FT                   SLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKEIEVFVNKQKIETIQVYNDELQ
FT                   ESWQTYQILLELLTKEKVT"
FT   gene            442803..444392
FT                   /locus_tag="MMS_A0419"
FT   CDS_pept        442803..444392
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0419"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69804"
FT                   /protein_id="ADK69804.1"
FT                   /translation="MPRPDNKGFVYRLGYGYLHELKQYHDDPLAIIKAIIANFPLSWTK
FT                   EQARTKLDEIFKEKKETKKEVLERFKGYEVVEKLFDYFNIFNDCSPTKSTTLKDVVLQL
FT                   IYQRIKNPISVFNTYKTAKKEKIDTHSKNSFYRSLDYIAKNKDEILRNLNAKICANTNR
FT                   KIDVLWFDATTTYFETFSREGYKKPGYSKDGKFKEDQIVIGMATDENGIPLHYKIFPGN
FT                   VADPNTLIPFMLEIADIYEVNSVTIIADKGMSVNRNIRFLESKNWKYIISYRMKAGSKQ
FT                   FKEYILDEKDYINDGGLIYKTRDIASSYNKKRINGHFRRQIISFSQKRATKDKNDRDIL
FT                   IQNFTKKMNKDNLVSCDDLAGSKKYRFFKPINKGAFYELDIEKIQEDQKYDGYYVYETN
FT                   RTDLSVKEVINLYSKQWQIESNFKTLKGKLSLRPMYLSTWNHIVGYICLCFISLVFLNY
FT                   IIYILNSKLGLTGKSKITEHKVINVIKEVKEIEVFVNKQKIETIQVYNDELQESWQTYQ
FT                   ILLELLTKEKVT"
FT   gene            complement(444401..445666)
FT                   /locus_tag="MMS_A0420"
FT   CDS_pept        complement(444401..445666)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0420"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69260"
FT                   /protein_id="ADK69260.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSCNKK
FT                   RINGHFRRQIISFSQKRATKDKNNRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFSYVS
FT                   QFKHKTRKHTYVNFWSHKLCFL"
FT   gene            complement(445858..446016)
FT                   /locus_tag="MMS_A0421"
FT   CDS_pept        complement(445858..446016)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69314"
FT                   /protein_id="ADK69314.1"
FT                   /translation="MQEVINVYHSIPRDELNKRLDDKNSFIPYVKQIYYDKLKNLYVDE
FT                   FKQGFYN"
FT   gene            complement(446035..446166)
FT                   /locus_tag="MMS_A0422"
FT   CDS_pept        complement(446035..446166)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0422"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69951"
FT                   /protein_id="ADK69951.1"
FT                   /translation="MGKLYENKHNLILHEVTGFDFENNRTRWMLDIVKNLWRSFPND"
FT   gene            446859..448349
FT                   /locus_tag="MMS_A0423"
FT   CDS_pept        446859..448349
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0423"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69310"
FT                   /protein_id="ADK69310.1"
FT                   /translation="MFSWDLYIINPLLIVIWLVVASYLFYKNSISKQKGLFYLEISSFW
FT                   IVINFLIQIITNYIDSPILKSFSSSTLTILLFLSSYFLYATILNPLALWLTLKLQSRRI
FT                   WIWISLFSCFLSIMIAFLSNVNITSIIFISLFLAVGISAQIIYFLFFNEQFNERLFPVF
FT                   SSIKAWFVVSFATFISYEIYSLLNLNLIFNHNSYTNWIIFSLSLVCLIICLVVSIFVKE
FT                   RKIKVIKYKEDIVEQLQRYDYKVLIGLIVMSFLITSVNVIIKSDIFELFLVSKLKQQSY
FT                   TNLNVWNYLQSFRLSFVLGQLLLGYLFYKLVIKVIGIVKSISILTSLTMFGVILITFIH
FT                   NIYLLTIMMWVFGLFFFVMFYLWFGIALMWDYRSTKVSVLSTFLTVTFLTLSVWYLVIS
FT                   ICKVNNIGLFGIFKSVFEVINNTDLNKNYLFIKKITEVYYICCILIFCLLGIYLTIFIW
FT                   TANYIIAEYMDLKQIKLKMTSLAKSDIQSKMITRLIRE"
FT   gene            448367..449128
FT                   /locus_tag="MMS_A0424"
FT   CDS_pept        448367..449128
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69749"
FT                   /protein_id="ADK69749.1"
FT                   /translation="MTEYELITTKLNELIKMSRKKELSQDQLFDICIYLTNVIDDVLLK
FT                   KNLKDDLINQNDQFYYLLYLLKTLLAILFTRNAFFNFDIFNKLNPVLLFYIKQSLDHQF
FT                   YDDPKKNYLLENSELHSLTSMYLYVFSIFNKLIKKINYLNLKYNLKPNIEEYKRSSFIN
FT                   DFTNLSYAFFKTRGTQYRSEQFFLLLKHSWIFNHLLEIKTNLDNSDYLVNLVFELECLF
FT                   IIICRIFIQITLDFKTNYEINKLLEINSTNL"
FT   gene            449138..449974
FT                   /locus_tag="MMS_A0425"
FT   CDS_pept        449138..449974
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0425"
FT                   /product="ScpA/B protein"
FT                   /note="identified by match to protein family HMM PF02616"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69513"
FT                   /protein_id="ADK69513.1"
FT                   /translation="MKHWQELTIDQFSGPIELLWLMIKEKKLDIIELSLIEIVDQYLAY
FT                   IKQNQQLDIEIASEYLIIASQLIELKSRHLLFKDQQVDQKQAVDYDDLVYQISQYNQIK
FT                   EISDRLFNAQETYLQTFSKKRSKQNFKKDLVFENPDPLIDLNDLDLDKLTEIFYSVITN
FT                   SNAFKYQADFDLETEIYQTLTTPSLTVHEVILDVVNKITSQKLKEWKLEELLEILELNL
FT                   KNFVVIFLAVLDLVRYQILVIDSIDDQIYIYLRKEVIENENLITQQLEVIVNESTI"
FT   gene            449958..450587
FT                   /gene="scpB"
FT                   /locus_tag="MMS_A0426"
FT   CDS_pept        449958..450587
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="scpB"
FT                   /locus_tag="MMS_A0426"
FT                   /product="segregation and condensation protein B"
FT                   /note="identified by match to protein family HMM PF04079;
FT                   match to protein family HMM TIGR00281"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70004"
FT                   /protein_id="ADK70004.1"
FT                   /translation="MNQQYSAIIEGLLFIYGDDGISLLDIQTVLDNLKPTEIKEIIIQL
FT                   NKKYLSDPSTAFCIQTYKKNNYRLQTKPELHEYFAKLEQYNENKKLSHSTIEVLSIIAY
FT                   KQPITKQQIDEIRNVDSTYQLYKLREKKLIKVVGKDLENNRSNLYGITDNFFKVFNIKG
FT                   GIEELPTISDDDIKQAIENNNEIKQEQQNLDLYGNIDDFNLDSQNE"
FT   gene            450655..451413
FT                   /locus_tag="MMS_A0427"
FT   CDS_pept        450655..451413
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0427"
FT                   /product="pseudouridylate synthase"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69237"
FT                   /protein_id="ADK69237.1"
FT                   /translation="MSLERLQKVISSRGYCSRRAAEKLILENRVKVNDQIINTLGVKID
FT                   PKAEIKIDNRLVLSDSNNQKYYYLFYKPRLVLTTMYDPKKRKTVNDYFKDLNHRVYPVG
FT                   RLDYDVSGLLLMTNDGVLFNFIMHPKYEFLKTYQGLCQGQVNKQQINQLIKGVYIDNDY
FT                   LTKAYSAKLVKYDKLKNTSIVELTINEGKKHHVKKMFDSIQAQLLKLKRTKIEFLEIAD
FT                   LKPGQYRELKTHEVKRLYGIYHSLKQNNNK"
FT   gene            451423..452040
FT                   /locus_tag="MMS_A0428"
FT   CDS_pept        451423..452040
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0428"
FT                   /product="deoxynucleoside kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF01712"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69614"
FT                   /protein_id="ADK69614.1"
FT                   /translation="MKIAIFGTVGAGKSTISAEISKKLGYEIFKEPVEENPYFEQYYKD
FT                   LKKTVFKMQIYMLTARSKQLKQAKNLENIIFDRTLLEDPIFMKVNYDLNNVDQTDYNTY
FT                   IDFYNNVVLENLKIPENKLSFDIVIYLRVSTKTAISRIKKRGRSEELLIGEEYWETLNK
FT                   NYEEFYKQNVYDFPFFVVDAELDVKTQIELIMNKLNSIKNPN"
FT   gene            452052..452765
FT                   /locus_tag="MMS_A0429"
FT   CDS_pept        452052..452765
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0429"
FT                   /product="DNA-binding regulatory protein, YebC/PmpR family"
FT                   /note="identified by match to protein family HMM PF01709"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69140"
FT                   /protein_id="ADK69140.1"
FT                   /translation="MGRAHEVRAASMAKTAAKKSAANGRAAKEIYMAAKQGGTDPNSNL
FT                   ALRSVIDKAKANQIPRDVIERAIKRAMGGDAENYVSNRYEGIGPSNVAILVDTLTSNVN
FT                   RAAAMIREVFNKNKGNPDGKVSFLFEDVAMFAFKNKKEDEVLEALMSDEVEINDLICED
FT                   DTIIIYAPFKAYNSVKHSLDKLNIDEYLISEIRAIPIDKRIEIKDEQAKLQLQTLLDKL
FT                   DELEDVQNVYHNAEL"
FT   gene            452865..453692
FT                   /locus_tag="MMS_A0430"
FT   CDS_pept        452865..453692
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69493"
FT                   /protein_id="ADK69493.1"
FT                   /translation="MNFSLVNFVLLIVNLLMIFLILLIYLITTRSYLNHQVPFINSSNL
FT                   VINSTDINKAIRQFQIMFNLSDYQIIYADTDNMIKVFKNINKNKKQIIISKRIFESVGY
FT                   ELDYLISRLWISAKQVKKDSLLKAYRLTLLTIPTLLITLLSLSMLINFFLFVYNVITDN
FT                   FQINNLTNNQNNMNINFLYKLWKYMIFNYLSFSLIICLFVNYYISIIIKNKIELHYNDE
FT                   VSKLVSSALEMYEYDFKAARIYALGIKWTYIPVFKINNFWTNHYKWTGPFTIV"
FT   gene            453973..454152
FT                   /locus_tag="MMS_A0431"
FT   CDS_pept        453973..454152
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0431"
FT                   /product="putative lipoprotein (Vmm)"
FT                   /note="Tandem dinucleotide repeats of TA occur 5' of the
FT                   ORF in a putative promoter region; this tract is possibly
FT                   subject to indels governing phase variable expression of
FT                   the gene. Twenty TA repeats are present in this tract,
FT                   likely rendering this gene in the OFF configuration."
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69908"
FT                   /protein_id="ADK69908.1"
FT                   /translation="MKKLLTLLGSVGLIASTSTAVVACGDRSNTEMNNSGTSDKPADSG
FT                   KPADYDDSGHILNL"
FT   gene            454589..454753
FT                   /locus_tag="MMS_A0432"
FT   CDS_pept        454589..454753
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0432"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69336"
FT                   /protein_id="ADK69336.1"
FT                   /translation="MSEKLDDKENPTWYKKVFYENKYYYCFRDVKRTFKEEHDFMSSKK
FT                   FSKERYDKM"
FT   gene            456015..456359
FT                   /locus_tag="MMS_A0433"
FT   CDS_pept        456015..456359
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0433"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70021"
FT                   /protein_id="ADK70021.1"
FT                   /translation="MKKLLTLLGSVGLVTSTSAIAVACENKIPAVSLSTDKNSVKEKFD
FT                   DQLEEKSSEKVGSAPQTDQSIVNKSAEEVKKKEIDEAKEVVKKAEEKAKLAQEKYKDSL
FT                   KKVIVLKQKL"
FT   gene            456833..457162
FT                   /locus_tag="MMS_A0434"
FT   CDS_pept        456833..457162
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0434"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69233"
FT                   /protein_id="ADK69233.1"
FT                   /translation="MKKLLTLLGSIGMVPSTAAIAVVCTDRATNTGSKEDDNSNQGEKS
FT                   KPENEEKPASQPSGKTNDEGSEMPGDDPKPSIQPENPKEKQLEEEQKTLDNAKKVAEKA
FT                   KGRCW"
FT   gene            457798..458247
FT                   /locus_tag="MMS_A0435"
FT   CDS_pept        457798..458247
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0435"
FT                   /product="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69658"
FT                   /protein_id="ADK69658.1"
FT                   /translation="MLFKKELVTYIDTKITSWQQAIQVANELLVKNHYVDDDFSKEIIE
FT                   LTNKIGPYYIIASQIALLHLTPKEKWKDKNNAISLTVFKYPIIFKQEQRYHVKYCLSLF
FT                   AKDNHSHIDLLQKFAILFNNKDFINELEKVNNTQDILIVLQKYDR"
FT   gene            458259..460067
FT                   /locus_tag="MMS_A0436"
FT   CDS_pept        458259..460067
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0436"
FT                   /product="PTS system, Lactose/Cellobiose specific IIB
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF02302;
FT                   match to protein family HMM PF04215"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69056"
FT                   /protein_id="ADK69056.1"
FT                   /translation="MEFGKYVLNFFTEFIGTPAILVALFAFIGSLLQKKKFTESLTSTI
FT                   KTAIGFLIIGGGAGIIAGSIQKLGFAFNLLFQRSGAIANNDVLPGLFLNTSKIVLTGSL
FT                   IMICAMFLNIVLARISKFKYIYLTGHVLFYFSTMFASVMHVAGLNLDEVKNLTTVVISG
FT                   ALLVSIYMVLTPALLNNHVIRITKNDNLALGHTGSLGYWLSAIIGLGITKISKKPSRST
FT                   EDVNFPKGLAFLRNTNVAIGITMLLLYLIIYFTTFIVHGYEQMVAHKIIDNGKDVFVQG
FT                   LLQSLTFAAGVEIVLIGVRMFIAEIIPSFQGISQKVVPDAKPALDCPIVFPYAPNAVLI
FT                   GFISSFIGGIIAMGITILIVNLKGINVDIWIIIIPSIVPHFFVGATCGVFGNSTGGIKG
FT                   AVIGSFVNGLIISFVPFLFIGLQLIPNISNNNQHIAWGDGDFLLGLPIGALLRLIGVKS
FT                   AIWVLLIISIISWLILPIYSFLTKKINLVKKLDNNNKDEIINKDQKLISKYDLKKQYKI
FT                   VAVCGQGLGSSLLIEMNLKNVIKELDLPIQITHTNLNSFDPTDETILAVVCGIDLQNSI
FT                   NFERKIVLENLLDQDQAKQKIKEFLS"
FT   gene            460067..460723
FT                   /locus_tag="MMS_A0437"
FT   CDS_pept        460067..460723
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0437"
FT                   /product="putative ribulose-phosphate 3-epimerase"
FT                   /note="identified by match to protein family HMM PF00834"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69762"
FT                   /protein_id="ADK69762.1"
FT                   /translation="MKIVPSIYCANLIDLKTEITNLTKAQINQIHFDVMDGVFVKNYAL
FT                   SNKLVDEIKQQFPNLIIEVHIMGIDLLDKISLFKNADYLTFHYNAINDLNQAKLWINEI
FT                   KKYNLKPGIALDLNNEINDIKKILNEIEVVTFMSIKPGFTGQKFEESSWTKLNLIKELK
FT                   LKYPHLKFQIDGGVRWENIKKLIDCQLDWIVVGSLLFNENDYLKVVSRIKQLETN"
FT   gene            460911..461624
FT                   /locus_tag="MMS_A0438"
FT   CDS_pept        460911..461624
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0438"
FT                   /product="putative lipoprotein"
FT                   /note="ORF contains 1 membrane spanning region in addition
FT                   to the lipoprotein signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69184"
FT                   /protein_id="ADK69184.1"
FT                   /translation="MKKLLTILGSIGLIATSGVAVVACNTSDKTKMPNENKGEEKVDLI
FT                   KVAKQKDLGFISKKDNEIIKKAFIKQNSIDEKKVTVSVKGNGNGVSATGSDNNTTTNTS
FT                   NGNLNDSAVIELKATNNGNETKTVTVIFEVNNNLEKLIQVKKLKGLADNKDDTILKAID
FT                   KLNPKSNLDTSKLSIERKDKKVSIKSSDSTYTGNPVEIEIESKVGVYVGLSLLSVALLA
FT                   SSGFIIYRSLKKKKK"
FT   gene            461914..463827
FT                   /locus_tag="MMS_A0439"
FT   CDS_pept        461914..463827
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0439"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70022"
FT                   /protein_id="ADK70022.1"
FT                   /translation="MVGNVFEKLRANVKMKSDKYSIVVDNFYKKFKDIEIGPFSFNIEK
FT                   GKITALLGSSGSGKSVFINSLLGTSINYQGNIFINQKERKDSDSIQNNSDIGFYSQMDF
FT                   SLYSISAYDFLYNMCYVMGLEQKLVKTRLEYWLKKFDLWEYKDKPLKSFSWGMKNRVNL
FT                   ILCFIKEPRILVCDEPGASLDSHWRNQIYKILDEFRRKSNSTIILTVHNINEVYDIIEN
FT                   FVILEKGKLLFCGTKQELNLYKKTKITFENNILLDEVEKILNQNDILTFNLDSDSNSLV
FT                   IGLKEHQVFSDALNILEKNNFQIKSIASLSINIDAIKKALEDKITKHQPKYQPDINLNS
FT                   NFNQSISFDKTLNNSNVTNQRDSAFEQLEVEILDNNNNNNNNNNNNNNNNNNNNNNNNN
FT                   NNNNNNNNNNNNIQSVNLINNLLQKTFLNMFNEINNLKQQVNQSNLDNYEFFVDELKAQ
FT                   INSVSEIKKDFLDKIDQLNTDQSSVLDLKDFISKQTNKINHTLYKEIKNMNNPCKTKLK
FT                   NHFDSFKSSSPLNDQFDQLKDQISYLKSQIHQNNSNDVNQFLKNEEFNRLKSDILSQKQ
FT                   ELEEFKKELYFEKMLNEKLESFDSKLKQKESILELERLKQEIKDEQNKLREMLLLEKLV
FT                   NN"
FT   gene            463987..464574
FT                   /locus_tag="MMS_A0440"
FT   CDS_pept        463987..464574
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0440"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69407"
FT                   /protein_id="ADK69407.1"
FT                   /translation="MFCILNFSNILISFLIGVLLAFVKTGQNRVIIFNFYILFFTCCLL
FT                   FVLILKMIQFFFNKNLEDKTTYIVLTNQVSRNKFFISQYFLIILILAINVLVSFLLINL
FT                   AYSVFNRFKYDIFILKMTLVYLLYNLFASFCLINFISMLMFLFSLQTTTIICTLLLSLC
FT                   FVANIPMSFVRANEKSYSIKVLTQIITMKILS"
FT   gene            464729..465640
FT                   /locus_tag="MMS_A0441"
FT   CDS_pept        464729..465640
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0441"
FT                   /product="ABC transporter, permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69043"
FT                   /protein_id="ADK69043.1"
FT                   /translation="MWDELGLINHEKIIINEKNLKLFSKPFGNSKVPSSWNRNDLLDLK
FT                   LILKNTFITNNQLKELIKKTTDKNKKNILLDFLNFSIEINNYFENSLQVNNYELLYDFL
FT                   FLDNLKNSNYLTKSNDLKSVKYELNNKDIRNIYEYELLGDAGDGFKFSNSKSLVNKLNF
FT                   NLMYVARILENYFIKYSSNYIILSTSRVLTDQLDWSSYIKTRNKMKYFSYLNLYNGLWV
FT                   FYTSNLGFYYKDIWFTPTSDSFIELENQKNLFLGYLEYDLKLLENNSISKNTTSNYTKP
FT                   QIYLITLIVINVLSFLITFYKF"
FT   gene            465692..465826
FT                   /locus_tag="MMS_A0442"
FT   CDS_pept        465692..465826
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0442"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69559"
FT                   /protein_id="ADK69559.1"
FT                   /translation="MKGLLKLLSLVGLSTVVTSSVVACEKTSDTSSDQDTDNSKSDNN"
FT   gene            466086..468200
FT                   /locus_tag="MMS_A0443"
FT   CDS_pept        466086..468200
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0443"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69173"
FT                   /protein_id="ADK69173.1"
FT                   /translation="MIKHQIKIIVVIKIITLDNKQKNELIQKFNNEVRNVYNGTVRPFI
FT                   ISRTAFLSKDSDDKNFFSRESLYKLDNEKSLKRNSDGYYSFYENLVQERKNEFEKTLRT
FT                   VLDVNSAVNKFKEKILSLGVDKYRTILGGFNNNKWIKGIKFRLTDSKIKFFEEKDSFDS
FT                   TIQVGLDFQYQYKDSADQIKIETISDDFVINISSEEAVIKLVNDIKKSWVDLLLLDSNN
FT                   LLKVDFERLKKFLGENQVLTAQDLLTTATNNYKSVISKYNESLAEDVKEEISRHFIKNS
FT                   ENKVVKNLLLSFKDQNQKTDVEKNNTELNIGSLERSYYNAKGKKTGTLEKGSYDLLHLY
FT                   FGEVKNGQEINLLNTKTGDEKLAKDLINPWVEKMANYKTKFKQTLANIASGFVDEDKLD
FT                   EFNNKLEKDNVLKNLFKSSTSIESFDLKGLQLKLENGYVHDLGNISFSYFVELDKKDKE
FT                   LNFENLENLTSEGYKKSAVFDAYYKGIEVMLDQFHKFYGIQKAYPDYESSEPSYPLKRL
FT                   LFNMTGKPSSLKDSENSDFNIWDEWEKYLSQTENNRVDDWTSFYSLDFNADVKKVKEEY
FT                   LISNMLGIKNFKVFQDQEQQHRYEQEIYYKNESYQRDYEQSKLHVTFPKGIVTEGRRNT
FT                   HLEFGLLTDLLNFKLKVAEGFTYYTLGAVTIIGKLDDQNGNQDSTKPDGEKDKTKPDGS
FT                   TEPKQPENQK"
FT   gene            469134..470657
FT                   /locus_tag="MMS_A0444"
FT   CDS_pept        469134..470657
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0444"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69387"
FT                   /protein_id="ADK69387.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNDRGILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   GMVPNVFINLKPYCWLHLFMFHFISVFKLHHLHSKFKIRTDWKKQNHWA"
FT   gene            470659..470811
FT                   /locus_tag="MMS_A0445"
FT   CDS_pept        470659..470811
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0445"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69280"
FT                   /protein_id="ADK69280.1"
FT                   /translation="MINVIKEVKEIEVFVNKQKIETIQVYNDELQESWQTYQILLELLT
FT                   KEKVT"
FT   gene            complement(470993..471553)
FT                   /gene="ppa"
FT                   /locus_tag="MMS_A0446"
FT   CDS_pept        complement(470993..471553)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ppa"
FT                   /locus_tag="MMS_A0446"
FT                   /product="inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="identified by match to protein family HMM PF00719"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69653"
FT                   /protein_id="ADK69653.1"
FT                   /translation="MKNNVISMVVEIPKGSSNKYEVDEKTKRIKLDRVLYGANFYPGEY
FT                   GMIENTLDWDGDPLDVISLCTYPTLPGVEVNVRILGSIKMVDAGEVDTKLFGVFNDDPR
FT                   FKEYQTLNDVPKHYRDEIENFFLQYKALQNKVVKINGWGTLDEALEELEECKSRFEEYK
FT                   DRLAKGQKDQILAEWKEKGLGQA"
FT   gene            471702..472589
FT                   /locus_tag="MMS_A0447"
FT   CDS_pept        471702..472589
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69886"
FT                   /protein_id="ADK69886.1"
FT                   /translation="MKKNESLKEQLNDVVCNVDNDLDMHKELDSKDHKKIDHYHGKHHF
FT                   DKFGNHDDIQNYNFELRTVFLFSRKKLLFKIVLTGIFLALTASVSAIDILLESIKIPVS
FT                   DQVWIQSRFLDILVVCISIATLGPIFASLLGFLAPILHNFIHGMEHGWIQPPIEAITNV
FT                   FIVWIVFLVFNVIFNNSPIHHDTNKNVARFKRWTPLPIMIVLVSFVSTLGFILALYIDS
FT                   NTNSNHLLSNQISFYHAGHDHDHIHDEHMLSFTNINTFIIIAIFGWNILRYGIALLLFI
FT                   LVEWKMRPINHRYK"
FT   gene            472658..473353
FT                   /locus_tag="MMS_A0448"
FT   CDS_pept        472658..473353
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0448"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69766"
FT                   /protein_id="ADK69766.1"
FT                   /translation="MSKDYTSRNQLFSKEIDLVNQQIKKAKNLGDYSKFINNSLNVLNK
FT                   LDNKYFNKVFNNIYDEFDKGGFYLAKTRINQTINQELLDNIHKQISLLKKISTNELVDL
FT                   KKYSDFIVLDEQKFHFSNLLKMTKDINSYKKATSEKFEKLDVINNDFTNLTKLIINQND
FT                   LNSIKEINEIKQVQITDLIKKTKKENLKKIAELERKKQMYQIKKNWFLIWISIFISVMI
FT                   FSLLLFIVL"
FT   gene            473362..474030
FT                   /gene="cmk"
FT                   /locus_tag="MMS_A0449"
FT   CDS_pept        473362..474030
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="cmk"
FT                   /locus_tag="MMS_A0449"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="identified by match to protein family HMM PF02224;
FT                   match to protein family HMM TIGR00017"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69572"
FT                   /protein_id="ADK69572.1"
FT                   /translation="MEKLIIAVDGTSSSGKSVIFKKVARILNYQFVDTGLMYRAFTWYC
FT                   LFKNIDINNQDQIIKLLDSFDYKISDEQIFVNNINVTNKLISSEILNVINKITIIPQIR
FT                   NYMVKAQQQMVKNKGYILVGRDITSVVLPNADLKIYLDCDIEIRAKRRFEQNVENKILG
FT                   KSFKQIYQDLIKRDQVDKTRKIGPLVLVSDAWYIDNSYLTIDQVVDIVVNKVHQLESQK
FT                   "
FT   gene            474030..475337
FT                   /gene="engA"
FT                   /locus_tag="MMS_A0450"
FT   CDS_pept        474030..475337
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="engA"
FT                   /locus_tag="MMS_A0450"
FT                   /product="ribosome-associated GTPase EngA"
FT                   /note="identified by match to protein family HMM PF00071;
FT                   match to protein family HMM PF01926; match to protein
FT                   family HMM PF08477; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR03594"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69873"
FT                   /protein_id="ADK69873.1"
FT                   /translation="MKKKIVAIIGRPNVGKSSLFNRIIKEKKSIVDNKPGVTRDRIYSN
FT                   AEWLTREFILVDTGGISIDQQLFSNEIQIQTQIAIEQADVIIFVVDFLNRLDKDDKMIA
FT                   KILHKSKKPVILAINKYDKKTIDDHNYEFMNLGFSDLYFISSTHGIGIGDLLDKVISYI
FT                   SKNDVDLKDDSTKIAIIGRPNVGKSSLVNSLVNENRMIVSEIEGTTLDAVDISFSYNKN
FT                   KYTVIDTAGIRKKSKLGQTVEKYSYLRSLSAITNSDIVLLMIDATKPITDQDTNIGGLI
FT                   YDEKKPVIIVVNKWDLVKNKQEQILKKEEEIRAYFKYISYAKIIFISALDKTRVTKILD
FT                   LVADIKQSLSVKVKTYVLNEVLNKAQLINPAPEFNGNRLKIYYASQVQAYIPTFVLFCN
FT                   HPNYLHFSYKRFLENQIRFSFGFDSIPINLIFRERK"
FT   gene            475339..476337
FT                   /locus_tag="MMS_A0451"
FT   CDS_pept        475339..476337
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0451"
FT                   /product="NAD-dependent glycerol-3-phosphate dehydrogenase
FT                   N-terminal domain protein"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF01210;
FT                   match to protein family HMM PF07479"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69158"
FT                   /protein_id="ADK69158.1"
FT                   /translation="MKKNITIIGSNAYSIALANILADNHHNVIIYSENELDVNNINFNH
FT                   SYNISTQLKINNKIVATTDLVASLENVEILILTSLNKQLLSTINQIKKYLKNEIILIST
FT                   IKGFDENNLDLLSNLIINQFSKTNLLKEFVCLYGPNNPSQIILKKPTTAMIISKNLSIC
FT                   KQLVKIFSNEYFLCYSNNDLITSELVVYFKDLINLSLGILEGLGAESNTKASLITIVIN
FT                   LIYQIAKNYNAKLETFFNFATLATLIENILDKNNKYFLLGIDIVKLKNITKALEKNNLT
FT                   IDQIQVVRIAYLLCDKYEIHNEFINTLYRILYNNIRPIALLNHSFKGVWLV"
FT   gene            476369..476641
FT                   /gene="hup"
FT                   /locus_tag="MMS_A0452"
FT   CDS_pept        476369..476641
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="hup"
FT                   /locus_tag="MMS_A0452"
FT                   /product="DNA-binding protein HU"
FT                   /note="identified by match to protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69998"
FT                   /protein_id="ADK69998.1"
FT                   /translation="MTKKELIEEIIINENISKVDAEKVVNRIFQTISKHLIEGKEVSVA
FT                   GFGKFVISERSSREGVNPSTGEKIIIPASRSARFKPAKQLKESLM"
FT   gene            476699..477235
FT                   /locus_tag="MMS_A0453"
FT   CDS_pept        476699..477235
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0453"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69860"
FT                   /protein_id="ADK69860.1"
FT                   /translation="MIFELLEKGIVSKKKLLLEYYKKLNLTDNQALIILMIMYLNDQTR
FT                   KMTTPNLLANYLNLSSVEIENELELLAEKDLIEIKTDFIDFSNLFKKITLLVNDSFLIK
FT                   QYNQFFINFEKNLLFVLTKDEKLKIIKLLQTNIKEEQLLQITNKKKISDFNFLLKEIEK
FT                   YLNSNQLILFDWLND"
FT   gene            477342..477494
FT                   /locus_tag="MMS_A0454"
FT   CDS_pept        477342..477494
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69479"
FT                   /protein_id="ADK69479.1"
FT                   /translation="MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVPTFPSLSIKQ
FT                   ENILM"
FT   gene            complement(477535..478512)
FT                   /locus_tag="MMS_A0455"
FT   CDS_pept        complement(477535..478512)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0455"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69934"
FT                   /protein_id="ADK69934.1"
FT                   /translation="MATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIA
FT                   DKGMSVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKVYINDGGLIYKTRDIASS
FT                   YNKKRINGHFRRQIISFSQKLATKDKNNRDILIQNFTKKMNKDNLVSCDDLAGSKKYRF
FT                   FKHINKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLK
FT                   GKLSLRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIK
FT                   EVKEIEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            complement(478665..479198)
FT                   /locus_tag="MMS_A0456"
FT   CDS_pept        complement(478665..479198)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0456"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69321"
FT                   /protein_id="ADK69321.1"
FT                   /translation="MKKSRNDVKGQWRTSIARVKKGEYLSIGVPRSDNKGFVYRLGYGY
FT                   LHELKQYHDGPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   DKLFDYFNIFNDCSPTKSTTLKGVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEI"
FT   gene            479623..479802
FT                   /locus_tag="MMS_A0457"
FT   CDS_pept        479623..479802
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69941"
FT                   /protein_id="ADK69941.1"
FT                   /translation="MKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEFWKKFH
FT                   TLLTKEKSTRKKQK"
FT   gene            479944..480477
FT                   /locus_tag="MMS_A0458"
FT   CDS_pept        479944..480477
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0458"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69563"
FT                   /protein_id="ADK69563.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   DKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEI"
FT   gene            480630..481607
FT                   /locus_tag="MMS_A0459"
FT   CDS_pept        480630..481607
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0459"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69576"
FT                   /protein_id="ADK69576.1"
FT                   /translation="MATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIA
FT                   DKGMSVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASS
FT                   YNKKRINGHFRRQIISFSQKLATKDKNNRDILIQNFTKKMNKDNLVSCDDLAGSKKYRF
FT                   FKPINKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLK
FT                   GNLSLRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIK
FT                   EVKEIEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            481658..481993
FT                   /locus_tag="MMS_A0460"
FT   CDS_pept        481658..481993
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0460"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69619"
FT                   /protein_id="ADK69619.1"
FT                   /translation="MFSCFMLKLGNVGKTHKKVKIPILLKIAKLPKSSFYEWKHKLENT
FT                   IDKDKELKEMIVDIFSKSFETYGYRRLKMALKSKEYIVNHKKILRLTKELGVQCIKFRT
FT                   KNGRYSS"
FT   gene            482197..482550
FT                   /locus_tag="MMS_A0461"
FT   CDS_pept        482197..482550
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0461"
FT                   /product="transposase InsK for insertion sequence IS150
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69136"
FT                   /protein_id="ADK69136.1"
FT                   /translation="MLDKALKKVKNTNGLLIHSDQGFHYQHISWAKKLEENNITQSMSR
FT                   KGNCLDNAIIENFFGLLKQEIYYGEKYNSVEELTKRIHKYIYWYNNIRIKEKLKGLSPV
FT                   QFRKQSCYNIEKF"
FT   gene            complement(482558..483001)
FT                   /locus_tag="MMS_A0462"
FT   CDS_pept        complement(482558..483001)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0462"
FT                   /product="recombination protein U"
FT                   /note="identified by match to protein family HMM PF03838"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69729"
FT                   /protein_id="ADK69729.1"
FT                   /translation="MHPLKNKGQYLETILNITNQKYLDENLCVVSKIPTNINLININNK
FT                   VITNATFKDNFNCDYIGVYNGLYFEFDAKETSKDEFNFNAIRKNQQQKLNLVSKNKGLA
FT                   FIILYFSKYDDFYIISYNKLIEYIKNNKKTIPRSWITKNPPLP"
FT   gene            483064..483441
FT                   /locus_tag="MMS_A0463"
FT   CDS_pept        483064..483441
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0463"
FT                   /product="DivIVA domain protein"
FT                   /note="identified by match to protein family HMM TIGR03544"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69736"
FT                   /protein_id="ADK69736.1"
FT                   /translation="MKKLSVNQIQNKKFNIAYKGYKIEEVNDFLDEIIKDYVVLENQIA
FT                   SLNEQLDLANQKLTKLSADKQKVENELEQYAKKNWKLVKDNLNDIDLIKRIARIEKNLV
FT                   GYEEKLNKIDEIYKLLISKSR"
FT   gene            483636..485066
FT                   /locus_tag="MMS_A0464"
FT   CDS_pept        483636..485066
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="5' extension through a frameshift mutation could
FT                   form a lipoprotein signal peptide. This ORF contains tandem
FT                   Palindromic Amphipathic Repeat Coding ELements.; identified
FT                   by match to protein family HMM PF03382; match to protein
FT                   family HMM TIGR02167"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69192"
FT                   /protein_id="ADK69192.1"
FT                   /translation="MISTTGFLVVACNNTNNNPVKSEVIINNKQAVIDLWNKEFKNKLD
FT                   SAKNTSLIVEMPKEKLPKKISDSIDLNGSLYENTVEKLTKDENNKLNQKVKILVNKDVI
FT                   GLEVGSVKYGQQSIKYKTKDGKIVEKNKDEWEKMVWKDPSKKRQKQEISDIDEVIQMGY
FT                   YDDEGDNYLKPFNKNIHYVQAFEMPTNISKISALLPREVNSLSKVFNQITSTNVGGIEK
FT                   WDVSRVCRMSFLFDGAKNFNYDISNWDVKILRDANSMFADNAKFNQNLGKWKPYNLAFA
FT                   RKMFARAKVFNQDLSSWQTSHVYNMEQMFDGAEKFNSNLDKWDTSHVQTMKSMFSGAKM
FT                   FNGNISSWNTSKVEDMTSMFRKTGEFNQDISKWKTNSVKKMNYMFSEAKMFNQDISKWD
FT                   VSNVDEMNFMFNKASSFDQNLSEWKVKEKVKHSSFATGSKIESQSSKLPKFKDSSSSTP
FT                   TPTSTPASTPASAKSKMK"
FT   gene            485168..486391
FT                   /locus_tag="MMS_A0465"
FT   CDS_pept        485168..486391
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible TIGR02209: cell division protein FtsL. This
FT                   ORF contains tandem Palindromic Amphipathic Repeat Coding
FT                   ELements.; identified by match to protein family HMM
FT                   PF03382; match to protein family HMM TIGR02167"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70046"
FT                   /protein_id="ADK70046.1"
FT                   /translation="MKKILIFLNSLLVISLTSLVISCYQLDTQTLEMLSTKIKDELNEV
FT                   DLKITNLQKENNSLESQIQELKNIEKISYKFEPFTRLYDKANGYRYKASKINLPIKNQY
FT                   FKTKIQLNKFKNNQQVKVLLNDIQIKENQILNQEKINYQLKQNIEDTKEDLSKFWGYGI
FT                   DPVYNKNQLVKIGYFLTRDFEIQIEKIKPETNQVPDHLPKEITSLKLAFQQNINSKIKG
FT                   IENWKTDNIKNMSEMFEKAKNFNQDISNWNTSNVIKFNSIFNEAEQFNQNLSSWKTNNA
FT                   INMDSMFVDAKNFNNNNQKLVWNTKNVTNMRSMFLGASMFNQDISKWDVSNVTDMSNMF
FT                   FRATSFNQNISNWNVLNVNNMSKMFFNASSFDQDLSKWKVNKNVVFDDFAFRSKIDNDN
FT                   KKLPNFNN"
FT   gene            486478..486821
FT                   /gene="rnpB"
FT                   /locus_tag="MMS_A0466"
FT   ncRNA           486478..486821
FT                   /gene="rnpB"
FT                   /locus_tag="MMS_A0466"
FT                   /product="Bacterial RNase P class B"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            486858..487328
FT                   /locus_tag="MMS_A0467"
FT   CDS_pept        486858..487328
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0467"
FT                   /product="competence/damage-inducible protein CinA
FT                   C-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF02464;
FT                   match to protein family HMM TIGR00199"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69163"
FT                   /protein_id="ADK69163.1"
FT                   /translation="MSLKKIVKLLIKANLTISTCESFTGGLFSNLITNIKNSSKIFYGS
FT                   FVCYQTMFKENILNIDKQVIKKDGVISFECAKEMLIKTYELTKTNIVVSFTGNAGPNSM
FT                   ENKPVGLAYIGVFYNNDIKVFEFKPKFVVSRKFFKKRAIKFIVKKIKQMVLF"
FT   gene            487367..488404
FT                   /gene="recA"
FT                   /locus_tag="MMS_A0468"
FT   CDS_pept        487367..488404
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="recA"
FT                   /locus_tag="MMS_A0468"
FT                   /product="RecA protein"
FT                   /note="identified by match to protein family HMM PF00154;
FT                   match to protein family HMM TIGR02012"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69602"
FT                   /protein_id="ADK69602.1"
FT                   /translation="MSTEIQKIEDNNLKESQMWNSKELKEAIKEIEKMFGKGSIMVLGQ
FT                   SDNLNVETFSSGSLLLDNALGIGGYPKGRIIEIYGPESSGKTTLSLHAICEIQKLGGIA
FT                   AFIDAEHSLDPKYCHNLGIDTNKLLVSQPDNGEQALDILEMLINSNSIDLIIVDSVAAL
FT                   VPKTELEGEMSDQSIGLQARMMSKALRKLNGLIAKSNTTVIFINQLREKIGVIFGNPET
FT                   TTGGKALKFFSSIRLEVRKSENILSNSEIIGNKIKIKIVKNKTAIPFKTATISLLYNKG
FT                   IDKIGELVDLLVSYEIVEKSGVWYSYQNEKIGQGKTSVIQWLNADEKRTNELIQQVKKI
FT                   IEQKE"
FT   gene            488635..490083
FT                   /locus_tag="MMS_A0469"
FT   CDS_pept        488635..490083
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00013;
FT                   match to protein family HMM PF01966; match to protein
FT                   family HMM PF08668; match to protein family HMM TIGR00277;
FT                   match to protein family HMM TIGR03319"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69291"
FT                   /protein_id="ADK69291.1"
FT                   /translation="MYLWKSKSRKRLVEQYTKEAKQAKKQILANGYKEISEAKMLFLKR
FT                   SELEKNELDRVKEQLELRSNDLKRNQEIVESKSQRLDASLLDLEKRKFLLDKKEEYLIK
FT                   ILEDASGLTKSQAKELLIKQVKNKSEKELISILKNAELQAHSSSKMIANNIIISAMERI
FT                   KVELTSQRTTNIVKLPSDDLKGRIIGKDGRNMKAFEQIGGVDIVVDETPNTVVVSSFNP
FT                   IRREIATRTLEQLIIDGRIQPIKIENELKKQEQELEYIIQETGLSTIKELNINDIDIEL
FT                   VKLIGKLKFRTSYGQNVLAHSIEVAKLSGAIASELGLDVEKAIRAGLLHDIGKAIDFEK
FT                   QGSHVVLGAEIAKKYNEDPIIINCIESHHEDKEKESEIAAIVAIADSISASRPGARYNA
FT                   IDEFILRMTEIEKIGNSIPGVAKTYALQSGRQIRLIVNPLVASDLDLAMILEKMKEEIK
FT                   NKVIIPGEITITVIRERKETDVLK"
FT   gene            490113..491456
FT                   /gene="ffh"
FT                   /locus_tag="MMS_A0470"
FT   CDS_pept        490113..491456
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ffh"
FT                   /locus_tag="MMS_A0470"
FT                   /product="signal recognition particle protein"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM PF02978; match to protein family HMM TIGR00959"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69283"
FT                   /protein_id="ADK69283.1"
FT                   /translation="MGFGDFLSKRMQKSIEKNMKNSTLNEENIKETLKEIRLSLLEADV
FT                   NIEATKEIINNVKQKALGGYIFEGANAHQQMIKIVHEELVNILGKENAPLELNKKPSVV
FT                   MMVGLQGSGKTTTANKLAYLLNKKNKKKVLLVGLDIYRPGAIEQLIQLGQKTNIQVFEK
FT                   GKQDPILTAQEALEYAQENNFDVVILDTAGRLQVDQVLMTELDNLKKKTSPSEILLVVD
FT                   GMSGQEIINVTNEFNSKLKLSGVVVTKLDGDARGGATLSISYLTKLPIKFIGEGEGYNA
FT                   LAAFYPKRMADRLMGMGDIETLFEKAVENIDERSIQKTMNRMFLGQFDLEDLRNQLAQI
FT                   AKMGSLNKLMKMLPINKVSETQIQDAQRKLAVFSILMDSMTLKERRDPRVLKAISRKNR
FT                   IIKGSGRTEKEFNELINSFEKGKKQVLEITKMIKSGRMPNLSKGGFKF"
FT   gene            491462..491929
FT                   /locus_tag="MMS_A0471"
FT   CDS_pept        491462..491929
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0471"
FT                   /product="putative rRNA large subunit m3Psi
FT                   methyltransferase RlmH"
FT                   /note="identified by match to protein family HMM PF02590"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69748"
FT                   /protein_id="ADK69748.1"
FT                   /translation="MKIKILCFGKLDKKFYIDAFNDYFKRLKKYVDLEIIELKEEVNGE
FT                   LNKIKDENSNLLLKKLQNYKDFEKVVLDVNSRLISTENLVEIIKTNLNYKSAKILFIIG
FT                   PSDGYSKSFLNSFTNKFSLAKITLPHQLCRIVLIEQIYRVFKIINNEKYHK"
FT   gene            492019..492345
FT                   /gene="rpsP"
FT                   /locus_tag="MMS_A0472"
FT   CDS_pept        492019..492345
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsP"
FT                   /locus_tag="MMS_A0472"
FT                   /product="ribosomal protein S16"
FT                   /note="identified by match to protein family HMM PF00886;
FT                   match to protein family HMM TIGR00002"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70034"
FT                   /protein_id="ADK70034.1"
FT                   /translation="MVKLRLKRIGKKQAPFYRIVVADSRVNRNGQYIELVGTFNPLKDE
FT                   VKIDNELTLKWLNNGAQPTDTVRSLLSKQGILKALHESKFSKNTQTENKKPVSKKTTKK
FT                   SKDN"
FT   gene            492363..492851
FT                   /gene="rimM"
FT                   /locus_tag="MMS_A0473"
FT   CDS_pept        492363..492851
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rimM"
FT                   /locus_tag="MMS_A0473"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="identified by match to protein family HMM PF01782;
FT                   match to protein family HMM TIGR02273"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69550"
FT                   /protein_id="ADK69550.1"
FT                   /translation="MNANLIKIGVIVNTFSIKGQVKVILNSDIVIDDLNKINTFFIETN
FT                   DNFQVLRIQEINLNKNYLIVKFLNLNNINDVIKFKNKEIYCLKNQNITQLVSLINFKFT
FT                   SFKTNGIIIDYMNNSYQQLIKVKSEDLKEFWVPLVDVFIKEIDYENQIIIAKNVEGLK"
FT   gene            492853..493575
FT                   /gene="trmD"
FT                   /locus_tag="MMS_A0474"
FT   CDS_pept        492853..493575
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trmD"
FT                   /locus_tag="MMS_A0474"
FT                   /product="tRNA (guanine-N(1)-)-methyltransferase"
FT                   /note="identified by match to protein family HMM PF01746;
FT                   match to protein family HMM TIGR00088"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69538"
FT                   /protein_id="ADK69538.1"
FT                   /translation="MKFSIITLFPKIINSYIEESIIKRAINKQAIKIEIIDLRNFSTLS
FT                   HNQVDDYQYGGGSGMVLMIEPLIKAIESVKTTKSIVLLTTPQGKTLNQSIVKTYANNYE
FT                   HIIIVCGHYEGYDERVLDYIDDEISIGDYVITGGELASLILVDSISRLLPNVIKQESHE
FT                   NESFENNLLDHPVYTKPYEFRNKKVPDVLLSGHHQNIKKWREEQQVIKTLKKRPDLIDI
FT                   TKLNRHQLEIYKKMKGEQ"
FT   gene            493577..493969
FT                   /gene="rplS"
FT                   /locus_tag="MMS_A0475"
FT   CDS_pept        493577..493969
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplS"
FT                   /locus_tag="MMS_A0475"
FT                   /product="ribosomal protein L19"
FT                   /note="identified by match to protein family HMM PF01245;
FT                   match to protein family HMM TIGR01024"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70065"
FT                   /protein_id="ADK70065.1"
FT                   /translation="MSSKATKTVKSKFDIINNQLRDDLIDFRSGDTIRVDVKIKEGDKF
FT                   RIQSFEGLVIKTQGSGITYSVVVRKMSNGVFVERTFPLHSPIIDSVTLIKRGKVRRSRI
FT                   YYIRKLSGKAARIKEIMPTKQAKEIK"
FT   gene            494061..495011
FT                   /gene="ylqF"
FT                   /locus_tag="MMS_A0476"
FT   CDS_pept        494061..495011
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ylqF"
FT                   /locus_tag="MMS_A0476"
FT                   /product="ribosome biogenesis GTP-binding protein YlqF"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR03596"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69731"
FT                   /protein_id="ADK69731.1"
FT                   /translation="MSAEFNWFPGHMNKTLKDIEARIEIVDVVVEVIDSRAPYSSKNAT
FT                   FKKLLKDKPIVYIFSKADIADSKVTQQWVDYYIKNENSKVIVLYNRHTDIVNELINVIN
FT                   ELTIKKREKDKAKGIKNTLINALVIGIPNVGKSTFINRVIKGKNVKVGNKPGVTRGIQL
FT                   IHLNPFINLLDTPGVLPSKLESETVAVNICAINSIKDNVFPKERVAAKLMSYIYNNYDD
FT                   IIEKYYKINLRLQKPISVIDSYKIFETIGIEKKWYVTEDILDMERILSSFLKDLDKGKL
FT                   GKISFEKVLEVVPEEIQKAINPEDNKQDNDISSLW"
FT   gene            495005..495628
FT                   /gene="rnhB"
FT                   /locus_tag="MMS_A0477"
FT   CDS_pept        495005..495628
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rnhB"
FT                   /locus_tag="MMS_A0477"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF01351"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69937"
FT                   /protein_id="ADK69937.1"
FT                   /translation="MISRKSFDDQIKIVHNITYLSGSDEAGRGCLAGPLVVASVILKPD
FT                   YFNPLIKDSKKLNPKTRQVLYDEIIKNCLDYQIIIISSKQVDELNPLQASLLGFKTTIN
FT                   NLKITPDLALIDGNQNIELTNIKTLQIIKGDDKSFSIACSSILAKVTRDKILDEYDQIY
FT                   PNYDFKSHKGYCTKKHLLAIQKYGILDIHRKSYKPIKKISKETS"
FT   gene            complement(495651..495965)
FT                   /locus_tag="MMS_A0478"
FT   CDS_pept        complement(495651..495965)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69325"
FT                   /protein_id="ADK69325.1"
FT                   /translation="MLLRVLSNTVWIHLLFIVPRVFKSCFLSSSNCFLSSYNEIPKYRP
FT                   VYIHCRTSRSSYKSIKMLEKLGFNNLINIQDSFLQLSYYEYFNDRTTNRKKILTDYNFE
FT                   "
FT   gene            complement(496139..497200)
FT                   /locus_tag="MMS_A0479"
FT   CDS_pept        complement(496139..497200)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="This ORF contains tandem Palindromic Amphipathic
FT                   Repeat Coding ELements.; identified by match to protein
FT                   family HMM PF03382; match to protein family HMM TIGR02167"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70047"
FT                   /protein_id="ADK70047.1"
FT                   /translation="MKKLLISFSSLILLSGVAATVVSCANIEMSKNKKDKDKDLKSDKN
FT                   KDQNNKFDKSKDKNQNSKPNNNDQNSKSNQDKTSPKDNPSTQSESEKQENSKQYDLDKL
FT                   ITNKFISIDGSGTGDGKLAKLPQNLQEYLDLIKKQNPKFTLTLNNVSFNVEENDNSGYK
FT                   KVSVSTKGNSKNPVIVYFYKDRHDTVYEGEKKEVVKEIGWSKSRYGTDILHFDEQTKEV
FT                   PENLPPFITSLEGAFRNNIQETIKNLDKWDTSNIEFMNETFYEAKNFNQDISGWKTNNV
FT                   SNMDSMFYGASSFDRNLSGWNVDKVITYIEFNKDSKISERNKPKFKELKRIHQGQGATK
FT                   ILHNRGFLNKMNL"
FT   gene            complement(497298..497558)
FT                   /locus_tag="MMS_A0480"
FT   CDS_pept        complement(497298..497558)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0480"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69994"
FT                   /protein_id="ADK69994.1"
FT                   /translation="MFDTIELTKERVETNFGWFMNAYKYGAPYHSGIAWGLDRIAMILT
FT                   NAQSIRDVIAFPKNSSGIDPMSNAPDLVDQKQLDELHIKTN"
FT   gene            complement(497537..497839)
FT                   /locus_tag="MMS_A0481"
FT   CDS_pept        complement(497537..497839)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0481"
FT                   /product="aspartate--tRNA ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69118"
FT                   /protein_id="ADK69118.1"
FT                   /translation="MGSIRVELAKMFNLAYPNEFKLLWVVDFPLFEYSEKEQRYLAAHH
FT                   PFTMTKPESLDTFDVNKKDAIAYAYDLVMNGFEIGGIVKELLILKFNKECLIQLN"
FT   gene            complement(497839..498078)
FT                   /locus_tag="MMS_A0482"
FT   CDS_pept        complement(497839..498078)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0482"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69654"
FT                   /protein_id="ADK69654.1"
FT                   /translation="MVVAIDELLTKKQLEVLIEQAKEFQYQSLGFIKFENSNWTGSLAS
FT                   QLSDQEKEQLIKRFNIKSKATILINFGKYEKFLN"
FT   gene            498476..498781
FT                   /locus_tag="MMS_A0483"
FT   CDS_pept        498476..498781
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0483"
FT                   /product="single-strand binding family protein"
FT                   /note="identified by match to protein family HMM PF00436"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69263"
FT                   /protein_id="ADK69263.1"
FT                   /translation="MNLVNIIGQLEGDATVTYTSKDGEKKLYKFVVKVPKPYKSKEVDS
FT                   LDYINIKAWSNAVDDEFLLHDQAVVGIEGRIQSFTSNNDLTNIRNEIFANRILYLN"
FT   gene            499000..500871
FT                   /locus_tag="MMS_A0484"
FT   CDS_pept        499000..500871
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0484"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69928"
FT                   /protein_id="ADK69928.1"
FT                   /translation="MKVKNNFDHFYKPMTDEELKKDRKSFNRGRKSFINVIWKHMKINK
FT                   KWAIGLLVTAILSAFFAAFNPLLMQQLQFSVEFEKTKKVFDNFWGFNWKIILSIWIIIL
FT                   VITAILTYIANLFGNELGRKIEISLRNELTKKLITTDIEYYSNKKTGEILTKVVSDTQI
FT                   IGMQASVIPNIIFIAFFTMIFTLITLFITTSLYIGLFFIALFLMFGILFGLDFLPMRKL
FT                   VFNLRKIITDINGDVTDRINTIKLIKANGTEEYEKKRFVDIHEIYYKKYKQISYFQSVM
FT                   ISILFFAINTVQILMTIIALWLYKNDIDTLKAILGPMLICAGMLIGPVMQLLRAVVGMV
FT                   QASTSAQRIDEITAAKQLINNHALDKKGIRIHKIEGNVIFKNVTFAYSDKPDNVILPNF
FT                   NLVLEQGKSYAFVGQTGVGKSTISKLLLRFYDPSSGEVLINNNINLKDVFLPSYLNHIG
FT                   YVEQDPSVLLGTVLDNLRYVKPSATDEEIILACKKAELHDLVMTWPDQYNTILGERGFI
FT                   LSGGQKQRLVIARMFLKDPQILILDEATSALDNVVEKEIQSKLEELMKNRTSITIAHRL
FT                   STIRNVDQIIVLAPKKGIIQIGTFKELVKKPGEFKDLYEAGFSKYDV"
FT   gene            500889..502742
FT                   /locus_tag="MMS_A0485"
FT   CDS_pept        500889..502742
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0485"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69482"
FT                   /protein_id="ADK69482.1"
FT                   /translation="MSKVKKVYTKIKKKWSFDNTGKFTLKKFGLFIRMNIEIAKKNPLL
FT                   FFGVVFFTSLDAIFAAMLPLFSSKVITTLVQNNKQWLFNWMELDSTGWLYAIAINLAII
FT                   IICEYFTNFTIALYSAQIEVMQRLKILKALTDQDVDFYFDHVSGNILTRLVGDTQFLAL
FT                   GVQQFLTNLIYAFSGSITAITIMYTQNLYMIATLSLVYLLIANLFCVGFFIDMRRKLIL
FT                   AFDIKRETDADMTDRINNISLIKASGTEEFEIKRLEEKNKDYENGLTKFTHSSALLNTS
FT                   LTFVIQLLIPIIFIIIAVQYLSNNQSSNSLGADIALIFPLLSTLIGGIAILLPSLRSAT
FT                   AASNAANRISELTDPKPMVHSNLKGYKIDKIDKIVLDNISFSYPKKPERIVIPPTKLIF
FT                   EKGKSYAFVGQTGSGKTTIAKLLLRFYVPTDGKILINGEYNLNRINLPAYLNHIGYVEQ
FT                   EPQILYGTFLDNIKYSKFDATDEEVIQACKKAELHDFIMSLPDQYHTVLGQRGFILSGG
FT                   QKQRLVIARVFLKDPDVVILDEATSALDNVVEKEIQDKLEELIKGRMCITIAHRLTTIK
FT                   NVDEIYVLGPNGVGIVQMGTFDQLKKQPGHFRNLYEAGLME"
FT   gene            502782..504389
FT                   /locus_tag="MMS_A0486"
FT   CDS_pept        502782..504389
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0486"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69933"
FT                   /protein_id="ADK69933.1"
FT                   /translation="MPEQETIFWVYFHDIVKKIKTDKFKKVDLLLRKKINEIFEVTHYG
FT                   LFQYQILKDKSLTNIDDSSVSEISNYITNNYSRFFEYLNYNNSKTSMYSSKLSKIEIDE
FT                   ISFIIENIALKYIADNLLLINNNNYNNDFLNLLLIELSKMYRFDTNFLARNNDKIVYHS
FT                   LVYPLFLTMLIIDITNENQMFNNIKKIYTKQNILNALKVGRPLSSNEYNYFKSHIDILE
FT                   YDEEWNTFLLNFKNENWVLHSIEKKYKLIFQLAKYTALFLKDRIKSVWALSDGEEIFDS
FT                   FYNYIILFLTNKPTGQTSTIYLTAKPDFINKNYDEDDKFLLPFLIKDYNPIQIGHHISS
FT                   LKDYSKFVCDKDRIIDFLDAVLLSTNYISLIDILKVDSNYLADFLIQRKKLALVDTLFL
FT                   YKLDDHNMYKKQYNSISLEDIQINQNVLKEIIKKDFRLEFLKTNNQLANMLKTISLILS
FT                   LVPSIAKRFNYSWELILKYFIITFGPYKRKKALYDKKTINEVSYKISKLLSNFKHVKNK
FT                   EDYSQTLLIIYKLENFKN"
FT   gene            504445..504521
FT                   /locus_tag="MMS_A0487"
FT   tRNA            504445..504521
FT                   /locus_tag="MMS_A0487"
FT                   /product="tRNA-Arg"
FT   gene            504577..505329
FT                   /locus_tag="MMS_A0488"
FT   CDS_pept        504577..505329
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0488"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69573"
FT                   /protein_id="ADK69573.1"
FT                   /translation="MANYYDQILKKIKQLVEKNNLTKALDIINQELELSYIPSDFEKSL
FT                   YKIKKEIKEKQYSQLNKTYSILEIKTLLNSKNNLDQIIGIKNLININIRLVLDEIKKYL
FT                   ININNAYENKSLLLISLSDQQIDQDFEVFKDKKTSFLINPKSLNIKEIYNIYYQIESQI
FT                   LEVIDQKDIFLIQTCKQVLFSYFLYIFPYVELLKTNDVIVAIIYLSFQLNNLKFDIKKL
FT                   NKNIEFNQVNVDKIIIDIKKSGVFNYES"
FT   gene            505319..505630
FT                   /locus_tag="MMS_A0489"
FT   CDS_pept        505319..505630
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69803"
FT                   /protein_id="ADK69803.1"
FT                   /translation="MKVNFDSKNYKYFRDYNFFMVKFFNITCSLCDNYEISFVINSSPT
FT                   PIGTILKKETKKLSEKEVEQLVKQQIDIWENLEKDNFKNNIPTFLCDECWNTLTNQSN"
FT   gene            505701..507002
FT                   /gene="cgtA"
FT                   /locus_tag="MMS_A0490"
FT   CDS_pept        505701..507002
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="cgtA"
FT                   /locus_tag="MMS_A0490"
FT                   /product="Obg family GTPase CgtA"
FT                   /note="identified by match to protein family HMM PF01018;
FT                   match to protein family HMM PF01926; match to protein
FT                   family HMM PF09269; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR02729; match to protein
FT                   family HMM TIGR03595"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69189"
FT                   /protein_id="ADK69189.1"
FT                   /translation="MKFVDSADLIIKAGKGGDGAVSFLHALFVPNGGPNGGDGGDGGSV
FT                   YFQGDEGKHSLLDLKLQKKYSAQDGFKGDIKNMHGAKGEDKIIKVPVGTILYDKKTNNI
FT                   LADINENNKLVLIAKGGKGGKGNARFANSRNKAPTIFEAGELGQEFEIRAELKVLADVG
FT                   FVGLPNAGKSTLLRAISNSKPVVADYPFTTITPQLGVARTKNNDTFIVADLPGLIQGAS
FT                   LGKGLGHQFLKHIERCLVICHIIDASGNFGSEDIIKNYELIRNELKTYNLNLEKRAEII
FT                   VLNKMDLDEAQLNLLDEKIINYFKNKKVIQISGLKKENIDQLLFMIYEELKVAKKQSLW
FT                   ELDKNNNQDEMVIYKFEEQKEDIQAYNKGNNRWEIAGETIFKIYQKFPIWTEDNLLMFN
FT                   EKLKETGVYETLVKKGIKKGDFVKVFDYELEWTD"
FT   gene            507004..507741
FT                   /gene="nadE"
FT                   /locus_tag="MMS_A0491"
FT   CDS_pept        507004..507741
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="nadE"
FT                   /locus_tag="MMS_A0491"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="identified by match to protein family HMM PF02540;
FT                   match to protein family HMM PF06508; match to protein
FT                   family HMM TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69997"
FT                   /protein_id="ADK69997.1"
FT                   /translation="MQTNLKQYLDYLVEFIQQTVKKAKCNGVVVGISGGIDSAVVANLA
FT                   KRAFPDNYLTVWMPIYSSQLDYDCANELIKTNHLKNIEVNLETSFDAFKNSFSNLDEKP
FT                   SLLAISNAKARLRMTTLYTIGQTKKYLVLGTDNLDEWHIGYFTKYGDGGVDVVPIIHLL
FT                   KSEVKKAAKILNVPELIINRKPTAGLWEGQTDEGEIGFSYDLIDSYLLKQNNDPKLKKR
FT                   IDYLHKISKHKRSLAIKPKKIQR"
FT   gene            507759..508004
FT                   /locus_tag="MMS_A0492"
FT   CDS_pept        507759..508004
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69514"
FT                   /protein_id="ADK69514.1"
FT                   /translation="MFWQLSKYHFKPIEVFGIAIPFRIFILVFAIIAILSLLIFILTYF
FT                   IQKKKNINQTKQQDIQEIIDQEINLIIKKEKEKQQN"
FT   gene            508022..509125
FT                   /gene="nadD"
FT                   /locus_tag="MMS_A0493"
FT   CDS_pept        508022..509125
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="nadD"
FT                   /locus_tag="MMS_A0493"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM PF01966; match to protein
FT                   family HMM TIGR00125; match to protein family HMM
FT                   TIGR00482; match to protein family HMM TIGR00488"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69063"
FT                   /protein_id="ADK69063.1"
FT                   /translation="MSKKIALFGGSFDPIHTDHVNIIRTCYEKLNFDEVWLIPTYLNPF
FT                   KTKQNSSIKDRLNMLDIIKNKFDYVKIYNYEIKNQKSTPTYQTVKHILKTNKNDSFSFI
FT                   MGSDQLDRFEEWNNFNELIQIIDFKIFKRNENYNKTILNKYHLELFEFENNHLSSTDIR
FT                   NLKHLDKQIKDINDYVNYNLMYLYERMETKMDFERYNHCLNVGKMAYELAIKWNVDPKK
FT                   ALIAGTLHDITKRWSKEKALSYLKTYLPQLINEPYPVWHSYTAYLHLLYDWLIDDQEIL
FT                   SAVFNHTVGSEKMTKLDIIVFCADKISIERNYENVEQLRELCFTDLMTGFKVLLKNQYD
FT                   LAIKKHGKENIGSMLIKTVEHFLKYKK"
FT   gene            509127..509783
FT                   /gene="mtnN"
FT                   /locus_tag="MMS_A0494"
FT   CDS_pept        509127..509783
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="mtnN"
FT                   /locus_tag="MMS_A0494"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="identified by match to protein family HMM PF01048;
FT                   match to protein family HMM TIGR01704"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69636"
FT                   /protein_id="ADK69636.1"
FT                   /translation="MKLIISAMYEELEYSLKKTGAKLIIDNDILKLYQYQDILLCISGI
FT                   GLVNASCSLSYLLNNYQIDQILNIGTCGSLNKNFKQNDIILVNKAYYFSVDVTGFNYSY
FT                   GQIPKLPKYFLATKLKLSLDYKTANIASGDVFINKQEHLKQFINKLNQKIDLVDMEACS
FT                   LFHTAFLYKKPISSVKVVSDIMFLNDSNMIQFDKFINQASITIFEILNDLYFKFK"
FT   gene            509805..510449
FT                   /locus_tag="MMS_A0495"
FT   CDS_pept        509805..510449
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69457"
FT                   /protein_id="ADK69457.1"
FT                   /translation="MRIAIFGTTGAGKTTLLENLKKLLDKKYVFVNETSLDCPYFNKAY
FT                   DDSNSDVQDYNYKLDLWMLTDRMKTFIKYKNHQNVIYDRSILDSMVFSQTDHIYNRLDD
FT                   RDYNVFKDYFLTCILPNIFDCQTNNKIFDIVIYLKVDPYKAIKRINKRSRDIELDTNDL
FT                   FWLNLTKVYEFWYDIYKEVIPFWVIDANVDEPNYIANMIANKIKEIDNKID"
FT   gene            511765..512418
FT                   /locus_tag="MMS_A0496"
FT   CDS_pept        511765..512418
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0496"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69315"
FT                   /protein_id="ADK69315.1"
FT                   /translation="MGENTKNDSDKINTEKTLDNDRMNNQSDQPREESTPRNNDSKENV
FT                   WSRGIKKRILESLNSTNLDYLKTLSNSLIQEKEKTLISNNIDKKTLEYKTKLTKFSSEL
FT                   KFDEIKKELISSLEESIKKNKNNQHQHKLLLHQFKDRQLEKQHISEITKLIIDIYRSNL
FT                   LNELYKELDEKIQKENREFEEIFKRKNKNEIKNKLFDLVDKIVDLQEALKNMSV"
FT   gene            512515..513642
FT                   /gene="trmU"
FT                   /locus_tag="MMS_A0497"
FT   CDS_pept        512515..513642
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trmU"
FT                   /locus_tag="MMS_A0497"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="identified by match to protein family HMM PF03054;
FT                   match to protein family HMM TIGR00420"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69188"
FT                   /protein_id="ADK69188.1"
FT                   /translation="MKQKVIVGLSGGVDSSVACYLLLEQGYEVEGLFMRNWDSATNNDI
FT                   LGNRNINDDICPQEQDYLDAKAVADKLNIKLYRVDFIKEYWDYVFSYFIEEYKKARTPN
FT                   PDILCNKYIKFDKFLNYAINQLNADYIAMGHYAKVEFNKTTNQYELIKASDTNKDQTYF
FT                   LSQLNQKQLSKTLFPLANLTKEQVRKIALKQNLITANKKDSTGICFIGERSFTNFLQNY
FT                   IPNQTGDIVDIKTNKVLGQHIGVMYYTIGQRKGINLSGMSEPYYVADKDVKKNILYVCS
FT                   TSDQSYLHSTSCLVNDINWILDISKYVDDINQFECQAKFRYRQIDNKVVVKKIDDNNYQ
FT                   VIFKKPLKAITIGQQAVFYLNDICLGGAVIDKVIK"
FT   gene            513684..514301
FT                   /locus_tag="MMS_A0498"
FT   CDS_pept        513684..514301
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0498"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69801"
FT                   /protein_id="ADK69801.1"
FT                   /translation="METSTILMIVLLVFVVGFVIWSTITGKKANKKEKEKRYNQVRSKI
FT                   KEYILKNEHKKNLRIEFEKVYARKGAEYKYRDVFDVIVQLIEPKTQKIIETRAYEVEGL
FT                   TTKINKSQYNTEWIVNSQIDLEETKRRIAIGEKTIKLTKAEKQKLKEVEKMQAKKLAQQ
FT                   EKEQLKKAKEKQKSQKGSLDIYQERKLNISNKKFVPSRAKSN"
FT   gene            514379..516523
FT                   /locus_tag="MMS_A0499"
FT   CDS_pept        514379..516523
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0499"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70088"
FT                   /protein_id="ADK70088.1"
FT                   /translation="MNSIFKINISKEIFKIANLKCIKIAWILHNINNFKKAVEWNKNKE
FT                   FFFNIDHDLESEDDFSSDATSINLFEEYTNTELKTEQEKNEFKQKWENFFNSDDGFNLD
FT                   EFKGDAIEDGLEFGQQVIQYFDLKQIKEYPDKLTKDFNDTANIIDAVNQTRELLKNHQD
FT                   QYIYLYEPAFEYDNFNLKVKCDVLKLNGNNHVEIIEAKATSKVKKEHFWDLVYQAYVLE
FT                   RNGYIVDNIAIARLNKNYLRDYDNNVDFDLKISIEEFVSQYKDISFNQAKRIVDNIDDL
FT                   DLGFKNIEEIDDLDLNKLIEIDYFTYGQAKTRNTLFEDYKNLINVVDLDELFLKIAYML
FT                   RYDENQIIEIFKNDSCYLHYDKKTKNWIKWTREISDYKACQHVLNWFDEKAPNFWHFGG
FT                   ARQTQKAFLIRHLHSPYFKDYNSLLDIEITNLLNDQYDKFINYKYNRIFEISKLDDQIK
FT                   SDPSLMIDNNYFYILKQVMNKYKRLPIYMYDFETVKFAVPKYSKVNPYYQIPFQYSIDI
FT                   IHDKNYDYNNPDSMIHYDFLANDYQDPRKEFIINFLKDIFSNKGGVYVAYNDAFEKSVL
FT                   KRIAFLFPKLAIPILYIVNNTIDLMDFFKGVKQDNSIDANFRPWFLIANKNFYGSYSIK
FT                   KTQPALDSSFTYKNLTINNGSKASETFRRFLEQRIGKTVWDNLIRKDMIKYCNRDTLAM
FT                   VVILKKVDQIIKIWEAKHAK"
FT   gene            516513..517466
FT                   /gene="fmt"
FT                   /locus_tag="MMS_A0500"
FT   CDS_pept        516513..517466
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="fmt"
FT                   /locus_tag="MMS_A0500"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF02911; match to protein
FT                   family HMM TIGR00460"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69702"
FT                   /protein_id="ADK69702.1"
FT                   /translation="MQNKIKVVFCGTPKIGADVLKALIEMNQVEIVLVISQPDKPIGRK
FT                   KQIVHTPVKKLALENNLKVVQPNKIGEIYDDLAKLEFDFLITCAFGQFIPTKILKLAKI
FT                   DSINFHGSLLPKLRGGAPIQYAIKNGDKKTGITIMQMVKQMDAGDYYVQESIDILDSDD
FT                   SGSLFEKMGHLAYSMCKKYLVDIYNHKFELIKQNEDEVTFCKNISSEEEKINWNNTSLD
FT                   IFNLIRSLSPSPISYTTINNQRYKIKSSKVIDLDNQNKNAIPGTILGINKQGIVVKTLD
FT                   KALLILEIQKEGKKMILASNYYLNKLSDLKINDKFD"
FT   gene            517553..518107
FT                   /gene="efp"
FT                   /locus_tag="MMS_A0501"
FT   CDS_pept        517553..518107
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="efp"
FT                   /locus_tag="MMS_A0501"
FT                   /product="translation elongation factor P"
FT                   /note="identified by match to protein family HMM PF01132;
FT                   match to protein family HMM PF08207; match to protein
FT                   family HMM PF09285; match to protein family HMM TIGR00038"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69770"
FT                   /protein_id="ADK69770.1"
FT                   /translation="MSVNDLRPGTTFLYDGNIYLVLEQAFSKTGRQQGKVTVKAKNMRT
FT                   GARVELTFTGGEKVDKAMIERKEMQYLYNDGNDAYLMNTETYEQVSIPMTRLEWEKNFL
FT                   VDGLMINMTEFENEVLGIDLPVKVELTVVEAEAAVKGDTTSGAQKKAILETGLEIMVPL
FT                   FVNQGTKIIVSSADGKYVGRA"
FT   gene            518125..518427
FT                   /locus_tag="MMS_A0502"
FT   CDS_pept        518125..518427
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69249"
FT                   /protein_id="ADK69249.1"
FT                   /translation="MYIDIEKNSKGNLKIESKVINRLVENVILSMTKISDPKNVSSSIY
FT                   VLDENQLHILATIKIGDEKLQDLNINEDKIFKAIDKTINQTISMKPKNINISYIR"
FT   gene            518444..519730
FT                   /gene="tig"
FT                   /locus_tag="MMS_A0503"
FT   CDS_pept        518444..519730
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tig"
FT                   /locus_tag="MMS_A0503"
FT                   /product="trigger factor"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254;
FT                   match to protein family HMM PF05697; match to protein
FT                   family HMM PF05698; match to protein family HMM TIGR00115"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69621"
FT                   /protein_id="ADK69621.1"
FT                   /translation="MIFAQEKFVDQGQGKWTVTIQDDQWTEFLKKAKNRLKTNLVVPGF
FT                   RKGKAPESETAKYLTPIKIYNEAFKIVVKPAFDFALSQENKIQNDNSPTPVIVKVSDKE
FT                   IVIDFIFDLVLELKVGEYKNITTVKKPVVEVNQEDVDNVIDMYRSRFAMQKEKQADDQI
FT                   QKGDIVTFDFKGYVDDQAFEGGEAKDFVLEIGSNQFVPGFEDSMIGLKVGENQEINVKF
FT                   PEEYIPSLAGKDAKFVLNIKNIKEKILPAKDDELVKDLNLPDITTYEQLEQKVKEDVLE
FT                   QKTKISKSEFVENIIDEIIKTSEFQIPKTIIERQIKDVKKEFEDQLAQQKITLDKYKEI
FT                   TKITQEEIDEELKSDAIHRIKSFLVASEIKNKENIVASEEAINAKFEEFANLYGIEADK
FT                   IKSLIDNQAIKHQVESELLETFIFENNGN"
FT   gene            519853..522204
FT                   /gene="lon"
FT                   /locus_tag="MMS_A0504"
FT   CDS_pept        519853..522204
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="lon"
FT                   /locus_tag="MMS_A0504"
FT                   /product="endopeptidase La"
FT                   /EC_number="3.4.21.53"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF05362; match to protein
FT                   family HMM PF07728; match to protein family HMM TIGR00763"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69133"
FT                   /protein_id="ADK69133.1"
FT                   /translation="MKTIKLPVVVTRGIFILPSTSKTIEFGRVKSKNALDASADLYNNQ
FT                   IVVVSQESPLEEEPNLEHLFYLGTVADLSVKKVWKDGTISVELNYNQKIKIDEFVEEDN
FT                   IIYAIGSVFEDKLPKTDAQKTKIKEALEELQEKHSFNTSELLLVFNENDFNKLNSLIYQ
FT                   IIDKMPLVSLNTKLLLIQSTSILEKLELLKELIINRPKSTIKLNNNLNNNSTVDSEINK
FT                   KLKDKMDKQQKEYYLREKMRIIKEELDDENSDASQLDKYKKRLEEEPFPESVKEKILSS
FT                   IKRIETMQPGSAEVNVERNYVDWMMSIPWWEQSEDIDDLKYAQEILEKHHFGLKKVKER
FT                   IIEYLAVKQKTKSLKGPIITFVGPPGVGKTSLARSIAEALGKKFVKVSLGGVKDESEIR
FT                   GHRKTYVGSMPGRIIQALKRAKVKNPLFLLDEIDKMASDNRGDPASAMLEVLDPEQNKE
FT                   FSDHYIEEPYDLSTVMFIATANYIENIPEALYDRMEIINLSSYTEIEKMHIAKDYLTKK
FT                   ILEEDQLTEDELRFTDEAYDEIIKYYTREAGVRQLERHLATIARKFIVKLLNGEITNLV
FT                   VTREVVVQYLGKHIFEHTSKEEESQVGVVTGLAYTQFGGDILPIEVSTYNGKGNLTLTG
FT                   KLGEVMKESATIALTYVKANHEKFGISKDKFDDIDIHIHVPEGAVPKDGPSAGITLTTA
FT                   LISALSKQPVSKDFGMTGEITLRGNVLPIGGLREKSISAARSGLKHILIPSKNVKDIED
FT                   VPQEVQDVLKITPVSKYEDVYEIIFKNNNQ"
FT   gene            522321..523556
FT                   /locus_tag="MMS_A0505"
FT   CDS_pept        522321..523556
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0505"
FT                   /product="recombination factor protein RarA"
FT                   /note="identified by match to protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69459"
FT                   /protein_id="ADK69459.1"
FT                   /translation="MNQPLSFLLRPKTTKDIIGQTEILKPKGLINKMILNNYCTSLIFY
FT                   GPSGVGKTSFAISLANDLKIDYEIFNASYDKKEKLTNIIQTALKQKRFILIIDEIHRLN
FT                   KDKQDILLEYMEKGNIFVFSTTTENPFFVINPALRSRSLLIELKPVNKEELISYAKKVI
FT                   NQYQLKINISDEALDFLAQISVGDIRTFLNYLELIDRLYSNEFIDIKEIKTIITVSKNP
FT                   TAQNSDDFHDLKSALQKSIRGSDVDAALYYFSRLIETGDYESLMRRMIIIGYEDIGLAN
FT                   PAISSRVVQACSAFRQIGFPEGIIPLGLAIVEMSLSLKSNSAYLATNSALDFVRNGNIY
FT                   SVPKHLKDNHYKSAIKLGIGIDYKYPHDYENDWVEQQYLPDEIKNKKFYNHKNNQYESK
FT                   VYELYNRMKNKK"
FT   gene            complement(523811..526273)
FT                   /locus_tag="MMS_A0506"
FT   CDS_pept        complement(523811..526273)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0506"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69744"
FT                   /protein_id="ADK69744.1"
FT                   /translation="MKKILIGLSTFSLLVSSSSIVSCTITYQFKNNYLDQLKMILNTSS
FT                   IAAQSIILSDKNTTNISTDYSLKTFSQTKISDLYKNEEKKLADKYVIDKKTTYEYQFKS
FT                   MFLSLENQKWTEQLKKITTIDKNNQTTNLDLAWNDQNTKTTDNNIFKTLSLASAGFNFL
FT                   FSGDFTPNQQGELINNFLSNQFGLLESTVFKDNQFTNLINQLNNIDNNQFYNFANSLFT
FT                   QPEWINSDKENNLTKKTLQEILESSSKRLWDQILPKDEKQDFKIDWSKVFKPLIDLLKA
FT                   FSIYYEQIEQRSDKNLTYQTMDPLHLFSNKKTNSEFLCEILNTDLQTIYKNKSEDQIKQ
FT                   EINSIDLKKVINFLKNTLVFDNNDEHGYKFQKFVVMLLSSASQKEQQNEITNNCLLKPF
FT                   YTWYEQNQELVKKIITSKLEKIESIKPYASFVSNITPILFKVIKAFHQDLIEQGLNKKL
FT                   SSELSSYLSLAKAILPALKVDRKVIDFLDLKSLKDFLNNPFLALYKQNFLKEVFELINQ
FT                   LSNKEVINNQIIDNISNVYNLTTLKLDKLFNYLLELIKKPSASKTSLDEFQFLYGLKDL
FT                   SISQIINNLSTFYNKENLDYIFNLNSFKNLLETIFNKNITMSFKYNNQEKELKTQNNLS
FT                   TILAILGLNSNYTKNLKIEIKDDTNKISEKIKQLIEQKQYGLISVILLGYNTDTKQFYK
FT                   DSILDNVANLFGHNDKDTNKDASKNAINVLIRSYLELVNWFQNVSLKKYAKDNFSTYLD
FT                   QNNWTTEFIDKKGNIENLNEPFIINYVLKYKNPKNNNQNWKFKVSLTRTSDFEQPWKIS
FT                   EITKLTNN"
FT   gene            526423..531687
FT                   /locus_tag="MMS_A0507"
FT   CDS_pept        526423..531687
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0507"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69391"
FT                   /protein_id="ADK69391.1"
FT                   /translation="MKRITSFLLLLKQGLKGVFKFKIQFIIILLLSFLASFILSTSLTL
FT                   TSRINKTYNNIVNNVNKFDYSSTNEIRTYRIDRNNSTTDRSVIPLLDLVNNSNSYYNQS
FT                   SNNKNTSYLNFILNKKNLTSNFDNKTILTELFENKEFIELFTTINGKDTNWIWKNIWLW
FT                   QLSLYFNKFVYHSYNQFLKNNKDYSYLKNTVIGKYLSNSFKDKNEFLNDAKVLKDLKFE
FT                   KIKNNFNVKEFKQTFNKQIQNKELFSYIYISGMSLFQHIYRNIYLPYFSDFKIENNNKI
FT                   GNSFYTFLTGNKLDNISDNQVDKWIINDKNKSYLTEFELNKTTINLNDNNVLTLKPDSK
FT                   DDIKKLVLEKGFKGNTDLVLSTIDSNNKVQSISPIINDSSFFKLSFFNGNGTSLTNVVT
FT                   VLSDTNFIKKDQIIGDNQFDNINLFHNIWLAHLKYSAIASGYDINFRTEVFYYDSVTQI
FT                   RYRLVILNDDHTTNLTILNKNQGARSPSKGEALISEQFARAHKLKLGQQIIVDGALLTI
FT                   TGFATDAYSFFPTTDPDFPIPQSELGAILYVTRSTINDILGATSQSNTNRVLKGYLSFF
FT                   LRKKQNNASIDLFNSYQMNDISKLYDSIKYQKDQKNKVTTWLNIKDFDHSIFRFNWTIA
FT                   PLAINSYKGSTLIAALVVSLIAIIALVICIRKTIYFNAKQIGILKALGSSPIQISISYL
FT                   AYVIVIILTSVPIGWITGLSTQSVFVKLFVNYFSIPLYSFTIEPFSLLISLLIFGLFGV
FT                   IVSLLSAIIITKKQLADILAVKQNWSSSKFINRLKRTWFKKAKFTTKFSLTLASSGKKN
FT                   IFLLVTVVGISTMFISAGLAIPSIAFTIKNTYYKSIKYANEYNYSKGVSNSPLTKPTIN
FT                   YWSGQDSLDKNILSTNLNNEELFYYKDPTAYASSSYDVNPFPKYLYKVEKFKNNNNEQI
FT                   NKKIAWTLLELIQNKDQTSANHTNGLDLLFTEMFGNNLYNVVGNQFSIGVIDQILGLIL
FT                   NSKNNVVNPKDTTTKWTDEQKYLIFKELTNNFTKTGTTAISILVGDLSTSSSDDWKTKI
FT                   FDAILKAVPPYVSAYIQKPSRKEQFSIGYNVQHYIPDHETLTTITDIKTTINQKNTDLS
FT                   LTGIANNQSAFIINQKNANDLFIDYKKLLALQEVFLEKKNTDIKLNDQFVLYDSKTNTI
FT                   NVPILPNKQANAFYKLNKNPDISNISTSSKQFFINTKNGYVNIPKHAWIYDDLNFIKSK
FT                   YYNSLTSEQKNLISKNRTGRNSKAVSDQDIRWLDPYNLDNNKFTLKLLYDQDRFDNDST
FT                   YDNKEWTLLNNSYMFDDFTYNNQFDDLLSSYIRPYYQYKNIQLYIPQSLINTDHIIYFT
FT                   SSKKTKKELENSSEHWYKKDIDYNSVPKSVIKAWDIKNTSEKFLMIRPYDLRYGLLVDN
FT                   VYKSGLSNLTAKPEYWMYQATKTKNISGMTIPIIQKDAKTNYQNKDLKITIKPVGTLDS
FT                   YNQKLILADQGLINLVLNLSIGKKIGIKDNFYNKQTVIKAGESYNNIISRFDRYDHNQI
FT                   INYIDKTKNTKEFNNLLFSSNKAFDKAQFLWHNAKYSNIEEALDLTSGISFVPDTAYNG
FT                   FYILNGHGASSASGDDDMISNIKNQNLLATSKTLINQITFIAISIGMLLIITVIITSAL
FT                   LVMLISDIYVTQYQQFMILMKALGYSNYKISKYAFGTAIVFSLIMWAISTLATWILITL
FT                   IIQIITSLGFAIPYGFAFWTLIVSFLIIGISFIGSLIVSSNKIRTQKPASLLTVSNE"
FT   gene            531735..532286
FT                   /locus_tag="MMS_A0508"
FT   CDS_pept        531735..532286
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0508"
FT                   /product="DJ-1 family protein"
FT                   /note="identified by match to protein family HMM PF01965;
FT                   match to protein family HMM TIGR01383"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69820"
FT                   /protein_id="ADK69820.1"
FT                   /translation="MKKIALYLNPGFEEIEAVTVCDVLKRAGILVDMVSTIDSLEVKGA
FT                   HNIVIKANKLWKDLNINYYDGMVLPGGSGVTSLFDNQTLIDNILEFNKQNKLIASICAA
FT                   PQVIGQTKLLDNKTITHYPNCNFYLDKANVVLDKPFVVDNNFITGVSAGSSMLFSLAIV
FT                   EYLLGKEKKEEIYKNLVIFG"
FT   gene            532321..533553
FT                   /locus_tag="MMS_A0509"
FT   CDS_pept        532321..533553
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0509"
FT                   /product="peptidase, C39 family"
FT                   /note="identified by match to protein family HMM PF03412"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69560"
FT                   /protein_id="ADK69560.1"
FT                   /translation="MIFIKLIKQTQYNDCSIACLAMIINYYYNQNYDLDRLKLEINYVE
FT                   EMLSFYDISNICSKYFLTCKALQIENDLEQINKKVYLAQVVNQTGLLHFVVVEKQNNHL
FT                   IIYDPLKTKKQKITYKDFYQIFTGYILIFNSNYKKFKANYNNLFTLFDSFYLAYLFYII
FT                   LNIFSILLTILEMRFLYVYSLSITNLNNSYFLYLYFLAIFIINIFLNEISKFLLNKYYQ
FT                   KNKSKKLETFYYYLVEKNIKLDIINTYSEIEFISSYQTYVLLNTISAVINSLVILFVIF
FT                   YINKTIFLVLFVFDLFWLVISFIYNFFTNQNKTNNQNLNLITHLLNKTKLIDKKTSLEL
FT                   INKDLNKTQTDYLHILFNFFEKISLLVIYYISWDLLKFNYIEFSILLIIVLFKAIHTSD
FT                   LKKTSLFFTKL"
FT   gene            533942..534169
FT                   /locus_tag="MMS_A0510"
FT   CDS_pept        533942..534169
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70055"
FT                   /protein_id="ADK70055.1"
FT                   /translation="MTKIINLETITKLETEFIKLLRIFYLDHQYLLFNDNFEIISKTDI
FT                   SLVLKLFTSYSNSSLIITSNDIKYNLISKD"
FT   gene            534214..534669
FT                   /gene="ybeY"
FT                   /locus_tag="MMS_A0511"
FT   CDS_pept        534214..534669
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ybeY"
FT                   /locus_tag="MMS_A0511"
FT                   /product="metalloprotein, YbeY family"
FT                   /note="identified by match to protein family HMM PF02130;
FT                   match to protein family HMM TIGR00043"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69668"
FT                   /protein_id="ADK69668.1"
FT                   /translation="MDFWKKFCNKILKTAYNYFNFNYDIELSITFVNDLKAQQINQQYR
FT                   NHSYIADVTSFPVEMTENEIKAIGFRELGDMFINLNEAKRKAIKYNHDLNSEMGFLFVH
FT                   GFLHLLGYDHEDSNDEKIMFDLQDQILKLNNLEYIIKFNEDDYLESN"
FT   gene            534673..535578
FT                   /gene="era"
FT                   /locus_tag="MMS_A0512"
FT   CDS_pept        534673..535578
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="era"
FT                   /locus_tag="MMS_A0512"
FT                   /product="GTP-binding protein Era"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF07650; match to protein
FT                   family HMM PF08477; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00436"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69055"
FT                   /protein_id="ADK69055.1"
FT                   /translation="MSNFKSGFVSIIGRPNVGKSTLLNKLIGEKISIVTNKPQTTRNNI
FT                   RGILTKKDQYQIVFIDTPGVHTSKKQLDKFLNTSALKSTKDVDVILFLAPSDEVIGKND
FT                   LFLLKQIKNLDVFKILVITKADNVTKEQLILKANEWSSYQDQFDEIIITSSITNLNIEK
FT                   LLELIVNNLSDNDYQFYDDDILTDQSDRFMIKEIIRENILLKTGQEVPHSVAVLVEHLE
FT                   QNENEINISCAIIVERQSQKSIIIGKNGVKISDIRYKSKKQIQALFKKRINLELFVKVQ
FT                   ENWRNSPSLIKKMGYNKDQY"
FT   gene            535578..536327
FT                   /gene="recO"
FT                   /locus_tag="MMS_A0513"
FT   CDS_pept        535578..536327
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="recO"
FT                   /locus_tag="MMS_A0513"
FT                   /product="DNA repair protein RecO"
FT                   /note="identified by match to protein family HMM PF02565;
FT                   match to protein family HMM TIGR00613"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69930"
FT                   /protein_id="ADK69930.1"
FT                   /translation="MEKTLKGIVLNSFDFQDYDKIITIYSNLYGKISLVCLGVNKIKSK
FT                   NKYGINYLSYSNFEIFKSKNKFNLSKLKRSELINSFNHISTDFNLYLYANIITSLVLSL
FT                   DEQIKNYNLYKTLKLSISIINNKSDFGLKVCVLFMFYFLKIIGNQIDLSKCGFCNSKIN
FT                   PIIAISFTNYCSSCKFCYFDDCILIDNQLSNFINSIFKNDFITNLSQEISTNNLNILTR
FT                   FILNYYQDIVGTYTTSMYLLSTLIRFN"
FT   gene            536391..537761
FT                   /gene="glyS"
FT                   /locus_tag="MMS_A0514"
FT   CDS_pept        536391..537761
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="glyS"
FT                   /locus_tag="MMS_A0514"
FT                   /product="glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM TIGR00389"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69301"
FT                   /protein_id="ADK69301.1"
FT                   /translation="MSKSIEKMISHLKNQGFVFQGSEIYGGLANSWDYGPLGCEVKNKL
FT                   KKVWWDFFVKKNPLNVGLDSSIILNSKVWKASGHIDGFNDPLIDCKNCKSRWRADKLIE
FT                   EFDSSINTGIMTSAQLEDYINQNNILCKKCQKKDFTQIRQFALMFKTNQGVLEDDSSIV
FT                   YLRPETAQGIFINFKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFIFRTREFEQMELEF
FT                   FFDPSDQKDWFKYWLDQIELFLTKKICLDKSNYKIRENLKDELSHYALKTSDIEFNFPF
FT                   GWGELWGISHRSDFDLKVHQNLSKEDLTVLKEENNQKVLANVIEPSVGVERLMLAIFWQ
FT                   AYTEEQLEENNSRTVLKLPYNLAPYQVAITPLSKQLNQNAHQLFLELLKDFDAVYDETG
FT                   NIGKRYRRQDAIGTPFVITYDFQTLEDQKVTIRYRDTMKQERILISQLKDFLNSQFN"
FT   gene            537796..539634
FT                   /gene="dnaG"
FT                   /locus_tag="MMS_A0515"
FT   CDS_pept        537796..539634
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dnaG"
FT                   /locus_tag="MMS_A0515"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF01807; match to protein
FT                   family HMM PF08275; match to protein family HMM TIGR01391"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70087"
FT                   /protein_id="ADK70087.1"
FT                   /translation="MVYISNEKISEIISKANIVDIISSYLHLIKKGRNHLAVCPFHNDS
FT                   NPSLTISPEKRIYTCFSCKATGNVINFVKDFEHVDFVTALKIVCDKTNISLDELKNYNQ
FT                   PIKDLESETIFKLNSEANNIFKTTLFSNLGIDALEYLKSRNISIEQIKKFEIGFASDKT
FT                   NLVQKLLDKNYNSLDIEKANLGIITNSYTKDYFTNRIIFPIKDENDQVIGFSGRSFTKD
FT                   NDPKYLNTKENKVFKKSHLAYNIASTLKISKSLKKIIVLEGFMDVISLSKIDINNTIAL
FT                   MGTSLSNYHLNLFKRHNLDVLLFLDGDDPGIQANIKISHQLLKEKINVLVIDNQTNNDP
FT                   DELVNNNVEYLKQIINQPIHPVNYLIDKLWNKVDNNDPNQIENFIKKVLNFIFDLNNEI
FT                   LVEATINKLVELTKISEQTIKNNLIELKKQLKLNNSFNKNSTTQVFKTNTQTNKVNKQQ
FT                   FKTKPNDFIKKEYINAEKRIFISLLISDQFLDKIAANVEKMIHPDIKHATINLINLYNK
FT                   KIYQGNDINKAFDLLKEYNLTGFDKKQEEIINNSLLTSIKIRESEIDDAFSKLDSYHND
FT                   TEISNLKKLLAESKNKTERFQIWNGIDTLKNKKKKR"
FT   gene            539637..541157
FT                   /locus_tag="MMS_A0516"
FT   CDS_pept        539637..541157
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0516"
FT                   /product="putative RNA polymerase sigma factor RpoD"
FT                   /note="identified by match to protein family HMM PF04539;
FT                   match to protein family HMM PF04542; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69124"
FT                   /protein_id="ADK69124.1"
FT                   /translation="MTKFNNKSELKKIASFNDFLDYTVSFANKNNNEISSEDVLEVFAN
FT                   IFPNASDNESEKILDVLQQKGIVFSDLVDDDIEQEELEEVEEEIEDLNLEELEELENLE
FT                   YLDDLDFDLDSTSNNLDDYDENANDDLDEFKEAKSAAIKGRKSAKSSNHMKYRVGGISN
FT                   ETKIQDIIKTYFYKIGQAPILTKEQEIIYAKMAVSDDPEDVQEGRNKLIESNLKLVISV
FT                   ARKHLNRGLDFADLIEEGNIGLMKAVDKFEYEKGFKFSTYATWWIRQAITRAIADQART
FT                   IRIPVHMVETINKLARVERQLTQELGREPNADEIANRVGEGITGDKVIEIKKLSIEPVS
FT                   LEKPFGDEDDTHFGDFVEDKDMVSPNEYTEKEILKEVMDKVFEDMPPREEKVIRMRYGI
FT                   VPTRLRTLLRLTQECNDTNAKELKQAIEELDIHLDTPIEKVRKFNNQIINNNLAKYDSA
FT                   RTLEEVGKELNVTRERIRQIEAKTIRKLKQPSPNNKSGKTLKEFYKGY"
FT   gene            541157..541834
FT                   /locus_tag="MMS_A0517"
FT   CDS_pept        541157..541834
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04816"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69516"
FT                   /protein_id="ADK69516.1"
FT                   /translation="MLSFRLHQVAKLINNSTTIADIGTDHAYLPIYLVQNKKAKIAYAC
FT                   DINQKPLKIALKNVEKFGLTDQIFAILSNGLEFVKNKEILNIDYVTICGLGSQTILEIL
FT                   KNDHQKISNYIICSNTSVKNLRLWAVSHNYLIKYESFIYEDDHYYWLIEINKNKYCDHL
FT                   EELEIEFGSKQFFNKNSLYISYLENEISNLTRILNQINPNNIKYLEIENRINKIRKYID
FT                   VIR"
FT   gene            541821..542597
FT                   /locus_tag="MMS_A0518"
FT   CDS_pept        541821..542597
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0518"
FT                   /product="dinuclear metal center protein, YbgI family"
FT                   /note="identified by match to protein family HMM PF01784"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69049"
FT                   /protein_id="ADK69049.1"
FT                   /translation="MLLDNIISYLNQLFNPKKASNWDHVGFQFEYKKLNNINISKVLVC
FT                   LDLTNDCLEFAISNQTQLIITRHPFIFNELKLEKKNPNKKQMIKKLKKHKILVFSIHTN
FT                   YDSSIKQNLLEILNKKLKINSFKKYGKDKESNLFYLDQKISVNDLINDLKEIFSLNKIR
FT                   LNSNISLDTKIKDFYLTSGSGASTMIENMLKDCTFITGEVKWDQWIYANSNNVNLIEIG
FT                   HYAENHFIDDLKNKLEIKFKDIKIFSYDIKNQFIEK"
FT   gene            542606..543967
FT                   /locus_tag="MMS_A0519"
FT   CDS_pept        542606..543967
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0519"
FT                   /product="DEAD/DEAH box helicase"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69480"
FT                   /protein_id="ADK69480.1"
FT                   /translation="MKFTDFGFKKYINDTLDQIEFIAPTSIQQKVIPLLKKHKNVIALA
FT                   HTGTGKTHSFLLPILNNLKLEENNNYAQAVIISPTRELSLQIYQNTKLFFKNNPLINCN
FT                   LFIGGEDISKNIEQLEKKQPHIVIGTPTRLKELYDLNKLRLTTTSYFIIDECDMIFDLG
FT                   FIEDVDYLISKINQDVTIGIFSATISQQLSVFCKKYIKNAHFIDDSQNKISTSNVKHIL
FT                   IDTKNKELEQSLIQIINSINPFLCIIFVNQKDEISKIVEILHKNNIKQVAELHGNLQPR
FT                   LRLSMLKKIQNNEFKYLVATDVASRGVDVKGVSHIISINLPNDLTYYIHRSGRTGRNNS
FT                   TGYSYIIYNLKNKIQIEELIKKGIEFETKKLIDNQLVDIKTNYKKVKVFKELDAESKQV
FT                   INKYKNKKVKPNYKKKRKQELDKIKQKIRRKHIKENIEKIKKAKYQKRRAELFD"
FT   gene            544007..545521
FT                   /locus_tag="MMS_A0520"
FT   CDS_pept        544007..545521
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02588"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69945"
FT                   /protein_id="ADK69945.1"
FT                   /translation="MQIPIIKPKKGPPLTIEEISEIKQHSSYEKSYLKTFNKYKKKVEH
FT                   RIYFKTSFWWDIFIIALAALANTITTDYFILATGDTGLFPGGTATIARFLSIVLDKHIT
FT                   SISTSSSFFIFLFIVNLPFFVFGFIKVGIKFTLTSLLYILLSIGWDQIITRLPIINPNE
FT                   WSLIINYELISSLPTEWSSKLWLFVFSIFGGFFLGTTYSLTYRVGSSTAGTDFISSYVS
FT                   KKYNKQIGSINMKINFTLLLIFVILNTVIMPIYKIDPTAKLSVLNTLTDEQFTEIYNKA
FT                   KDSGKFILDSNSHHHFYLPSDWSVSDQQLWTRQQIAQIIASNTNFTNYDNLTTIIKLKF
FT                   VFGPSLFASFICFVIQGVVIDKIYPKNKLFTVLISTTKPREVKNYLFESGYRNNIHFLE
FT                   NQTVKKENGYIAQSVIMIHIGLMDWKPLQAGANNIDPDMMISFIRTKQVKGPWSYSLDT
FT                   QKRELSLYKKVITDRRLMARIEKESILLTKQRITNDKKLKNKSKTF"
FT   gene            545636..549790
FT                   /locus_tag="MMS_A0521"
FT   CDS_pept        545636..549790
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0521"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69856"
FT                   /protein_id="ADK69856.1"
FT                   /translation="MKNRLASFKKVLRFIIVLILILALLTGIGFSSYKISNNISYGAKF
FT                   VGGYQALVGVYDKTKNQEEEIPNGDAFKGAQSLEKKLSPFSDNTIETQQSGLSRVFIKA
FT                   SKKAYANNQDDFKNAIERTGGLLILDKNYQDIFFNENLMKIIGIDKVYDSSSDKRVAKK
FT                   LTLEEFLGEAKAESLQPANFSNKNSPFVSFNLKNEYLKNLIDPKKNKDNNALTMITSVG
FT                   HIIENLRTYYKKANSTNNQVVEQYLNTYFNQIIKPIQDYISSKASSDQLGVKILKDLFT
FT                   IEYSVPTTEGSQKNLSIQRNSLVDSNIVKWWNSNTKGKIDNTKNLKYVLFGTDNLNNKK
FT                   SDHIFRFTNSANKYIYDANASEKDFIKDDKGNVGKYYNKLKISSDNSTSQDIELDYIDK
FT                   VSNSLIKILMTEILFKKDTTDKDHIVNKNLDQNLFRNNILLHNNQISPENIRIVTTNPA
FT                   IVIDRKTQTTKLYIPVWSNTMAKQVESDILQTSLGFTFKVLSIKEFSADITNIMLIITL
FT                   ACLVILALAVLVFMLFSYRLLGLFAIILAAISASLTMFAPIIFNMAIGPEIFMIIFVGI
FT                   GLILDASIIYFENLKTHIYKEKLSPESSFKISNKDTLPISLDTSFIILIPSVLLFIFGS
FT                   GALKNLATISVINILIIILFVILGLRLLTWLVLKAKLFTKYPWLLPLNTIKNSQSTWFN
FT                   DLMLSFYLSRIENLNTKTKLTAKDLAKLKKFKDKYDFYLNKQEQIITNKKLKQLKKDQY
FT                   NLELVNKRLLKLENKYEIYLNKQEQINNNKKAKLLKKKKSEEIKNKCLLKLENKKQKII
FT                   NKNSFTKSSIKNSLIKQEFLQARINKNTSSQVLETLENKNKQRRIFKINKIFTIIFIIC
FT                   TFLGAIIGITIGPNYNSSFGKSYSVIAYGQKINDIYDNLDEAIRNYKQFDPSTKRGKDI
FT                   ISMGEHLEKVKNSQDAYMKSKFKVDYSNLTKPSDKNQWASYVVGNIYKEIVKKNYVSLW
FT                   KNPVSYNKYFRASVDVDYGYDFIDTNSLNLDHKQLAYVGFNIINAQDNKIISIFEKLLV
FT                   KDNLQNPDLSIKYDHDDNSSANGIINLINVPYTAYGEIKNIAIIFAITLLALLVYILIR
FT                   FKWTYFVALALTLILVIVLVSSLVVIFRVPVGIEILSAILAVLSFTIITCVLFLGKGKS
FT                   IIKSKDNKTFTEMFEKEIMAFSNKKATRHQVHEKKYQLKVEYKTNKKNLIKQQLESNNI
FT                   KSLWSKMFFKLKQNIKLRFNKKHNSLYKDFKLKIKENKNILKHHKKHTKIEIDLIANNN
FT                   AFLKETFINVFKFGMTRTILITVIYLAYAIILSFGLYAIIGMGLTIIIGILISSLVSLL
FT                   IALPIWIWLEKKCMIYVLGYRYYVQNFKINQEEQIINGIND"
FT   gene            549802..550314
FT                   /gene="apt"
FT                   /locus_tag="MMS_A0522"
FT   CDS_pept        549802..550314
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="apt"
FT                   /locus_tag="MMS_A0522"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01090"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69381"
FT                   /protein_id="ADK69381.1"
FT                   /translation="MNLKEFVVDVKDFPKQGIVFKDITPLLNNKDAFKYTIDQMADFIK
FT                   QLDVDVVVAPEARGFLLASAVAYAANKRFVLVRKPNKLPREVYDVEYSLEYGTNHQQIH
FT                   VGDLKPNDKVVVIDDVLATGGTMQAIIDLVKLSKAEVIGMSFLIDLTFLHDVNLFDQYK
FT                   VQKLIKY"
FT   gene            550397..552649
FT                   /locus_tag="MMS_A0523"
FT   CDS_pept        550397..552649
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0523"
FT                   /product="putative GTP diphosphokinase"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM PF01966; match to protein
FT                   family HMM PF02824; match to protein family HMM PF04607;
FT                   match to protein family HMM TIGR00691"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70000"
FT                   /protein_id="ADK70000.1"
FT                   /translation="MHNKYNYISFDYREIKDFKDLLNELKKYIKNKSELERIEQAYKYA
FT                   FKCHFNQTRKNGDPYIYHPLSAAYYLAQWRMGPNTIIAGLLHDILEDTPIQKEELVELF
FT                   NEEVANLVESVTKVSFFAKENRQQIKSKYLRKLYLSMSKDIRVIIIKIADRLHNIYTIK
FT                   NLRSEKQKIIAQETLEIYSAIAHRIGMKSAKSLLEDRSFEILNPQEFKKITDLFNSDMQ
FT                   NRQQIINDIIINLEQYLKKEKNIKIISIFGRPKTIYSIYRKMNVIGKNFEEISDLLAIR
FT                   IIAKSIDDCYKILGFIHQKYIPLAGKFKDYIATPKNNVYQSLHTTLSDANGNIFEVQIR
FT                   TEEMNQVAETGAAAHWRYKEGEIIDIAKKQKEIDEKIDIFSRILDLDKSEDQQSSIEQS
FT                   IKDDLFTASIYVLTPNGAVITLPYGSTVLDFAYRIHTEIGEKTIGARVDGVFLPINTVL
FT                   KSGEVVEVKTSPKQEPTHEWLKIVVISNARNRIKKYLQKKINEETLDKKDQQKELIRKT
FT                   EANINAYINQKDWKWKKKTADEILETVKTMDYNSLNDFLLDVAKGEFTINEAAEKVFIK
FT                   QNYSKDDEAYASIKSKIIYDTTIKNDILVDGIKNIKTTLASCCMPIPYEEVVGFVTKNN
FT                   GIKVHLKECINIDWTNMKSRLVVVQWNEAVAEKNTYTTKLKYFGIDRNKLLYDISKIIS
FT                   GLKVSIINANIFTDEKSLLSSGVITIKIKNSNQLTQTISALRSIPGINGVERGISN"
FT   gene            complement(552697..555663)
FT                   /gene="smc"
FT                   /locus_tag="MMS_A0524"
FT   CDS_pept        complement(552697..555663)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="smc"
FT                   /locus_tag="MMS_A0524"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM PF06470; match to protein
FT                   family HMM TIGR02168"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69537"
FT                   /protein_id="ADK69537.1"
FT                   /translation="MLFLKQIRASGFKSFADLTVMDFNYDMTGVVGPNGSGKSNITDAI
FT                   RWTLGEQSTKTLRGSKMDDIVFSGNNEKKAADVAEVTLVFNNIHENFSSIKSDVVEITR
FT                   KFDKNTRESEFYINSTKCKLKDVQSIALEAGLTRSSIAIISQGTVANFTESKPETKREI
FT                   FDDAAGVSKYKKRKKETLSKLEKATENLTRLEDIAKEISRRLPNLERQSKKALEYQQKV
FT                   NELKNIELYILTKDLKVLVNRIEELRVEKIEYETQIKKLTNEINMSQEEVNLIIDKDSE
FT                   DNQKLGELNAKFNSIVEKIANLKVRKQKAKFKEQENLNTKDQDEYKAALIKKQFDEKQI
FT                   SIKSEKNKLTKAENSLLELKDKYDYYSNKYNEIYREIETIRITISRISIQIEAIEHNKK
FT                   AALQSYQDEVSAILNNQKQIGGVVGVLKSLINVKEEYQIAISVTASGHMNSLVMKTDQD
FT                   VKKAIEFLKKNNNLGRVTFLPLNTLTPNLINPVQRQILEKSEGFVGFANELVEYSETIS
FT                   KAVEYALASIIVVQSYDDAINLAKNTNFRFNIVSLDGQRILPRGAIVGGSTRNANIFTK
FT                   QNTQNQDNNLEELKNKIELLEQKEISKTKEITEYKTANDSLRDQINDLNGTIRNAKNNL
FT                   FNWTENLKEFSDEHKSLTGRDLFTGVYSKSDESESIILAKQISELEIQRDEIQIEINSI
FT                   SFKRNQSMEKQKEMNSKNSKKRDELDELKTHAGSINTEYNVLLQRRITIIDRLSNGYQI
FT                   TEETALTMEVENIEDEQVARERIIELTTYIQNIGNVNMDAIEEYKNEKERFDYYDQQIK
FT                   DIYDAKEKLESIILDIDIAMESQFKQIIEDVNKTLPDVFSKMFGGGYAELIYTDPDNIL
FT                   ETGIDIKIFPPGKKITNLNLLSGGEKSLVALSVLFAILKARPLPLVILDEAEAPLDPVN
FT                   VERFARYVRQFSHNTQFIIVTHREGTMTQCDSLFGVTMQTKGITKIINVKLVEAKNLH"
FT   gene            complement(556110..556364)
FT                   /locus_tag="MMS_A0525"
FT   CDS_pept        complement(556110..556364)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0525"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69062"
FT                   /protein_id="ADK69062.1"
FT                   /translation="MKKSLTKKLDWEKKSELSSKDKTYPFKIAIIHELDKGFDFKSLSV
FT                   SGLKNFHDLIHDILSKKLTIAQVEKLYMRNILIHLKKDE"
FT   gene            complement(556367..556819)
FT                   /locus_tag="MMS_A0526"
FT   CDS_pept        complement(556367..556819)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69343"
FT                   /protein_id="ADK69343.1"
FT                   /translation="MRPKYSYKDISDWFLSKESMTPKKLQKLTYYAEAWAYALFDEGIL
FT                   SDTSFQAWIHGPVSPELWRDYKDYGWNEIPKKENNDYKLDKNTLELLDAVWSTYGERTG
FT                   YELEAISHSETPWINARKGLGELEASTKLIKPEDMKNYYRSIYTGD"
FT   gene            complement(556976..557674)
FT                   /gene="rnc"
FT                   /locus_tag="MMS_A0527"
FT   CDS_pept        complement(556976..557674)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rnc"
FT                   /locus_tag="MMS_A0527"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="identified by match to protein family HMM PF00035;
FT                   match to protein family HMM PF00636; match to protein
FT                   family HMM TIGR02191"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69986"
FT                   /protein_id="ADK69986.1"
FT                   /translation="MNIKNFFEKYNIKINNEKLFNEALTHNSYANEHKLKYSYQRLEFL
FT                   GDAILQMYVSRFLFFNYSKLSEGELTRLRASTVREETLFRVAKDINLGALVKLGHGEYI
FT                   TKGYEKPSILADVFEALTAAIYLDQKEDGLVTWLGQTLFKYIKDSNFINDTKDFKSELQ
FT                   ELLQSEKRSDLKYIIEKEDFFANENKILYTVSVNLNGQKFGVGKGFSKQEAEQNAASDC
FT                   LSKLKKPTSN"
FT   gene            complement(557664..558668)
FT                   /gene="plsX"
FT                   /locus_tag="MMS_A0528"
FT   CDS_pept        complement(557664..558668)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="plsX"
FT                   /locus_tag="MMS_A0528"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="identified by match to protein family HMM PF02504;
FT                   match to protein family HMM TIGR00182"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69447"
FT                   /protein_id="ADK69447.1"
FT                   /translation="MYKIAFDVMGSDLGSLTAIKAASEFIKEHDDLYLVLVGDETEIKQ
FT                   ALQQTPIDKTKYEIFPTTQVIDMNGSILDIRRKKDASIIRTLELVRDQKVDGMLTGGNS
FT                   AAFIGAAHFILGELNNIVRAGFMPTMPNAKNKLTLLLDVGANSENTPEDLVNYAKMANI
FT                   YYKEVLKNPNASIGLLNIGTEKSKGLELQKQTFKQLEELKNINFIGNVESRDVLTGNVD
FT                   IIVTDGYSGNICLKACEGAAKVLLTEIKKEITSSFIKKLASLVLKKSFKNVAAKFDYKN
FT                   HAGAILLGVKGICFKSHGSSDVRSFKATLRMTLDAIKNDIVKKIEKGLIENEY"
FT   gene            complement(558701..560344)
FT                   /locus_tag="MMS_A0529"
FT   CDS_pept        complement(558701..560344)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0529"
FT                   /product="DAK2 domain fusion protein YloV"
FT                   /note="identified by match to protein family HMM PF02734;
FT                   match to protein family HMM TIGR03599"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70090"
FT                   /protein_id="ADK70090.1"
FT                   /translation="MKKLELLKNMITSGVNNLYNHYPQIDKLNVFPVPDGDTGTNMNLT
FT                   ATNGYNEVIDVEYESIGKFLSAFSRGLIMGARGNSGVIFSQIIKGLSLGMNNAKELSVS
FT                   EWKSGFSKASEIAYKAVMKPVEGTILTVIRETSEKVNQLADDTDIKDFWKQVVKNSNQS
FT                   LENTPNLLPLLKEVGVVDSGGYGLVKFLEGIEYYVLNDQIVNKLDKLEVNTGGNIDMQI
FT                   EEEFGYCTEAIVMLNDDWINKLQNSVIRDQLQIFGNTSIVVVVDNDILKVHTHSLSPGQ
FT                   VLQFLQQYGDFQTLKIENMNLQANKQVKNKDQKWKENSDIKTERKLINETAIISVVSSE
FT                   KQKRYFEDELGISFAINAGAKMNPSTEDFLQAIETVDAKTVFLLPNSSNVYLTAKQAEK
FT                   IENKSKIYVIQTKTIQQGMVAALNFDPSLTASKNYSYLSKSFRNVVSFNITKAEKNTTY
FT                   NGIEIQKDNLLVIVDNNIIGAEQTLEAIFDKQLSKYIKSKTEIITIFVGGETNEQDLVQ
FT                   LRKFLDEGYDVEYEIVDGGQETYNLLIAIE"
FT   gene            complement(560370..560681)
FT                   /locus_tag="MMS_A0530"
FT   CDS_pept        complement(560370..560681)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69054"
FT                   /protein_id="ADK69054.1"
FT                   /translation="MSTIDEFVVQTIREAVITVPGVVGLANFSANNKKDLSTNDIHKAI
FT                   EFVIDKNIQHFKIHVILLYGVNILDILKEIQIRIKYELEKNFKNNIEHKVDVIVEDLI"
FT   gene            560849..561046
FT                   /gene="rpmB"
FT                   /locus_tag="MMS_A0531"
FT   CDS_pept        560849..561046
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmB"
FT                   /locus_tag="MMS_A0531"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by match to protein family HMM PF00830;
FT                   match to protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69761"
FT                   /protein_id="ADK69761.1"
FT                   /translation="MARRDALTGKSALSGQSRSHALNATKRKWNLNLQKVRVMNENGSV
FT                   FNIKVSARTLRTLKKQEKIV"
FT   gene            561110..561194
FT                   /locus_tag="MMS_A0532"
FT   tRNA            561110..561194
FT                   /locus_tag="MMS_A0532"
FT                   /product="tRNA-Leu"
FT   gene            561277..561720
FT                   /locus_tag="MMS_A0533"
FT   CDS_pept        561277..561720
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0533"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69303"
FT                   /protein_id="ADK69303.1"
FT                   /translation="MNWNIKKVSDKKLAVKKDENGSFLNYSKAVNLAIRMAKKQKAILE
FT                   IFNEKDRLIKTYNFDQVLTQSELVEKIRTELKLAHAKKTVVKIELEKHHKKYKKALKSK
FT                   NNLEKEQLKQIFKLAKLNYKNKKRQIKYIKFRYKIAKRNLKDW"
FT   gene            561810..562961
FT                   /locus_tag="MMS_A0534"
FT   CDS_pept        561810..562961
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0534"
FT                   /product="phosphate ABC transporter, phosphate-binding
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69720"
FT                   /protein_id="ADK69720.1"
FT                   /translation="MQKIKKSDNKPKKQFKHFFTNKKSLLFLNLCVLFIVSIWIWTFVS
FT                   IKSNLINIGGSASADLVLQKLIKEYQKQTNKKFNYSSTGSGAGARNVINQTYSIGFISK
FT                   SQNDLSIPSEIRNVFNNPKTKDDLEEFIKINQSNKQEIFNKLQNNKTYHYTSFAKDSIV
FT                   FIYNIKNTGLTDDQINQIKFNVSNNMISKQSQKALHKIYINNNQSDLISWKEFYKLLTN
FT                   KDENNISNKIKVRTYSTNSGSGTRSSFEELSGLKKEKKKIGQAVNEYNSNGAIFTQLNA
FT                   SDGSFGFVSMQYAQDLKKFPNLRSVIIKQDNQEWNLNKNDDNLLTYPLSRPFVALYKLT
FT                   DNQKLNNDILDFIYWFSCSDDKKVQEIYNHLGLIRNRLSFKNN"
FT   gene            563060..565111
FT                   /gene="pstA"
FT                   /locus_tag="MMS_A0535"
FT   CDS_pept        563060..565111
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pstA"
FT                   /locus_tag="MMS_A0535"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00974; match to protein
FT                   family HMM TIGR02138"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69353"
FT                   /protein_id="ADK69353.1"
FT                   /translation="MIKQKKETSFVCLKSIIITLTIFVLLALVILLGFVMIKTNVLFNK
FT                   QSFFEFVFGKNWSPDSKEFGILTITLMTLILIFISMLIAVPLTIFTSFFISEYLTLKSQ
FT                   KVTITIIKLLAGIPSVVFGLFAREQIGALFKLMGASSNDNLMVASLTMAFMAIPIMISL
FT                   SYDAIKSVPFIYRDASLALGISKEKTTFNIIRKSATPKIISAVILGMARVIGEAMAIMM
FT                   IAGNSTAWFDTNNGVSGFLFSSIRTLSSTIGLEMLENSSNLHESALYAIGMFLFILVFI
FT                   INLLILFVSNKNSISQKIHLVLFKNKKTHKIKHIKLYQKQTLYQIITNRAENKLFKKIY
FT                   STIMLVLMWLSISFVIMFTFWIVFTTIFNGLSSLKYSEAFLTIEGEDGIFAAILTTLLL
FT                   ILCTLLFAIPLALACAIYLSEFANKNSYFAKFFRFLLNLAASTPSIIFGIFGLSVFIIY
FT                   LKLPFSIFSASITMTIVVLPMLIKNFEDALTSVPLSYREAAVALGLSKTKTLFKIVLPN
FT                   ALQAIITGTILAMARIIGESAPIYLTLGTAIKYPDRGFLSSGSTLTTGIYKIASESAPG
FT                   QGNDIAWLMSLITIIFVLTLNLSSSKLSLLLVKTNKKVKFEFKQIYKNFINKQFYKTQL
FT                   NLFKNSLKQFIKSLKKYLNITNLFKEIRKTIKYKKEYKKLRKRDNNYE"
FT   gene            565104..565916
FT                   /gene="pstB"
FT                   /locus_tag="MMS_A0536"
FT   CDS_pept        565104..565916
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pstB"
FT                   /locus_tag="MMS_A0536"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00972"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70099"
FT                   /protein_id="ADK70099.1"
FT                   /translation="MNNEQLITNTKPKKKEPLKTAIEIKDFNFFYNKGKTQSLFNINME
FT                   IKEKSITTFIGPSGCGKTTLLKSINRLNDLIDGVKMSGVIKIFDKDIFDKDIDITKLRT
FT                   EVGMVFQKPNPFPISIYDNVVYGLRSLGIKDKKILDQICEESLVKAALWDEVKDILISP
FT                   ALGLSGGQQQRLCIARAIAMKPKILLMDEPTSALDPIATLKVEELVLDLKKDYTIVMVT
FT                   HSLQQATRISDYTGYFLKGELVEFNKTKKIFTNPKDRRTENYISGRYE"
FT   gene            565925..566599
FT                   /gene="phoU"
FT                   /locus_tag="MMS_A0537"
FT   CDS_pept        565925..566599
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="phoU"
FT                   /locus_tag="MMS_A0537"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /note="identified by match to protein family HMM PF01895;
FT                   match to protein family HMM TIGR02135"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69611"
FT                   /protein_id="ADK69611.1"
FT                   /translation="MSSNKILDRDLDQLRSLIENMIEETKIQYANSYLVIKEENKLIDA
FT                   QKVIEHDKIINDMQNEFTSIALWKISKQKLVAKDLRLAIGGILITREIERIADYSKGIS
FT                   KFFIHYKPNEKHLLMISELYELVVEMLDIFSDIFENLKVDKEQQVLSLEEKINTKFRSF
FT                   YDQLIDDIRQKTTKSEAEEIAAVLKQMFNLERAGDHLLNVQEIINFIKTSKFIEKTEKI
FT                   NK"
FT   gene            566666..567904
FT                   /gene="ftsY"
FT                   /locus_tag="MMS_A0538"
FT   CDS_pept        566666..567904
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ftsY"
FT                   /locus_tag="MMS_A0538"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69976"
FT                   /protein_id="ADK69976.1"
FT                   /translation="MGFWAKLKEKLTKKTNQVEQDEPILDQQDQQDQQEEQEQIIEKEI
FT                   EQEPVVNQDKQVEIIKENKIKKTKTSETKKQEKPIETLKEKKKREKQKEKDKKVEKAML
FT                   KSAFNFSKDIKKLSKKYKQADDEFFEELEDVLIQTDMGMKMVLKVSNLVRKKTKRDTSF
FT                   ENIKDALVESLYQAYTDNDWTNKKYRIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYA
FT                   ELGYKVLIAAADTFRAGATQQLEEWIKTRLNNKVDLVKANKLNADPASVVFDAIKKAKE
FT                   QNYDLLLIDTAGRLQNKVNLMAELEKMNKIIQQVEKSAPHEVLLVIDATTGQNGVIQAE
FT                   EFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLLAFDIDQYIVH
FT                   LSSGFMQGDEVEK"
FT   gene            567894..568229
FT                   /locus_tag="MMS_A0539"
FT   CDS_pept        567894..568229
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0539"
FT                   /product="helix-turn-helix protein, YlxM/p13 family"
FT                   /note="identified by match to protein family HMM PF04297;
FT                   match to protein family HMM PF04967"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69246"
FT                   /protein_id="ADK69246.1"
FT                   /translation="MKNNLLEKTLELSELFKIYKELLTDKQKQYFELYIDEDLSLSEIA
FT                   DEFNISKTAVYDSISKTSKLLFSLEKKLHLKQKQDLLISLINKIETNQIDQKQFIKSLK
FT                   EVIWWKY"
FT   gene            568217..568990
FT                   /locus_tag="MMS_A0540"
FT   CDS_pept        568217..568990
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0540"
FT                   /product="putative metallophosphoesterase"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00282"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70096"
FT                   /protein_id="ADK70096.1"
FT                   /translation="MKVLMIGDVYAKPGREMLEKHLKNIVDQNQIDFIVVNGENTTHGK
FT                   SICKKHYDFYKSLNVDVITSGNHIFKNAEVLEYIKTTNDLLKPLNMSKHTPGNGYVIVK
FT                   KNKKKIAVVSLMGQSFMDTVNNPYDALDEFLKTNTDFDILLVDFHAESTAEKIAFAFNY
FT                   DGIITAFVGTHTHVMTADERLLPNKTAFISDIGMTGVIDSIIGVEVNDVIKRAKTGLPV
FT                   KFNIATGKCWLNAVIIEIDDKTNKATSIKRLTIKD"
FT   gene            569200..570363
FT                   /gene="metK"
FT                   /locus_tag="MMS_A0541"
FT   CDS_pept        569200..570363
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="metK"
FT                   /locus_tag="MMS_A0541"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69350"
FT                   /protein_id="ADK69350.1"
FT                   /translation="MNQNIEKRLFTSESVSEGHPDKICDQISDAILDEVLKQDKNAKVA
FT                   CEVFATTNYLLIGGQISSTAIVNYEQVARDVLKKNGYVDDAYGINANTCKIDIKIESQS
FT                   PDIAQGVELSNDQIGAGDQGIMFGYATNESKTYLPLAITIAHELVYNATSQRKKGLFKW
FT                   ARPDMKSQVTIDYTNINNPKIDTILMSIQHDPNYNETEFKKYIKENIMNLVAKEFNLNT
FT                   DFKVLINPTGRFVIGGPQGDTGLTGRKIIADTYGGYSRHGGGAFSGKDSTKVDRSAAYM
FT                   CRYVAKNLVAAGLADKIEIQVSYAIGISQPISIFIETFNTHKVDLNTIYKAVYENFDFS
FT                   VSSMIKTLDLKKPIFFKTSKYGHFGKKDLPWEKLDKIEVLKEYKKCS"
FT   gene            570354..571037
FT                   /locus_tag="MMS_A0542"
FT   CDS_pept        570354..571037
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0542"
FT                   /product="CutC family protein"
FT                   /note="identified by match to protein family HMM PF03932"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69539"
FT                   /protein_id="ADK69539.1"
FT                   /translation="MFLEVIAKDLSDIRVINNSKADRIEFCKNLEVGGLTPSLDEIILA
FT                   NQITLKPLHIMIRNNSKDFFFDDYELIKQLEMISVIQKLPNVHGIVIGALNNDYTINED
FT                   FLQRVNKIKGSLKITFNRAFDLVKDPINALNVLAKHKIDAVLTSGGTNLNTGLEVIRQL
FT                   VDQNLDIQILIGGGVDKNNIKQCLTVNNQIHLGRAARMNSSWNSDISVDEINLFKDLDR
FT                   EQNNE"
FT   gene            571030..572346
FT                   /gene="trmFO"
FT                   /locus_tag="MMS_A0543"
FT   CDS_pept        571030..572346
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="trmFO"
FT                   /locus_tag="MMS_A0543"
FT                   /product="tRNA:M(5)U-54 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01134;
FT                   match to protein family HMM TIGR00137"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70064"
FT                   /protein_id="ADK70064.1"
FT                   /translation="MNKKVKIIGAGLAGCEAAYFLANNNIQVELYEVKTLIKNEVQKTN
FT                   NFAELVCFNTFRSQSLLNAAGILKAEMRRLNSLVIKIADGCKIDGDDALAVDREDFSKK
FT                   LTEVIKNHPNITIIEQNVSHIDDENDLTLIATGPLTTNELKEDIQRLIGKQKLFFIDAS
FT                   ASIITKDSIDFNKVYYSGRHKLGKYICCPLNEQEFNEFADNLINAEQVQLKEFEKSIFF
FT                   KGCQPIEQLAKTSKKLLLKGPMSPNNLLDQNNHQPYSVVQLRQDDAKDSLYNMVGFQTN
FT                   LKWPEQKRVFQTIPGLEKAKIVRYGVMHKNYYINSPKILNFKLQVMRKKNVFFAGQITG
FT                   VEGYIESASSGIWAAINILAFINNKKIKPLPNTTILGALTNYITNSKIYSLKPMKCNLA
FT                   ILEQENKYQSNDKFYSFNNSKNSLEEYIKQLNQILGTSI"
FT   gene            572372..573301
FT                   /locus_tag="MMS_A0544"
FT   CDS_pept        572372..573301
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0544"
FT                   /product="phosphomannose isomerase type I"
FT                   /EC_number="5.3.1.8"
FT                   /note="identified by match to protein family HMM PF01238"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69623"
FT                   /protein_id="ADK69623.1"
FT                   /translation="MKILKLKPYFSKKIWGGNRLKEFGFDIEDNQNIGEAWVISAHENG
FT                   MSYVISDDQYNNLSLKELFENHKHLFNNYKGCYPLLVKIITASDYLSVQVHPDDNYALK
FT                   NHNQLGKPESWYVIDANKDAELIYGHTAKNKNQLIDLVNQNKWNQLLKKVKVKPNDFLY
FT                   VAPGKVHAISPNLVIYELQRSSDITYRFYDYNRIDKTTNKPRPLDIFNSIECTITPDIN
FT                   DHIIHNANNKVFSSDYFSLYVLECTNLKEFEVDEKCDWLQLTIISGSGYINDMYFKQGE
FT                   SAITINKVEKLIVKGKIKIIISWIKNND"
FT   gene            573294..573947
FT                   /locus_tag="MMS_A0545"
FT   CDS_pept        573294..573947
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0545"
FT                   /product="putative uracil-DNA glycosylase"
FT                   /note="identified by match to protein family HMM PF03167"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69148"
FT                   /protein_id="ADK69148.1"
FT                   /translation="MTNLHPSWNKLFTDLNLSDQINNLINKAYSSNDIVFPKQKDVLNL
FT                   FKLSDLNNIKVVIIGQDPYHDFNQANGIAFSSNALKTPPSLKNIFNELYSDLNIDHFNN
FT                   NDLTNWVKQGVFLINTCWTVIAHKPNSHNNLGWQKITKKILEQIILHNQNVIFCLWGNF
FT                   AIKMYDSLLVKSNFVIKSAHPSPLSYKGFKNTKPFSQINNLLINLNLDPINWSL"
FT   gene            574020..575000
FT                   /locus_tag="MMS_A0546"
FT   CDS_pept        574020..575000
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0546"
FT                   /product="HD domain protein"
FT                   /note="identified by match to protein family HMM PF01336;
FT                   match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69151"
FT                   /protein_id="ADK69151.1"
FT                   /translation="MKKVKDINIEDHLIDTILRIERVIVSTGSSGNNYLILHLADSTGR
FT                   IEARKWVVSEKDKQLLKPNTIVLLKDTIVHEYRNILQLKVEDYQVIDEKDLLKYHLNKT
FT                   DLYITAPLDIKTSYLELISLLNSINNQTYKTITLNLIEKYKKEFLTFPAAMSIHHNVTS
FT                   GLFWHSYTLVKNVLSLKENYFYVNIDWDLLICGAILHDIGKVIEISDVNGSDYSLEGKL
FT                   LGHISIGNAEINKLADKLNLYKDQNNKINKEITLLQHMILASHGKKEFGSPIEPVLIEA
FT                   VILSALDDLDAKVYKINDELSKIELDNWTQKIISIDNKMFYKHKK"
FT   gene            complement(575031..575429)
FT                   /locus_tag="MMS_A0547"
FT   CDS_pept        complement(575031..575429)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0547"
FT                   /product="histidine triad domain protein"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69362"
FT                   /protein_id="ADK69362.1"
FT                   /translation="MDCLFCKIINQEIPSYKIYENEYVYSFLDVRPVSNGHLLIIPKKH
FT                   FENFSACDDKYLQEVILAKKHLVNLLKEKLNPAGFNYLSNEQAISGQTVLHYHEHIMPK
FT                   YEKEKGFLLKAEIVDIDELENTFNKIVK"
FT   gene            complement(575432..577585)
FT                   /locus_tag="MMS_A0548"
FT   CDS_pept        complement(575432..577585)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0548"
FT                   /product="putative lipoprotein"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69048"
FT                   /protein_id="ADK69048.1"
FT                   /translation="MKKLLTILGSILLSAGTATVAVACTTKNDKFNKPFITDELAQKII
FT                   SGLKLSDDFNFTTGERFSKLDYKSLILDMINEIISKNKYTDNWNNLSKKFGLEIEQAKE
FT                   FGNKKAENVLKNLSTIKLFADYTSKRAFEEDFDSVDLSYSENYPLNPYNLESKNGQKDK
FT                   TVYAIYYKNNNGGSSSGSSSNGGGTNGEATWLRWQTTGEFDNIDNPIPSTPQLPNISLL
FT                   TDTSSKNFRIAKLSKPKDQEYITNTASVKEDGKATNNGNNEFVEWYKNSSDKFETDGQG
FT                   IMQYRFMYHFKTKIEAKLFNDLLGHAYIDSNLFVDKNDNKSASNKKIILNNVSKLISDI
FT                   QSNYSQVDKTISNVKMVWAFSLDKQKVSEVNGAINQYVNPDGSLTNEDNKKTLKNVFDK
FT                   IKYKATNESKQGTDSLLSISGFNGFVKNKDNNIESLSGDLKLTEEAKKAVARVNVPSLL
FT                   TNNNNGFASENSNNVDYVFVLPIYLNDLFSSNDMQIKRETESSGGAGSNGSNYELNVLE
FT                   NTWVNLNDKFSLDNRYFDNLTIKKVESQNNGEALVANNNDKWYVSLKNGNDNKKVEVTY
FT                   SDDSKKIITLKKVDKNNIKTLDFTYKLSQSDFNKQLFKQNPTANITYDINLKNYDNIKD
FT                   KQNDAYIWKNDPKKSNDIQDLSAAKKQVLLDQLEAITAKNPDVQNAAKTELYSAYLYTD
FT                   GIYYKSLFDEISKYIESEKPTLD"
FT   gene            complement(577585..580497)
FT                   /locus_tag="MMS_A0549"
FT   CDS_pept        complement(577585..580497)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0549"
FT                   /product="putative lipoprotein"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69670"
FT                   /protein_id="ADK69670.1"
FT                   /translation="MKKLLTWLSAITLVASSSVLAISCKTEQVKNKNSLFLTNFGDIRI
FT                   DSKSLLEWNQKWNGISSNNQELINKTNNLLAAGILLAIRDNKLQLPDENENGWDSSVNS
FT                   QIKNLLGDKNSTDTATLYGLANKSLNDLKNNKYKNNAKGWLKHLQEMFPGVKKNLANLE
FT                   NAYKSNFILNDSSNSAFIKLKNLLMFNSTVADSMWQKGIQTTNLDWKTLTNNFANAYPG
FT                   NKNLDELVKAIKDAFNKSDSNWNDAKIVTFTNMVNGLGGINNQNTTGSVGNGSSTGQND
FT                   NLTITYSSPKDVKKHITTNNGNAETWIKEVLNKISSDAIKGTIAFSQWNPTYNYDTQKG
FT                   SKNFINYNNQKPSSWTEIVKEIPLLENGDLKTDPIKGEYGAISNSQKYAINNYFKSEKP
FT                   VIFSDLIFKFSNNKTSSDIEKNLSLKALIPTDSSGQDLTTKLIERFQGIQSVLETYVGN
FT                   DAKKDQEQYTAGLTRFDTIFRGQDAKIKANTSTNNKAEFKDWTEWDTKNDNHKINVNGK
FT                   LLTLSDSTYSDTVKFSIYDFLTSGNNDSNSWTWQNKEALNGKLDSSNFKNALTDGGLSN
FT                   DEATKVDNAIEQSKTNDSAKNSARLTIYNLSELFKKINQRDNSTSASSGNSGGSGSSGS
FT                   SSNTTTTSSEVNNNKNIYTVLNKEEGIIAFIDGDGLHITKIDGYKLISKKNTPLNSMSS
FT                   EQKETNNKIKQTAVLKQIRSLYGSANANVLVPYLINSTLQSSTNVSMAGAASTTSSTSS
FT                   TTDKWNWTKKDLEYASSVKNLGIDINSLNSNIKNDYERFLINTSLIDNSKTKPFYNIDI
FT                   LSEVSKSIQSGNNISLQSNWLIELFTKFLKNGKESQQINLLNIIIATDNKEDNNDEIEK
FT                   IFLYQAKNLKVIGIRKLQEANKKWVNKVKENYKKYSKDPSLDHKFIPNQVIDLNSKTSD
FT                   RKKRYDKLLQSNIFNSEVKVQEKSTGGSSSSGENVMRGDS"
FT   gene            580700..581938
FT                   /gene="sufS"
FT                   /locus_tag="MMS_A0550"
FT   CDS_pept        580700..581938
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="sufS"
FT                   /locus_tag="MMS_A0550"
FT                   /product="cysteine desulfurase, SufS family protein"
FT                   /note="identified by match to protein family HMM PF00266"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70018"
FT                   /protein_id="ADK70018.1"
FT                   /translation="MDDQFNKIRKQFPLLKKHPDLIYFDNGATTLKPNSVINAQTNYLK
FT                   NISTNPHSSDYKIGYQSLEILNNTRELVKNFINANHTSEIIFTSGTTQSINMIVKGLIN
FT                   LIKQDEEILITSLEHSSNLVPWIWLKQKTNAVIKNLELTNDFGIDINKLDKIITLKTKI
FT                   ISFAHISNTTGYINDVKKIIQKIRSINQNVIIVVDVAQSIAHFKVDVKDWDVDFIVFSA
FT                   HKMYGPFGVGILYGKYQLLDKLEPLNLGGGSSLTISKDFTSYTLKSLPEKLEAGTLNIS
FT                   NIYGFKKAIEFILKIGINNICLYETKLKQYTRQQIKANHLENKITFYNLNNDSPLLLFN
FT                   VNQINAQDISSFLDVKYNITSRSGAHCVRRLEDVIHIKSALRISFAIYNTTDEIDKLIV
FT                   ALKNTDKFLDIYF"
FT   gene            581941..582378
FT                   /locus_tag="MMS_A0551"
FT   CDS_pept        581941..582378
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0551"
FT                   /product="NifU-like N-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF01592"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69524"
FT                   /protein_id="ADK69524.1"
FT                   /translation="MIDINNDSLLREIIIKHFLNPENKTLTNNQNAIIKELKSQTCADQ
FT                   LIIEILIENKIIKSMKFDGSACAIATSSIDLLINNLLNLDIKKAIELIKNYQNFLLTGT
FT                   LVNIDQSNELVVMKNIHKQKNRILCASLALNDLLEILNSYE"
FT   gene            582371..582934
FT                   /locus_tag="MMS_A0552"
FT   CDS_pept        582371..582934
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0552"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /note="identified by match to protein family HMM PF01812;
FT                   match to protein family HMM TIGR02727"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69923"
FT                   /protein_id="ADK69923.1"
FT                   /translation="MNKTLLRKQLLEKRKNFDLEYKNTSNLIITNKVIDFIKQHQFKQI
FT                   CIFLSTKYEIETRNIINWCLNHHVLVFVPKITTDNNMNMVLLDNSYLTNFNKFNIQEPT
FT                   INILANLKEIDCVFTPVVGFDKKLNRIGMGKGFYDKFFSLNSFNYLKVGLCFDKQKVDQ
FT                   IFIESNDIKLDYIITENKNIYKLN"
FT   gene            583277..584851
FT                   /locus_tag="MMS_A0553"
FT   CDS_pept        583277..584851
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0553"
FT                   /product="peptidase family M13"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01431;
FT                   match to protein family HMM PF05649"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69477"
FT                   /protein_id="ADK69477.1"
FT                   /translation="MYTTFVYRNYSLPIDFDISNDYIDSSIKTLYLTIASHILPDKSHY
FT                   QNKEVKNKFYKEFKAMTKKLLSAYFNDLKKINLIIKNTLEFDEIIANYSLSSLEKVRYN
FT                   ELYKPYKYEDVIRNTKYLDLNNIIKTLINKDVDQIIFTDDNFATNLDQIYNNKNLELIK
FT                   SWLVVMLIVRFSKYLDEKTRTIASKYSLFISGQTKVKNKEKHALNLALEYFSTPIGLYY
FT                   GQKYLGSKAKKDVENMVSHMINIYKQRLKNNTWLTSQTINKALLKLDKLGVHIGYPSEI
FT                   EPFYTNLITNSTNLIDTVFNFNQVINQYLFSEYKKPINKNYWSMAAYQVNAYYHPMYNH
FT                   IVFPAGILQGSFYSINHSTSQNYGGIGAVIAHEISHAFDNNGANFDENGNLKMWWTDED
FT                   FDKFKQKTQKMIDLFDNKEIEFGRCNGALTVSENIADAGGISCALQAAQLEKDYNAQEF
FT                   FINWAKIWKSKYKQQTALRLLETDPHAPTELRANIQATNLEEFVDAFNINPEDKMYIDP
FT                   QKRVKIW"
FT   gene            585070..586353
FT                   /gene="pgi"
FT                   /locus_tag="MMS_A0554"
FT   CDS_pept        585070..586353
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pgi"
FT                   /locus_tag="MMS_A0554"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="identified by match to protein family HMM PF00342"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69065"
FT                   /protein_id="ADK69065.1"
FT                   /translation="MIKVNLDHTNIDINKVVDLNKVKQIHQMIINKTGKGNDYLGWLNW
FT                   PNDYNKTEYEQMKQVANKLRSEIEVLVVIGIGGSYLGCRAADEMIRGLYHQDKVELIYA
FT                   GNTMSSTYIYQLVEYLKNKNFGICVISKSGTTTEPGISFRVFEKLLVDKVGLNKAKDLI
FT                   VAITDKNKGALKQLADKKGYQTFVIPNDIGGRFSVLTPVGIFPLLVSGINTDNIFNGAL
FT                   KAKNELINDDLSNQAYKYAVIRNYLYNQGYKTDALISYELQLQMLTEWWKQLFGESEGK
FT                   DNKGLLPSSMIFSTDLHSLGQWVQEGPRNVMFETIIKIEKPNYDLNVPIDEDNYDGLNY
FT                   LTKNSFHQINQTALKGAIQAHSVTGNMPNIVLEFEKMDDEQFGYLVYFFELALTMSAYL
FT                   LDVNPFNQPGVEVYKYNMFKLLNKPGIK"
FT   gene            586379..586825
FT                   /locus_tag="MMS_A0555"
FT   CDS_pept        586379..586825
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0555"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70023"
FT                   /protein_id="ADK70023.1"
FT                   /translation="MIKQNKKLDDTYKAGLILIIIGCSFTLLWALIGFFSIIAGSLAAS
FT                   FITSSYPTDPNIDIVKTSITTAIIGVNIIVIIASIPALITLLFAIKSLKYQTYKYKLVC
FT                   GIMGILFGFLLGIIGGICLLVTNNKDEEEIIIKNKNDDDQITLK"
FT   gene            586865..587368
FT                   /locus_tag="MMS_A0556"
FT   CDS_pept        586865..587368
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0556"
FT                   /product="dUTP diphosphatase"
FT                   /note="identified by match to protein family HMM PF08761"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69201"
FT                   /protein_id="ADK69201.1"
FT                   /translation="MIDNKTLKWLNEKQIILDQFIQNKWNFKNDKTLLDKKLTAFLVEL
FT                   GEYANEERSFKYWSNKKPSGLEIQLDEYIDGIHFIISVGNQINYNFLEFNYNFLNKESI
FT                   IDIYFEIISCLNSFIKENNNTNYSNLLNAFLNICEIKNYTQEQIINAYNIKNEINFQRQ
FT                   NNNY"
FT   gene            587385..588152
FT                   /locus_tag="MMS_A0557"
FT   CDS_pept        587385..588152
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0557"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69495"
FT                   /protein_id="ADK69495.1"
FT                   /translation="MEVISSVSNPKIKEILKLKDRKHRNKQKLFIVEGFHMIMEAYNDQ
FT                   IIKTLLGTSKTLEVLKDEIPNIEQVIEISENVAKKISDTVTSQQIFAICSMPENTKIDF
FT                   ENNILLLDQIQDPGNLGTLIRSAASFNFKTVIASPNSVNFHNQKVLRSTQGNLFQVNLV
FT                   NEYLVTVINQLHDNNYIIIGTSLHDDSKPLSKVKFDSDDKYALIIGNEGKGISPELLDL
FT                   IDLNINIEMAEDVDSINAAVAGSIIMYQINNAK"
FT   gene            588320..589735
FT                   /locus_tag="MMS_A0558"
FT   CDS_pept        588320..589735
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0558"
FT                   /product="putative glyceraldehyde-3-phosphate dehydrogenase
FT                   (NADP+)"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69958"
FT                   /protein_id="ADK69958.1"
FT                   /translation="MYKFKALLDGKLFDNNRILEIINPVDFSVAGQVVSLTKQDINDAF
FT                   IAAKSSQKAWENTDLEKRISILDKWKQLIDQNKEELAQIIMSETAKPYKDCLTEVIRSV
FT                   EYIDQTFYEVRNLKTLIIDGAKYGAKNKIGTFMRVAKGVGVAISPFNYPINLAVSKIFP
FT                   CLVTGNTIVFKPATQGSLIGAKLGELAYQANLPKGIFNVVTGRGREIGDDIITNKLADF
FT                   ISFTGSVEVGKRLLEISSTKDVVLELGGKDPAIVLDDLDLEKYAKEIISGAFSYSGQRC
FT                   TAIKRVITTDKIADQLVPLLKEKINKLTVGLPKDNCDITPLIDQKTADFVYGLIDDAKK
FT                   KGAKIIIGDKQEKNLIYPTLVDHVTSDMRLAWEEPFGPVLPIIRTNSVDQMIELANKSN
FT                   FGLQASVYTKNLDQALTIAQKLEVGTVNINGKSQRGPDVFPFLGVKDSGFGVQGIVDTL
FT                   LFLTRYKGIVINN"
FT   gene            589922..591853
FT                   /gene="parE"
FT                   /locus_tag="MMS_A0559"
FT   CDS_pept        589922..591853
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="parE"
FT                   /locus_tag="MMS_A0559"
FT                   /product="DNA topoisomerase IV, B subunit"
FT                   /EC_number="5.99.1.-"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01058"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69819"
FT                   /protein_id="ADK69819.1"
FT                   /translation="MAENGKYDESAIQVLEGLDAVRKRPGMYIGSTDNRGLHHLVWEIV
FT                   DNAIDEALAGYCTQIDVILEKDNSITISDNGRGIPTGMHKTGKSTPEVIFSILHAGGKF
FT                   DSTAYKSSGGLHGVGSSVTNALSKRFKATIYRDKKIHEIEFKNGGKLEKPLTFIANTYK
FT                   TGTTINFLPDDSIFSNTKFNFSLISERLKESALLNSGLKITLSDLISNRYVEYQFQYGL
FT                   VEFIKELVDDKKVITDIITINNESKNIIAEIALQYTEDDNEIILGFANNVKTSDGGTHL
FT                   VGFKSGLIRAINDYAKEQKILKDKAKLDSNDLREGLVAIVTVKIPENLIEYEGQTKSKL
FT                   GTSDAKTVVEQIVYEFMSYWLIENKVLANKIIENAFNAQKARIAAKQARQAIKSVKGKK
FT                   NINKLMLGKLTPAQGKKREINELYLVEGDSAGGSAKTGRNRKFQAILPLRGKVINSEKA
FT                   KLVDLLKNEEIQSIINAIGAGVGKDFDISDINYGKIIIMTDADTDGAHIQTLLLTFFYR
FT                   HMKDLIVHKKVYIALPPLYKITFNDKSFIYLWDEEELNEFNKTNTKKYEIQRYKGLGEM
FT                   NADQLWQTTMDPKNRKIIQVTITDGLLAERMFKTLMGDDVEKRKLWIQENVKFTLEDDQ
FT                   IKIIEMEK"
FT   gene            591855..594551
FT                   /gene="parC"
FT                   /locus_tag="MMS_A0560"
FT   CDS_pept        591855..594551
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="parC"
FT                   /locus_tag="MMS_A0560"
FT                   /product="DNA topoisomerase IV, A subunit"
FT                   /EC_number="5.99.1.-"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01061"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69172"
FT                   /protein_id="ADK69172.1"
FT                   /translation="MSDKSEIILYPLEELLGNRFSRYAKYIIQERALPDVRDGLKPVQR
FT                   RILYAMNQLNLTFDKPYKKSARVVGEVIGKYHPHGDSSIYDAMVRMSQWWKVNIPLVDM
FT                   QGNNGSIDGDSAAAMRYTEARLTKISNLLLEDLEKNTVIFSPNFDDSETEPTVLPSYFP
FT                   NILVNGATGIAAGYATNMPPHNLSEIIDATINIIKNPNITIDQILKIVKGPDFPTGAII
FT                   QNKQGIREAFLTGKGKVIISSKWHQEKNNIVIDEIPYEVVKQDLVKKIGDVIDNNPNLG
FT                   IKEIRDETDRKGLRIVIELNEKANLETVRKFLFKSTWLSVSYNYNNIIIVDKQPKQLGL
FT                   IDIIKAYISHYKEVFIKRTEFNLNKANLRLEIVNGLIKALSILDEVIKVIRKSENRLDA
FT                   INNLVITFKFTTNQATAIVDMRLYRLTSTDVNKLLLEKTELIDKIKKYQEILNNSLVLD
FT                   NEIISRLEEAKKQFGIKRKSQVEDLVEDLDVDQKEVIIEKEINLWISKDGYIKVIDNNI
FT                   LNKNELSSFGKKPNDMWISQGVCSNLDHLILISDQANYYSIPLYKISTSKWKEQGVHIN
FT                   SVATTQPNETIINALVIKEFINSTQHLLLVSKNGLIKRTQISDLETKIFNKSFKIMKIS
FT                   DDDSLVYADLISSKTSYCCIITKNGYAVRYNIEDIPVQSTISKGVKAANLKDDYIISAL
FT                   SLQNNKDVLIFTNKNNYKRLDQNLIPIYIRPKKGIRILVEKKKNKEQIIFGFAINDQMS
FT                   ISILDTNDQITDINVSDLKHTNLEQNSISTNIDEISYISIKQLIRSIAFDQPALANNFN
FT                   DQDTNDQIETKPKFNKLVSERIVVSKDTKNKAISNANQVHGSDLSSYLDDISSLLSKVS
FT                   QNKKDKKTKQLDFEDYFSDDDQNQDDN"
FT   gene            594659..596842
FT                   /locus_tag="MMS_A0561"
FT   CDS_pept        594659..596842
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0561"
FT                   /product="helicase, RecD/TraA family"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69191"
FT                   /protein_id="ADK69191.1"
FT                   /translation="MEEQIKIRGYLSKFLYKSDSWALAIFTSENNSNKTIKIKGEISDL
FT                   KPKILYELIGKQTSHIKYGTSFEVSSFTLASINTEQQIINFLKSDVFPGIGNLTASKIA
FT                   KLYSKNFIQEILNNKEQFFQIKDISKDKLELIYNKIKQINEQNFLRIEFINHNLNLKIL
FT                   DKLKKFTDDENEIKQILTNNWFEFSFKHELGLMQDIDKIFLHFNNNDINNLTRISYWHL
FT                   YACNEILFNLGDSYTYKNYLFKKVSDLIKINDLDLLNNGLDYAIKNELLVLKNEKIYTY
FT                   ESFNDELVISEVLVNNHLKTNDIDDNLLTSYINQIQLNTQIKDFKYDKDQVLALKNFIK
FT                   HKISIITGGPGTGKTTIIKAIVELFKKVYHSSNYAICTPTGRAAAKIRENFTESHATTI
FT                   HKLLGYEKDNKFSVNKYHPLDYDLLILDESSMIDARLFSQFLSSINNAKKIVLIGDVDQ
FT                   LASVGYGNVFYDIINSKIICTTNLINIHRQSFNNGIIDLAYMIKNDNLDLNKLQNLDNV
FT                   EFFFNKDKQACLEYLKTVYSKTINQTKSIQVISPVYADILGIENLNNFIQYNFNQNILD
FT                   TNNVYDRLRFRYAVNDKVMYLKNDSELNLSNGDIGYICQINKNNNKFNSAIINFNNNLF
FT                   EFTSEQFDEINLSYCCSVHKTQGSEYDQVILVLQDTLFSSFLSKKLLYTAITRAKKQLI
FT                   VIGDFDLFIKASKKNARIRKTTLVEHILNKLNN"
FT   gene            complement(596884..597252)
FT                   /locus_tag="MMS_A0562"
FT   CDS_pept        complement(596884..597252)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0562"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69792"
FT                   /protein_id="ADK69792.1"
FT                   /translation="MGAVTWAVVTIRWSPIGTDLRIANEKYAAAVNVVSVIAFTPDAFF
FT                   KQIRSAIEAKHQMTIIINGRESIVADRLGNQLILLVVLGFGLLGLVSGIILHFVLQSRN
FT                   KWEALESRLQVIESKIKN"
FT   gene            complement(597510..598400)
FT                   /locus_tag="MMS_A0563"
FT   CDS_pept        complement(597510..598400)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0563"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69566"
FT                   /protein_id="ADK69566.1"
FT                   /translation="MDKVTKFFGSIPEFFKRNYVLLILALADVAIMAIPFYMDNFIPNM
FT                   NANFRLAQSDYSQAGAIYGYVSLTCYILGAWLGDKFRAKSMVVLGIVITGVLGVWYVIL
FT                   PFVPLLAGNTDHVLQGAFRNLMVVQLCIIFAGFAFATCALFWAPLWKLVKNVNTEHLPK
FT                   ELQEKQVGKNNGIQGMLNGLIGLAIALFGTLLLELQNHEILGKVGGENGVSVGFLILIS
FT                   LYAGFIILSALLALFLIKEPKLQEPPSFSVKALVSVVKDKAVILLAILVLGVYMLQMGL
FT                   SSYVNYLKTCSEFLD"
FT   gene            598776..599996
FT                   /locus_tag="MMS_A0564"
FT   CDS_pept        598776..599996
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0564"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70080"
FT                   /protein_id="ADK70080.1"
FT                   /translation="MKKPKKNNDNVLIEINDLRFKYHKKQSNYDLLIDHLQIQKNQIIS
FT                   LLGPSGSGKTTLLNLLLGYIKPDKGSIHILNNPKIHEVAYIMQENSVYENTTVFNNVFL
FT                   SAKNYSKWVKQAYLNYFEKFLNNKELFSKKLINQFEVYKNLINDLNSKTKTKKQAFLKL
FT                   VFLCLFEKQVKHKFKFLKEIKLKNLFKNEIELISKKLGIDQLLYKNVNQLSGGQKQRVA
FT                   FAKGIIKKTNLVLLDEPFSALDAKIKESTIDWLIKIKKEFNLSMIIVTHDQQDALKISD
FT                   QIILLDKGKIQQFSSGEQMYNDPNNLFVAKFIGSPEINFIKKENDKSYYIRHNKIKVKP
FT                   NLNGKYQIIDKKSFGDKVHYLINFNKDIKWTLVLNDNSLQVNDLIDLKYNQSDVLVFNK
FT                   NGNRIYE"
FT   gene            599989..601002
FT                   /gene="gtsB"
FT                   /locus_tag="MMS_A0565"
FT   CDS_pept        599989..601002
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gtsB"
FT                   /locus_tag="MMS_A0565"
FT                   /product="glycerol ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69268"
FT                   /protein_id="ADK69268.1"
FT                   /translation="MNKFLLKFKQKDSFNLKLKLKKSLPVLKIILLMLPLLFLILLFTI
FT                   IPIFHTFIKSLRFAPNEANRTIYEYNFKNYNNILSDPNFQHAIINSTFVLLFGTGISII
FT                   LALIFSFIINSLISKSTKSVLLSVIYSQFFISGFAIGIAFTNFFGSKNLFFYILGLNQY
FT                   SFTSGNKRLPIWIYYAIYQIWRSLPFNLILFAAALSRSDYKYKKLMLNDKLTLLQSFRY
FT                   VYLNELSKVLFSILFTNFIFACLLLPSALLEDNFNVDLNYAHTLTSYTIKYFGWGSSGV
FT                   LRYERAHSAAFFSFSYLVLLLCLILLLRPKTIKSIYKLIKKVILKNRGKYESKNNN"
FT   gene            600980..601789
FT                   /gene="gtsC"
FT                   /locus_tag="MMS_A0566"
FT   CDS_pept        600980..601789
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gtsC"
FT                   /locus_tag="MMS_A0566"
FT                   /product="glycerol ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69318"
FT                   /protein_id="ADK69318.1"
FT                   /translation="MKAKIIIKEIIKYLLIALLCLLLLFPLYYLLLQALLSNSSILDNK
FT                   TYIFIKEWNWSNFLKAFQSNFIKAFGWTILFATVLISLRIIIYSLAIIGLLKMKPNYQK
FT                   VFLYFFIIISLIPEFSIFLSLKTILLQIHLEETPIAFISNAIFSFFNFTYIFNLAKSIE
FT                   TEKSKVMLNDNLKWYDKLFYVYLPKMKLGYFLLIIFSFISVWNDYLWPQFLISNADQFT
FT                   NITIWYQTLGREQEASLINVQAAGAMISVLVPLVIYMSFSKKIGRFN"
FT   gene            601916..603784
FT                   /locus_tag="MMS_A0567"
FT   CDS_pept        601916..603784
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0567"
FT                   /product="putative lipoprotein (LppB)"
FT                   /note="identified by match to protein family HMM PF03202"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69360"
FT                   /protein_id="ADK69360.1"
FT                   /translation="MRRKLLGLSAMALTMTAPFAAIACTTTKSDRILFATAQGAGWPLS
FT                   LALRPLVKYYNETYKNEAGFVPVKFKFADNPTKDPEIETHGITNQFQLIKKTKEDIETH
FT                   NTKALPNIVLGDQSGAYIINQDQRLLDISDQGIDKNTFSSKIAELHSILAGQNDTTKLY
FT                   NIPFDNADTNAVQINLRVMDKMFELIKKGGGTVEESSKIYKKVEASKKEKNKNDLPEKT
FT                   IWSALKVKEQKNGEKGSLSDIKLNDATLQSLKSLRDFAAKFTEGVEIDTSRVNGDTISG
FT                   EVLSIDYQEQEFYKELHSRINSDKPIFELDKSNDKNIPKVKYNLVQDDSIKQEFKNLWE
FT                   EWNKSIKRVEYKKETPNKKVFQSMKFMANGVKEWGSWNIFRFQSAISLASSVGANQNKI
FT                   TDFTRKHPYFSDDIKKDPKFDTNNAKDADVFMDSQITPSKGNKNGGTDITPSKTNPGIF
FT                   DEGGSSILPINVGNEKLNNGTKKFLKWIYTGKNKVSGIEEENWLTLAKTSGYIMPLKEV
FT                   VTKETVKKLEEIISKLETDLKSKDDITKEPEYFTLNMLRSSLLSLKSLVKLENGESVAR
FT                   AMVTDDKAAEITGNVAKALIGQTNIDGRTDTNADTLLSQFENIIKK"
FT   gene            complement(603996..605669)
FT                   /locus_tag="MMS_A0568"
FT   CDS_pept        complement(603996..605669)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0568"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70116"
FT                   /protein_id="ADK70116.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNDRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQEIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            605799..606134
FT                   /locus_tag="MMS_A0569"
FT   CDS_pept        605799..606134
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0569"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69490"
FT                   /protein_id="ADK69490.1"
FT                   /translation="MPLKEVVTKETVKKLEEIISKLETDLKSKDDITKEPEYFTLNMLR
FT                   SSLLSLKSLVKLENGESVARAMVTDDKAAEITGNVAKALIGQTNIDGRTDTNADTLLSQ
FT                   FENIIKK"
FT   gene            606331..606471
FT                   /locus_tag="MMS_A0570"
FT   CDS_pept        606331..606471
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69125"
FT                   /protein_id="ADK69125.1"
FT                   /translation="MKKLLALLTASTLLVIPTSSSFLINKVSNINANYYAENDNEIENK
FT                   N"
FT   gene            606522..606608
FT                   /locus_tag="MMS_A0571"
FT   ncRNA           606522..606608
FT                   /locus_tag="MMS_A0571"
FT                   /product="Small nucleolar RNA snR69"
FT                   /note="Small nucleolar RNA snR69; Rfam score 24.14"
FT                   /inference="nucleotide motif:RFAM:RF00475"
FT                   /ncRNA_class="other"
FT   gene            606722..608272
FT                   /locus_tag="MMS_A0572"
FT   CDS_pept        606722..608272
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="This ORF contains tandem Palindromic Amphipathic
FT                   Repeat Coding ELements.; identified by match to protein
FT                   family HMM PF03382; match to protein family HMM TIGR02167"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69689"
FT                   /protein_id="ADK69689.1"
FT                   /translation="MKYKGKTRGEDTYSKENEFDASGWGDTNFVVYELGYYDDGKGQIQ
FT                   AIKLPKGVVLVPKDLPKEITSLKELFKDAESFNDQNVKNWDTSNVEIMESMFEGAKKFN
FT                   QDISKWNTSNVVNMSQMFKDAKSFNQNINTKYSRDKNKYNMSWDVSKVKNMQSMFEGAE
FT                   KFNSDLYNWDTRKVSAMRDMFNGATSFSKDISNFDVKGVVDFTDMFKNATSFNKNLSNW
FT                   ALYDNEPTDLDSGATSWISYYKPRSKRDTSNIIKKSDEGYLNTTNSLYDEEITKLIDKH
FT                   KIEVEKQKAEAEVRKQKEIPNKIKDIWNKDFKGKLNSAQKFKDIFKEFQEKIKEDIDLK
FT                   SVSIKLANSSLENKRFRFDSTNTTIDTRIKVEPQSLDILLDNQTIKLEPGSVKRAWKAV
FT                   QFKGKTNGERASSKEDEWDISYWDDKDFEVYELGYYDDGEQIQAIKLPKDVKIIPDHLP
FT                   KEITSTKELFASSNQFNDENIKKWDMSNIEDTSGMFLGAAKFNQDLSDWNTSNVKKHE"
FT   gene            608265..609725
FT                   /locus_tag="MMS_A0573"
FT   CDS_pept        608265..609725
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="This ORF has 1 membrane spanning region. This ORF
FT                   contains tandem Palindromic Amphipathic Repeat Coding
FT                   ELements.; identified by match to protein family HMM
FT                   PF03382; match to protein family HMM TIGR02167"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70029"
FT                   /protein_id="ADK70029.1"
FT                   /translation="MSKMFLNAKEFNSKIFNKVDNVTDMSQMFLNATAFDQDLSSWKVN
FT                   NVKNMNSMFLGATKFNQNLNEWNVENVTDMSWMFKDTTSFNNELSKWKPKKAIDMSHMF
FT                   EGAIKFDQDISKWNVSSAKNMKDMFKNASTFNQDLKDWDITSVSNMEGMFELATKFNGD
FT                   ISSWDTRNVESMSGMFKGATSFNKDISNWDTSKVKDMSYMFSDAINFNQNINTKDNSNK
FT                   KTWDVSKVTDMEGMFSGATKFNSELSKWNTSNVNNMRKMFKNAKVFNNNISNFDIKNVK
FT                   YFNNMFENASTFNQDLSKWSFKHLGNNKNIDTESYDLNATSWKAEWKPDSSSNTPAQPA
FT                   PVEPTPTPNPVQPTPVPQPQSVPTPHKPVDPVKPDKPDQPIKPDESLKPVDPKPTDSTK
FT                   PITPTKPIQPTDNKKPESKPIQPTEDKKPIQPKTPENKPDNQAKPDNKTQTKNVNNKTA
FT                   FVAVSAVSILAILAISSVVILIKKKKNK"
FT   gene            complement(609776..610129)
FT                   /locus_tag="MMS_A0574"
FT   CDS_pept        complement(609776..610129)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0574"
FT                   /product="transposase InsK for insertion sequence IS150
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69312"
FT                   /protein_id="ADK69312.1"
FT                   /translation="MLDKALKKVKNTNGLLIHSDQGFHYQHISWAKKLEENNITQSMSR
FT                   KGNCLDNAIIENFFGLLKQEIYYGEKYNSVEELTKRIHKYIYWYSNIRIKEKLKGLSPV
FT                   QFRKQSCYNIEKF"
FT   gene            complement(610144..610500)
FT                   /locus_tag="MMS_A0575"
FT   CDS_pept        complement(610144..610500)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0575"
FT                   /product="transposase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69938"
FT                   /protein_id="ADK69938.1"
FT                   /translation="MTIFSKSFETYGYRRLKMALKSKGYIVNHKKILRLTKELGVQCIK
FT                   FRTKNGRYSSYKGTVGKIADNVLKRNFHSLQANKLWCTDVTEFKVNGQKLYLSPIIDLY
FT                   NDEIISYSFKPILT"
FT   gene            complement(610487..610636)
FT                   /locus_tag="MMS_A0576"
FT   CDS_pept        complement(610487..610636)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0576"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69206"
FT                   /protein_id="ADK69206.1"
FT                   /translation="MLKTHKKVKIPILLKIAKLPKSSFYEWKHKLENTIDKDKELKEMI
FT                   VDYF"
FT   gene            complement(610645..611187)
FT                   /locus_tag="MMS_A0577"
FT   CDS_pept        complement(610645..611187)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0577"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69672"
FT                   /protein_id="ADK69672.1"
FT                   /translation="MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRF
FT                   EAFGIEGLINKEKKPYYSAKLKLKIVLYKLETNHSYDEVAKKFNIIYSSTIAGWVKKYR
FT                   EYGFLGLNNNIGRPKKIMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEFWK
FT                   KFHTLLTKEKSTRKKQK"
FT   gene            complement(611264..612442)
FT                   /locus_tag="MMS_A0578"
FT   CDS_pept        complement(611264..612442)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0578"
FT                   /product="oxidoreductase, FAD/FMN-binding protein"
FT                   /note="identified by match to protein family HMM PF00724"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69183"
FT                   /protein_id="ADK69183.1"
FT                   /translation="MNKYKKLFEPFELNGFKLENRFVLSPMTLSLATLDGKITTQEADY
FT                   VKRRAHSAPLQITGGVYFDEFGQLFEYGISAKSDDDISSLTSLYQAMKTDSNCVILQLA
FT                   HAGKFSKTSLKKYGYLYGPSYEKNHTPIEHEVLELPKEKIKQIIQDYKDATLRVIKAGF
FT                   NGVEISMAQRLLMQTFFSQIINKRTDEYSTTTFENRSRFCLEVVKAIREVIDKHAPKNF
FT                   IFGFRATPEETYGDILGYTIEDFIQLVDKIIEIGKISYLAIASWGHDIYLNKVRSNTKY
FT                   KNQLVNKVIYDVYKNKLPVISSGGINTPDKCLEALKYSDLVGLSSVFVADPEFVLKIKN
FT                   EQIDQINLSVKHDQLKDLKIPESSFQDVVNMFSFCETIPSETIKTFENNSKE"
FT   gene            complement(612442..613479)
FT                   /locus_tag="MMS_A0579"
FT   CDS_pept        complement(612442..613479)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0579"
FT                   /product="lipoyltransferase and lipoate-protein ligase"
FT                   /note="identified by match to protein family HMM PF03099;
FT                   match to protein family HMM TIGR00545"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69399"
FT                   /protein_id="ADK69399.1"
FT                   /translation="MVLIEPIRNGKYIKDGAYWLAIQIWAASNLKIDDTIVFPSIADPH
FT                   IQMGYFQNPEVEVNFKYLKEKNLEIVRRATGGGTIYIDSNSVNICYLIPYKKGTEILGN
FT                   YAKFYEPTIKILKELGAKNITQSGKNDLTIDGKKVSGAAMMLLDDVIYGGNSLLYNVDY
FT                   DAMSQVLNPNRKKIEAKGVKSVSQRVAALSQYLDEPYRNLDIFEFKDLMIKKIFNVDDL
FT                   KDVNRYIMTDKDWEQVDELIKTRYKNWEWTYGLSPRYEYNRDARLAIGTINFSLAIENQ
FT                   RIEKIKISGDFFAKKDLLELEKALIGTKMTHEDLLKAFNDADLQSYFFNEIKPEEVVKI
FT                   ILDEE"
FT   gene            complement(613457..614314)
FT                   /locus_tag="MMS_A0580"
FT   CDS_pept        complement(613457..614314)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69035"
FT                   /protein_id="ADK69035.1"
FT                   /translation="MNANLNIDQLDNLINQNDSLIIAIGSEIYQTDNQIEFENNFSDFI
FT                   KEFNFIDFKQASVYPFLDIKNYWAFFSRYIKLNYFDQKLDNSFIDLKNYLENKNYFIIT
FT                   TNRDNSLELAGFDLNKIFYLDSKLNLLECSKKCSEELYINDDAILNMANNQKNLKVELE
FT                   QIPVCKKCNSYLKVHQRFWCQVFIKDDEFLQTQNNYQKFINQNKDKKMLFWEIGINFNN
FT                   QLTVKKPFWQMIEKFDKATYLTMNKKIYRIPLEIRSKTITYTNDLNLVIKNLEEVKNGT
FT                   NRTN"
FT   gene            complement(614316..614660)
FT                   /locus_tag="MMS_A0581"
FT   CDS_pept        complement(614316..614660)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0581"
FT                   /product="putative calcium-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69645"
FT                   /protein_id="ADK69645.1"
FT                   /translation="MKKVIKFLVIEKIDDRNEYYLRMTSEMQDDIGTVSYLQFKNIDKK
FT                   HLKEDDIFLALEASKAILNLKMPLDATVVKWNQKALDNPKLISSHDENENWIMVLSDID
FT                   ETKFMSLEDF"
FT   gene            614847..615638
FT                   /locus_tag="MMS_A0582"
FT   CDS_pept        614847..615638
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69239"
FT                   /protein_id="ADK69239.1"
FT                   /translation="MNLIYDYNYVFKNNNNDNESIIFVHGYNSSPKTFEIFEKYWARSN
FT                   YYALQFPGSNLVKAVKDHKVSVEGFAKLLIDFIEQNQIKNVVAIGHSMGGGVISIAYKM
FT                   RPDLFKKLIFITPMNKPQRALYERYKIDYFPKTFDEYITNTLSSLYYDPSILTSNEEWM
FT                   KKAKQNFNPRMYDNDLIIKLGTPKAKTFQLIEKGLDSINIPTLLILGEKDGVILRDECL
FT                   KYFDQHVKGVESHWIKKTGHMVFEENFNEFIKIVENFLKIG"
FT   gene            615641..616441
FT                   /locus_tag="MMS_A0583"
FT   CDS_pept        615641..616441
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0583"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69648"
FT                   /protein_id="ADK69648.1"
FT                   /translation="MKKIIYYYDYIFKDNNNDTENVIFCHGFNASLNVFNIFKNYWTKS
FT                   NYYALQFPGNNKVEPIKNHEISVLQFAKLVVEFVKNNNLKNVTLIGHSMGGGTILLAYQ
FT                   LAPELFKKLVYVCPMNKASEDVNNNFLHDYFPKTFEEFTTDFLGSLYYDPSFLTKDPKW
FT                   MRLAKWHFSGNDYNTKELTDLGKTLVSKELHEQIYQAIKTIKIPTLLILGEKDGVVNRE
FT                   ACLKYYQDEVKNVITTWIPKTGHMVFEEDWDSFIKILEPFLLNK"
FT   gene            complement(616665..617621)
FT                   /locus_tag="MMS_A0584"
FT   CDS_pept        complement(616665..617621)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0584"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /note="identified by match to protein family HMM PF00056;
FT                   match to protein family HMM PF02866; match to protein
FT                   family HMM TIGR01771"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69111"
FT                   /protein_id="ADK69111.1"
FT                   /translation="MKKTANKVVLIGAGSVGTSFLYAAINQGIAEHYVLIDAFPQPAEG
FT                   NALDLSDTLAVIPHSFTSIKAGSYEDCKDADVVVITAGRPQKPGETRLEMVAGNAEIMK
FT                   NIATEVKKSGFDGITVIASNPVDVITHVYQKVTGFDPHKVIGSGTTLDSARLRRLVGQK
FT                   LNVKPESVQAYVAGEHGDSSVAIWSQANIMGRPILDYVKCGCLTLEDLDQIQKDTVDMA
FT                   YKIINLKRATFYGIGACLTKIVNAVLRDEKSTLMVGAQLNGEYKNKDLYTGVPAIIGSN
FT                   GWERIIEWDLTKEEQEKFDKSCETLHKTIDSVKHLFE"
FT   gene            complement(617673..618830)
FT                   /gene="nagA"
FT                   /locus_tag="MMS_A0585"
FT   CDS_pept        complement(617673..618830)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="nagA"
FT                   /locus_tag="MMS_A0585"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM TIGR00221"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70009"
FT                   /protein_id="ADK70009.1"
FT                   /translation="MILKNAKIVLENKIINNGYLIIKDKKILEIGSDYKKKNGIDLNNQ
FT                   WLLPGFIDCHVHGGYGVDFETGNKNRFKYFADNIIKEGVTRYIQTSVTNSVKKNNQIYK
FT                   EFGEFIKLNNGKAKCLGAHLEGPFISKFKKGAHQENLLLNPDINLTKKWNKLSNNSLKI
FT                   VTYASELDDGTYTQFLINNQIIPSIGHSNLKANQFEQPYLLGVRHITHLFNGMSGVDQH
FT                   NPGLVVASFNHKDVLCEIISDGIHLDKEILKMIYNFKTADNLCIITDSMNAKGLDDGEY
FT                   KLGNLEVYKKGIEIRLKNNNALAGAGSTYDHNVRVIKQVCDVKMTDLIKMTSINIAKQL
FT                   NIFDNTGSIEVNKLADLVVLDDNLYVNKVLVEGKIVFKNTKNKKL"
FT   gene            618999..619733
FT                   /locus_tag="MMS_A0586"
FT   CDS_pept        618999..619733
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69534"
FT                   /protein_id="ADK69534.1"
FT                   /translation="MLLSGITLINAFFNGILKEQWYFESNNLYQPTRLINYDILLSFFS
FT                   VQVSIITTIYLLIVVINYKNPNSNINTQRTRNIVLNWNLLDFMIFWIGIIGFKNTIAGQ
FT                   LPYLTKTQIFSTVITHFIVPLLLLFIYLFESGNNKYEIKKFYKNIKELFWVYSYPFFYT
FT                   LFVLMRAQIYLKDKNIDNFIYPYEFLDFTTPYIGNSKIGYLILIWIIFVIWLTLNHLII
FT                   LLINNLIFKIKNKKKEKIVTSN"
FT   gene            complement(619745..620329)
FT                   /locus_tag="MMS_A0587"
FT   CDS_pept        complement(619745..620329)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69871"
FT                   /protein_id="ADK69871.1"
FT                   /translation="MENKINHKTYKTLKYLLTISSVILAICLLLVFVQFTKAKPLFISL
FT                   TPFISLLVILLILSFTCLLVYIIYRVKILKTSNYKYIKKEIIYLYTSFSLYIFSFILTV
FT                   IYLIIALLIKNSESIRIMFYVVISIFFICIILSSVFETLSRLKEQILLYKQEYQSQQEL
FT                   KLNKEIDKKEQINKEVINNNNNQSKNPFIED"
FT   gene            complement(620334..621980)
FT                   /locus_tag="MMS_A0588"
FT   CDS_pept        complement(620334..621980)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0588"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69221"
FT                   /protein_id="ADK69221.1"
FT                   /translation="MKKVLSYFLIILIFFTSLFFINNKNQNQVNLTYNTQFNDNENNET
FT                   NKNSIKEFLWGGKALRYFLYKNSTAQTNKSFNQFTDYLLTNFERVFEKRTKRNFYKQQY
FT                   ITELQSEEFKHAILSSILVTSAYGSTSPEEFFAESFSRYVSANEKQKNLTWYLLERFFT
FT                   KTFYKLKQQNIGILPSNDKETNWKKIKNVIDSENDVKYKYELEPENHTLNSEYDRLNYF
FT                   DLGYHTNQYGYNNGLYIFETINYIYKNTFASQISNLDFLNLDRSVWNGDEFAHYYGVNY
FT                   DIFSDYMKLNLYKPKNIITTNSNDQFFKDFDQLDAYWKEKSKFNFGKSSAIQIKQNLEN
FT                   IWNSIPKPKTLNKDYFDLDKLKNNTVHLFNTLQKVTHNNLDNIFINLILTNDDRFKVNN
FT                   NLLDPKIKGITSTSFSKNTLSSSYSYVLIKADSFNKAENQEQYDRSWFASNNQFQTLNH
FT                   EFGHVLDSFLALNSFQTQLNKNTFSSLSFWADHQQANLYHGNIVISKNRNWSLYSIFIF
FT                   GVIGINLVLLILYIGYDKIFKPKNKKTIVIK"
FT   gene            622132..622257
FT                   /locus_tag="MMS_A0589"
FT   CDS_pept        622132..622257
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0589"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69942"
FT                   /protein_id="ADK69942.1"
FT                   /translation="MAKKIKQYLTDVLINKIDYYVSIKKFDFDTIKEMLALRFPV"
FT   gene            complement(622327..624000)
FT                   /locus_tag="MMS_A0590"
FT   CDS_pept        complement(622327..624000)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0590"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69416"
FT                   /protein_id="ADK69416.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKLATKDKNNRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            624239..626065
FT                   /locus_tag="MMS_A0591"
FT   CDS_pept        624239..626065
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69776"
FT                   /protein_id="ADK69776.1"
FT                   /translation="MAKKIKQYLTDVLINKIDYYVSIKKFDFDTIKEMLAIDLIDYEPY
FT                   MIQTIDKYIKYIIWLDQKNKNKSEAFLKFLDKYQQDLDDNSSLVEKNSLQTSSDNLNDY
FT                   QQRKKHQTWLDQYFRKQKTKYHVYEESPLDSQTKINNFEEFLQDQTNEEQVEEILDKDL
FT                   DLVNLITSDNTFYQNSTINLDDLKTNSDESIKDDLDDILLANQKLDELEEIELDPEEFG
FT                   AATVNIDKWETQNGSKNNQEIKQEVEPTLDEQDLTKDSWIEEKDLTSDLIKKIDITKDS
FT                   WIENDQQTNTSLDQKLISEPIVQNPEELVDNNQVEELSKEHWVEEKQEDKCECDKTCDQ
FT                   NLEKCSDDSCDQKTCCEVENTYQKEEDCEYEKQDKCSDNSCCEENKCCVDNSNCQEEYS
FT                   KKDGCECSVTNCDCESSCDQKQEELTEQLDHNISNQTEINKLWINQPETDLKQTNNQEP
FT                   LIKTNQNINNKIWTISPETDLKEYSNDRDFLDSKTDQEIINKTNQTNDLVDQETNNLDV
FT                   TSSQTDQTSNNEIITNQQVALNPNKNNETPKVIELNKPVKLYQQVKWNDKTYYVVGIKI
FT                   KKDVFGHEIPVLRLESQDKPYEITEVKLIKKY"
FT   gene            complement(626114..626653)
FT                   /locus_tag="MMS_A0592"
FT   CDS_pept        complement(626114..626653)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0592"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69232"
FT                   /protein_id="ADK69232.1"
FT                   /translation="MKKLLTILSSFGLIATTGASVVACKNDQSISLQPKKSENESLGSA
FT                   TKEEKKEEKTDNNQPSSLKSTEDQNTSLTSTPDNKELGSTGSIQNKEEEVTKIKGQLEK
FT                   LKESEQKAKVLLKQIEEGNNKAKEAAEQEKIRNELEKLNAQKPKIEEALKQIEETKKQL
FT                   EAKLQSLQTNTTESSN"
FT   gene            626932..627096
FT                   /gene="rpsU"
FT                   /locus_tag="MMS_A0593"
FT   CDS_pept        626932..627096
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsU"
FT                   /locus_tag="MMS_A0593"
FT                   /product="ribosomal protein S21"
FT                   /note="identified by match to protein family HMM TIGR00030"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69987"
FT                   /protein_id="ADK69987.1"
FT                   /translation="MASVIVHDGETIEKALKRFQKVASSNKAEARKREYHLSKKEKRIY
FT                   KQKQNRKYK"
FT   gene            627204..627764
FT                   /locus_tag="MMS_A0594"
FT   CDS_pept        627204..627764
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0594"
FT                   /product="putative Holliday junction DNA helicase RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69041"
FT                   /protein_id="ADK69041.1"
FT                   /translation="MNDYINGLLHKIDDKYLYIELNNSGYRFLYLKTDLKDLKLNQNNQ
FT                   VYVAINVIDNVFKYYGFKNQLIRDLFELLININTIGEKTAFLILENYNYNELIDIFKNG
FT                   RTDKILQLKGIGNYTARLIINSVQKELFNNKISDKKNKVITSLEKLGYKTKDIYKIIIN
FT                   IDEDMNIEDLTKYVLEQLSYLHN"
FT   gene            627781..628704
FT                   /gene="ruvB"
FT                   /locus_tag="MMS_A0595"
FT   CDS_pept        627781..628704
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ruvB"
FT                   /locus_tag="MMS_A0595"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF05496; match to protein
FT                   family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69807"
FT                   /protein_id="ADK69807.1"
FT                   /translation="MFRPEKWEEYIGQTNILDNLKVFIKSAKKQNKVVDHIFIYGPSGY
FT                   GKTSLAYLLAKQLKTNIRILNGPNLQKASDIISILTSIKEKDVLFIDEIHAVNKEVLEI
FT                   IYPVLEENKLNIIIGKDYNSKVVNIDLPKFTIICATTEINKIPLPLLNRFPINFTMQEY
FT                   NLEDMSKIIELYCNKFQIKLDQDIYLYLASFCRKTPRIAINLIKRIKDHIICDNPKIID
FT                   VNYIKKVLDKLEIYELGLTITEINYLKMITKNKRIGLDNIAHLLNTTPLIIANNIEPFL
FT                   IRESLIIRTIKEREITYKGLKYIQNF"
FT   gene            628782..630140
FT                   /locus_tag="MMS_A0596"
FT   CDS_pept        628782..630140
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0596"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69995"
FT                   /protein_id="ADK69995.1"
FT                   /translation="MQKFDVVVLGAGPGGYSLANILSLNNKKVALIEKEDLGGTCINKG
FT                   CVPTKTLIKSAKVFELVKNSQKFGINADNISFDFKKMQQRRLDNKKFFNNSIKNQIDLN
FT                   QISFFKGVGEVLDQNSIKVNDQIISFDKLVLATGTRAKIINFDGLEQSRKNGYLLDSDQ
FT                   ALFLENVPSSLTIIGDGPISLEFAYLYNTLGSKVTILTNTDFLLRFDIDIQKSVRQYFD
FT                   EKQIKVIENANIIKIDNNKVFYDQTSIESEKILLAVGRVPNNESFTKLDIKKDKNGFVI
FT                   VDEFMKTNFDNIYAIGDITGLTLLSSVAYKTGDIVARNILKTDSEKFDKNLVTWAIYLN
FT                   PEIAGIGLTEQQLKEQNIEFESIMINSKALPRAHADGIVNEYSFIKFLVSKQTEEILGC
FT                   FMMIENANILINQIGLFMQQKLSFSTLQKTVYTHPTIGEALYYTSRVKGIKTN"
FT   gene            complement(630156..630293)
FT                   /locus_tag="MMS_A0597"
FT   CDS_pept        complement(630156..630293)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0597"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69675"
FT                   /protein_id="ADK69675.1"
FT                   /translation="MSDFLYGNPEKLIAGYRIVRNLIRIDFLISLSDFILLYMAEIIKK
FT                   "
FT   gene            complement(630347..630928)
FT                   /locus_tag="MMS_A0598"
FT   CDS_pept        complement(630347..630928)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0598"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69829"
FT                   /protein_id="ADK69829.1"
FT                   /translation="MTVQQHLINNLLEENKKKSSKNKTAKSKIKVYTKTNITSLIDKYP
FT                   LRFQEMIYDLFDINNWSELKEFLNFRNEEIKSEMTPPSLITSQNNPENLEIVEQLKELV
FT                   NLMTSINLLSLTYESLDEIEYLFPKLGENKLIKNVNTEDVSYLFDNLLNKLIESVKEEY
FT                   LKYFDEDEQDILLLFDSIKSTNISLVKKHY"
FT   gene            631038..631958
FT                   /locus_tag="MMS_A0599"
FT   CDS_pept        631038..631958
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69254"
FT                   /protein_id="ADK69254.1"
FT                   /translation="MNFNKIIVENEKYYLNKYQYFYINKKEITKILNQINWPAIIVDTE
FT                   FFNKSHNKEEIQPTLYNDTQKDLVYILQYSFAKNLEEIYNRINRKAIKSLAIKRNYNDK
FT                   TYDFFKQYNLLKKSFINMCINKKIKTIIFAGQSNDKKIIESWVNENKNLLKNKKSDLFI
FT                   LDKTTNEYKINSLDIYQVLNHLSFVNLDNQSQQFYNPKNIQKGWIGENTITIPSLRKFI
FT                   DYAKDIFNDNNLNDTEDIYLSCCNALKLFSVDKISIDEFKVLNKSVKLAKTHCFNDVLK
FT                   ILYLIDFIYAFSKFKNTNNKYIKKD"
FT   gene            631967..633070
FT                   /gene="yqeH"
FT                   /locus_tag="MMS_A0600"
FT   CDS_pept        631967..633070
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="yqeH"
FT                   /locus_tag="MMS_A0600"
FT                   /product="ribosome biogenesis GTPase YqeH"
FT                   /note="identified by match to protein family HMM TIGR03597"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69618"
FT                   /protein_id="ADK69618.1"
FT                   /translation="MKSCLGCGSLLQTINKFEQGYVNDTEHAYCLRCFKIKNYNQLVDS
FT                   EINDQQFINKISTLVNENKNNGLVFYYVLDIFDLFGSRILEIENLIKDFKVILVVNKID
FT                   LLPKSIKLEKIRNYINNVFKTGCLKNLEIFLTSADRINLVEPLLNKVIKNNKNQQYFIG
FT                   ASNVGKSSLINKMLEINQLIPSIVVSKYFNTTLDFIEIQLDTNTTIFDSAGVSRKNSIA
FT                   NLMNKRFQSYCYFKKEIQQFTYQLTPNNSIFFSGVCWFDYLSSSNQKTNFHIYTNKEIN
FT                   LHRTNTKNVIRYWNNNRKNLIPYINNSEKIQVYEFKFTKEHLNNWYDISISGLGWINFK
FT                   VETEMIIKINIPSDQKTVLVSLNEPLI"
FT   gene            complement(633093..634301)
FT                   /locus_tag="MMS_A0601"
FT   CDS_pept        complement(633093..634301)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0601"
FT                   /product="ImpB/MucB/SamB family protein"
FT                   /note="identified by match to protein family HMM PF00817"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69211"
FT                   /protein_id="ADK69211.1"
FT                   /translation="MFNKTIIHIDMDAFFASCMQLKHPELKNKPIVISNSFDKSIISTA
FT                   SYEARKYNIKAAMPLFKAKKLYPQIISVKPDMIFINNISYQIWDFIKNNYTNKIEVASI
FT                   DEAYLDVSDLVKNTSVLILAKNIQKDIYDQFNLTCSIGIGFNRFSAKMSTSLDKPNGIT
FT                   LTTTSNFKDNIWPISINKMYGFGQSAAKLLNNTKIKTIKDLALLSDVEVYQLLNKKGLA
FT                   LKNEALGLGSDYINYLSNDYKSISKETTLNTPIYQYDEIETIILNLSKFISYKLHKNQL
FT                   LCKTIEIKIRYKIDEKLFDKQKHLTSRHKQITLKNYTNDFEKIYNSALDCFYSLYDQNK
FT                   GILLIGVGVSKLIHKNQNWVQLDIENQTKVDKNQIDNALKIENMIFDINKKFKKPVIFK
FT                   AKD"
FT   gene            634449..637193
FT                   /locus_tag="MMS_A0602"
FT   CDS_pept        634449..637193
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0602"
FT                   /product="membrane family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69950"
FT                   /protein_id="ADK69950.1"
FT                   /translation="MNKTNKKNILLLQSIIISVVIFFIFLKTNQNINITYVNKMITNTS
FT                   NNTNLSKENRSYYSLRDDYILFNQYQYNTGLCWDFSATKSLETSLMINNNEMYDLSEAS
FT                   ISINQKDLVGGGAWFFDYDQLIKENGISFESDFKFGDLYYVPNKGEYKTWLQNIYNSKN
FT                   IKSFRNQVKDVSFNRYDLLNIKKHIVNNGSLFVPIKNYATKENQNYKHISIKTNNKTKV
FT                   HELIHTNKINTHAVSIIGWDDQYLASDNSKGAFIVLNSDGYYSNNDGINFLPYNSKTII
FT                   NDLNGYEYIGDKLLISKSNNNFNNEFSNYYNTKNYGQKNYNSKAKNTNIFNTTQDVKIE
FT                   YQINNNLAKLYNINAYVYLNDLDVSDLFKINSDQNKITIQSKDKLKSGSYTVKLIYQYS
FT                   LLKDKTNTIKVKHEHRQIYLLDQTNTISANSYWNYNNKQHLVFHNYNSFVANDNLPVIL
FT                   IDKNNNLNFEYKPLYLYSDKKDKISYKINQKDILKPENILNKDQNEFQLDIDKYVDNKK
FT                   IASNKYQFYRLDNNINYYFAKIYLTNNTKIKNLANEIPFFKNSYFHKKHLETPANNSLK
FT                   FLKYVYINKNGEEQDLLFDQSKNKYYISYEIINSLKTNVLDLNYIGNKYKTNNQTYNTP
FT                   IIIKPIFKEKEPILIINNIKKDYLTNQKINDEFDIKIINNNQIQHIKPNVKIKNINNEY
FT                   INTIKYNDNKIILEFEYNNKTYNLDFHINPVKRIINIKPKLENTFIYDTNYHKLEFDTP
FT                   IDKNIIKITNNEHINSGNYITTLEIIDNNYVFNNNKNKLEFRWSIKPKKISESSIINKD
FT                   KLIFDNKVLYSYDNKVFKEYHSLDKLEIPFNKIVYFKYKDDLNHDSSSIIKIDLEKYNL
FT                   QNNKSKNILIIVLSIILPISLITIITIIIIIIIITNKNKKHIK"
FT   gene            complement(637334..639007)
FT                   /locus_tag="MMS_A0603"
FT   CDS_pept        complement(637334..639007)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0603"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69554"
FT                   /protein_id="ADK69554.1"
FT                   /translation="MKKSRNDVKGQWRTSIARVKKGEYLSIGVPRSDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADSNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYVLDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNNRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            complement(639222..639839)
FT                   /locus_tag="MMS_A0604"
FT   CDS_pept        complement(639222..639839)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0604"
FT                   /product="putative uridine kinase"
FT                   /note="identified by match to protein family HMM PF00485"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69898"
FT                   /protein_id="ADK69898.1"
FT                   /translation="MSKKVSIILIAGGSASGKTTIASKIANEILKDKSVEHISMDNYYK
FT                   DFTNLSLEQRNHINFDHPNSIDIDLLIKDLKQLLKRHDIFVPTYDYKKHIRTNKEKLIK
FT                   ASDVIIVDGIFSLHFEKLRELGDIKIFVKTPDDLRFIRRLVRDIKERNRTIESVIDQYL
FT                   TDVKPMHDLFIEQTIDYADIVFKKGNDVAIDIVASKIKDLLN"
FT   gene            complement(639863..640303)
FT                   /locus_tag="MMS_A0605"
FT   CDS_pept        complement(639863..640303)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69843"
FT                   /protein_id="ADK69843.1"
FT                   /translation="MMKKYLFNLLTIIYMFMIVIIANESFGYGHNAQLHLLGRVNPAYG
FT                   LAVSGIVLSSLLLVIPFLLIFVKQTRKVEKILFITNFVIFVINIVLLFLASIFFIVNKI
FT                   GTIGSHIGIIVLYLTVVGIVCQNYSNIFKIKLNKKNKLNTDK"
FT   gene            complement(640376..641725)
FT                   /locus_tag="MMS_A0606"
FT   CDS_pept        complement(640376..641725)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0606"
FT                   /product="putative dipeptidase"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM TIGR01887"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69226"
FT                   /protein_id="ADK69226.1"
FT                   /translation="MKIDEKELISKYFDQALNETKKVVSIPSFLTESTADAPYGKACKE
FT                   VLDYVIDLANNLGFQTYKDKNNKYGFVDYGTGEKLFVILAHLDVVPPGNIEQWVTDPFT
FT                   PIIKDNKLIGRGTFDDKGPAMMNLFALKYLKDHNYVSSKYKIRLIFGLTEETTWDSIKT
FT                   YVNDHGVADLGYTPDGEFPVVYAEKWITNLDIISDEPTDIQISGGAAYNVICDTVSYKG
FT                   PKIKEIQDYLIKNNITTKIEDDKLIVQGKAGHGSLPWYGVNAATWLAKSMYENNVHHKI
FT                   TDYLATNVHLDFNLKNVFGDISDETGELTQNVGLIEIKNKNSRIGLNFRIPVFTNPTQI
FT                   FIPTLTKYLEKINLSLEVKKIDNSLYVHQESDLIKKIMRVYQEVTQDYKAKPIAIGGGT
FT                   YAKAMPNVVAFGAEFDIENSTMHAYNEYVKIDDLKKMLEIYTKAIVLLTE"
FT   gene            complement(641881..642561)
FT                   /locus_tag="MMS_A0607"
FT   CDS_pept        complement(641881..642561)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0607"
FT                   /product="thiamine monophosphate synthase/TENI"
FT                   /note="identified by match to protein family HMM PF04131"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69839"
FT                   /protein_id="ADK69839.1"
FT                   /translation="MNLIDQIKNTLIISCQAVDDEPLNDSYVLSKMCYALVLGGAKVLR
FT                   LSQVEHIKKIKEVVNVPIIGLIKKHYDNSEVFITPTIKEVDQLVDLKVDIIALDATLRK
FT                   RPDQDLTNLIKTIKTKYPNQLLMADCSNINDAINAQNLGFDLISTTLRGYTKDTLNHNN
FT                   IENDYQFLKDLKKVITKPIIAEGGIWTPQQAKEILNLGIHSIVVGSAITRLHLIVKYWN
FT                   DNLK"
FT   gene            complement(642620..643495)
FT                   /locus_tag="MMS_A0608"
FT   CDS_pept        complement(642620..643495)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0608"
FT                   /product="ROK family protein"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69167"
FT                   /protein_id="ADK69167.1"
FT                   /translation="MTNIKKYLSIDIGGTSIKYGIFNENLNPLFINSITTIPIKDELLK
FT                   QIIDIIISSLPLDGISIATAGVVDKNGVIKFANQNIKDYFNFDLKTYIKDFLITYKNLV
FT                   PIEIINDANSASYIEYVNNKTIKNSVTLTLGTGVGMGIILNGELFLANNGIAGEIGAIK
FT                   NFNQYIDTDLSWTKFIKKLNQNKYHYNSNDIWTLYNKNDFYKTEIENYLDKLVNLLCTI
FT                   SYILSPQVIYLGGGFSYCSEQILGLINNKFKKEFVFYDINPINIKYTSNKNDSGLLGVL
FT                   HLLVDKHFKN"
FT   gene            complement(643534..643935)
FT                   /locus_tag="MMS_A0609"
FT   CDS_pept        complement(643534..643935)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0609"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04074;
FT                   match to protein family HMM TIGR00022"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69877"
FT                   /protein_id="ADK69877.1"
FT                   /translation="MIYNKISNLNRYLNLHKNIDFAIKFILNNNLKELKDGINVISDTL
FT                   FYNKFITNTIDINNAVFESHKKYLDLHILISGDEFIGHEFVDDLNEQVEYNLKDDVYLY
FT                   RTKTKKTIYQNNQSFAFFFNRCPFTKNQS"
FT   gene            complement(643944..645647)
FT                   /locus_tag="MMS_A0610"
FT   CDS_pept        complement(643944..645647)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0610"
FT                   /product="transporter, SSS family"
FT                   /note="identified by match to protein family HMM PF00474"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69522"
FT                   /protein_id="ADK69522.1"
FT                   /translation="MNNLIFLQSTSQSTSKSFHWADYLVLVIYLLFTLGIGLYFQFKSK
FT                   LQKAENTDEYFKAGGKTPGWVAGFSIYATTLSAITYMATPAKAFSTDWLFAFGNLTIFI
FT                   ATPLLIRFIIPFFKKLSDVSGYGFLEKRFSYFLRVAASLMFILFHIIRVGLIIYLPTIA
FT                   LTAVTNINPYLIAVIIGIFCVISTVLGGLNGVIWSDFIQAVVLIGGILLAIIFALIKMP
FT                   NLNEVNSIVINNHKLLAKESIIPQSWAKPWILVLFFGQLINTFYQYIGSQDVVQRYQSN
FT                   QSFKQVKKGLWTNAILSLITILLFYGMGTLLYAFYVQKTGLTSIDEIMKNIGTNANNQI
FT                   LPYFIVTVLPVGISGLIIAGIYSASMSTISSSLHSAATCIVEDILIRIKPDLKDKQKMY
FT                   WAKGLILGIGLLGTIAALVLIVTKADNLLDLFAAIIGLFGTSVTVIYLLGIFTKRTSNT
FT                   GAILGAISSFIIVFVIFIINKTTKIAISDFYGIILAFVIGLLVGYLSSFIFKNKKLNQL
FT                   EGLTVHTFSKQDFNKMVEDGEKEWQKIKASESQFKKDLINKIKNKKVAKN"
FT   gene            complement(645649..646536)
FT                   /gene="nanA"
FT                   /locus_tag="MMS_A0611"
FT   CDS_pept        complement(645649..646536)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="nanA"
FT                   /locus_tag="MMS_A0611"
FT                   /product="sialic acid lyase"
FT                   /note="identified by match to protein family HMM PF00701"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69991"
FT                   /protein_id="ADK69991.1"
FT                   /translation="MKNLKGVFAALLIPYKSDGSIDEQALEKFIDYNIEVSNVDGLYVN
FT                   GSTGEAFLLSNSERKRILEIVAKHVNKRVPLIAQVGSLNIYESIEQAKLAEQLGYDAIS
FT                   AVTPFYYKFNLDQILNYYKEIKKSTSLPLIAYYIPILSGVNFSLEAFEKLFAINGIIGV
FT                   KFTATDLYTLERIKAKFPDKLVFYGFDEQQLSASIYNIDGVIGSTFNVNAKKAKKLFEL
FT                   IKNGQNQQALELQKEINDFIEIVLANGLYAILKEIIKQHYDLNEVFCRLPMTQVISQYA
FT                   LKAKEIKDKYLTDI"
FT   gene            complement(646700..646981)
FT                   /gene="rpmA"
FT                   /locus_tag="MMS_A0612"
FT   CDS_pept        complement(646700..646981)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmA"
FT                   /locus_tag="MMS_A0612"
FT                   /product="ribosomal protein L27"
FT                   /note="identified by match to protein family HMM PF01016;
FT                   match to protein family HMM TIGR00062"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69823"
FT                   /protein_id="ADK69823.1"
FT                   /translation="MRFLLGLQYFASKKGVGSTKNGRDSESKRLGAKKSDGQFTNAGSI
FT                   IYRQRGTKIHPGLNVGRGGDDTLFALIAGTVKYEKFGKNRTRVSVIPN"
FT   gene            complement(646983..647246)
FT                   /locus_tag="MMS_A0613"
FT   CDS_pept        complement(646983..647246)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0613"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04327"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69253"
FT                   /protein_id="ADK69253.1"
FT                   /translation="MKGHANSDEYGKDLVCAGLTAIVSGALNAIDSYYKNDVDIEVLKN
FT                   KITIIVKQENNNNLQLMLDMLKIQIQTITIQYPKNARIKEVS"
FT   gene            complement(647300..647602)
FT                   /gene="rplU"
FT                   /locus_tag="MMS_A0614"
FT   CDS_pept        complement(647300..647602)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplU"
FT                   /locus_tag="MMS_A0614"
FT                   /product="ribosomal protein L21"
FT                   /note="identified by match to protein family HMM PF00829;
FT                   match to protein family HMM TIGR00061"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69743"
FT                   /protein_id="ADK69743.1"
FT                   /translation="MFAIIRTGGKQIKVEQGQEIFIEKIKGEVNDKIAFDEILMIDGKI
FT                   GTPTIKGAKVLGTIIKQGKAKKIRVIRYHPKKNVNKIYGHRQPYTKVKIDEISAK"
FT   misc_feature    complement(647609..647682)
FT                   /note="Ribosomal protein L21 leader"
FT   gene            complement(647746..648147)
FT                   /locus_tag="MMS_A0616"
FT   CDS_pept        complement(647746..648147)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69398"
FT                   /protein_id="ADK69398.1"
FT                   /translation="MKEINLENTKEIIGGAGVSGALINGIAKVVESGFEGVSNLITDIA
FT                   SVGFAFYQASKNPIKAEYKIGNNSFKIDNTKLVDLKIEQAKAQEIKIPVLEIGNNKNNI
FT                   KINYNDAYNNDEQISNIYNDFDQNISIFN"
FT   gene            complement(648170..649057)
FT                   /gene="yraL"
FT                   /locus_tag="MMS_A0617"
FT   CDS_pept        complement(648170..649057)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="yraL"
FT                   /locus_tag="MMS_A0617"
FT                   /product="S-adenosylmethionine-dependent methyltransferase,
FT                   YraL family"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69988"
FT                   /protein_id="ADK69988.1"
FT                   /translation="MIIQKTYKNTKPTVYLITTPIGNLEDITLRAIQTLKQVDIICCED
FT                   TRTSKVLLDKYQITNNLLSLHKFNENLRIEQIINLLNQNKNIAIISDAGVPIISDPASY
FT                   IINQLKELEINCNITAIGAGSAYIHALISSGFLIDSHYFYGFLKNKNKISKQNELNQLI
FT                   NKYGDSIICLYESVHRLKDTITCLNQLLNKNHKIAIAKELTKINEEIIYGNIDQINQYI
FT                   YSDEFVLKGEFVIVINKKINNETTTYSDIQLIDLIDQEIKNGYKLKQACEIINLKTKIS
FT                   KNVLYKLYTFKKNF"
FT   gene            complement(649603..649956)
FT                   /locus_tag="MMS_A0618"
FT   CDS_pept        complement(649603..649956)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0618"
FT                   /product="integrase core domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69389"
FT                   /protein_id="ADK69389.1"
FT                   /translation="MLDKALKKVKNTNGLLIHSDQGFHYQHISWAKKLEENNITQSMSR
FT                   KGNCLDNAIIENFFGLLKQEIYYGEKYNSVEELTKRIHKYIYWYNNIRIKEKLKGLSPV
FT                   QFRKQSCYNIKKF"
FT   gene            complement(650188..650463)
FT                   /locus_tag="MMS_A0619"
FT   CDS_pept        complement(650188..650463)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0619"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69649"
FT                   /protein_id="ADK69649.1"
FT                   /translation="MLKTYKKVKIPILLKIAKLPKSSFYEWKHKLENTIDKDKELKEMI
FT                   VDIFSKSFETYGYRRLKMALKSKGYIVNHKKILRLTKELGVQCIKL"
FT   gene            complement(650472..650651)
FT                   /locus_tag="MMS_A0620"
FT   CDS_pept        complement(650472..650651)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69247"
FT                   /protein_id="ADK69247.1"
FT                   /translation="MKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEFWKKFH
FT                   TLLTKEKSTRKKQK"
FT   gene            651189..652628
FT                   /locus_tag="MMS_A0621"
FT   CDS_pept        651189..652628
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0621"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69721"
FT                   /protein_id="ADK69721.1"
FT                   /translation="MPRPDNKGFVYRLGYGYLHELKQYHDDPLAIIKAIIANFPLSWTK
FT                   EQARTKLDEIFKEKKETKKEVLERFKGYEVVEKLFDYFNIFNDCSPTKSTTLKDVVLQL
FT                   IYQRIKNPISVFNTYKTAKKEKIDTHSKNSFYRSLDYIAKNKDEILRNLNAKICANTNR
FT                   KIDVLWFDATTTYFETFSREGYKKPGYSKDGKFKEDQIVIGMATDENGIPLHYKIFPGN
FT                   VADPNTLIPFMLEIADIYEVNSVTIIADKGMSVNRNIRFLESKNWKYIISYRMKAGSKQ
FT                   FKEYILDEKDYINDGGLIYKTRDIASSYNKKRINGHFRRQIISFSQKRATKDKNDRDIL
FT                   IQNFTKKMNKDNLVSCDDLAGSKKYRFFKPINKGAFYELDIEKIQEDQKYDGYYVYETN
FT                   RTDLSVKEVINLYSKQWQIESNFKTLKGKLSGTVPNVFINLKPYCWLHLFMFHFISVFK
FT                   LHHLHSKFKIRTDWKKQNHWA"
FT   gene            652630..652782
FT                   /locus_tag="MMS_A0622"
FT   CDS_pept        652630..652782
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0622"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69944"
FT                   /protein_id="ADK69944.1"
FT                   /translation="MINVIKEVKEIEVFVNKQKIETIQVYNDELQESWQTYQILLELLT
FT                   KEKVT"
FT   gene            complement(653017..653382)
FT                   /locus_tag="MMS_A0623"
FT   CDS_pept        complement(653017..653382)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0623"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69307"
FT                   /protein_id="ADK69307.1"
FT                   /translation="MPQATIKEAVTKKLSISPSKLQKFEVDYEKKIVKVISSKSNNQEI
FT                   EFTFTSFLDLGKIQTTIKNGRSYTNIKKIKKTIAKKMGVNQDELKEFDVNTNDTGTVHS
FT                   TKFSGTLAFKFSSNDTK"
FT   gene            complement(653717..654391)
FT                   /locus_tag="MMS_A0624"
FT   CDS_pept        complement(653717..654391)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0624"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70083"
FT                   /protein_id="ADK70083.1"
FT                   /translation="MKKLLTIFGSISLISMTSITSIACKNINKSKKEDPSKPDRTPKTP
FT                   ENDSTKPEENQPKKPDDKKPNNNDNSSNDSNSNSNPNNKPDSTKPSENPKKPNEQHQGD
FT                   DPNNHQPQADQLEKSEQPKRTKEQNFELIKKYGAEVLALLESLSEDKTEQLYKKPENSE
FT                   LLKLVTNIGQFYQKLGSSTTIDDFEKEFKEKKFLNKLYEEWDKTVTEYEKQKDSILEIL
FT                   KQ"
FT   gene            complement(654488..655900)
FT                   /locus_tag="MMS_A0625"
FT   CDS_pept        complement(654488..655900)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0625"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69474"
FT                   /protein_id="ADK69474.1"
FT                   /translation="MAIPKDILKIPRPSSTRVKTTSKEGIYNVIQRTSIRKNGKIIPVE
FT                   KGVIGKIINGVFQSIEKQTYEVDIKSYGLFALNEKLNNHIFRELLNFYDFEDARKLYVI
FT                   ASLRTMFSDIKNEHLKHEYDTNFISEIYPKCALSSNTISSFLEKIGKSSSKMEDFMNKR
FT                   LEEFSNHSIVIDGMLKNNTSETNIFSEMSRKSRTKGSQNLNLIYAYDINAQEPVASSVY
FT                   PGNMLDYTAFRDFLRTYEIKNGFLILDKGFDDKECKNLMREKNIKYLIPIKINHTFKKF
FT                   NLKSGFNFTFTYDDDTIRAKKIIINNKYYFCYKSTLTEMVEKKNFISRAHKKGAYDEIK
FT                   LLERENLFGLIIFECNYDLDLKDIYVAYKKRWEIELLFKQFKNVLEQNEANVQGNYRLL
FT                   ATEFINFLSSIMLCRIKNHLLNSGVLDNRTISETFRYLSKIIKKRKSRKREEWDDVETL
FT                   KYIKEMKSILKI"
FT   gene            complement(656948..657640)
FT                   /locus_tag="MMS_A0626"
FT   CDS_pept        complement(656948..657640)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0626"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69608"
FT                   /protein_id="ADK69608.1"
FT                   /translation="MANNALSWEQKNKPIPKSDKKSVKVQARVKEIWNKELKDKIVVAE
FT                   GENVKKTEILEKTKEVLKKHTSDLEISDIKLFDDEKDKYITRDIENKLNQIIKIKINDR
FT                   IGFVLDIGYTIQEAIYIDSVAPTTNAGAFDAYDKDKVIEAFILKNPQLRGLTKDNFEVV
FT                   GQATNNSVTVKVKNSDKFQGQITINFTIRTQINTQNNKKIIIASSAGVGGVGILGSIVA
FT                   LFRRRKKK"
FT   gene            complement(657667..658383)
FT                   /locus_tag="MMS_A0627"
FT   CDS_pept        complement(657667..658383)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="This ORF has 1 membrane spanning region. This ORF
FT                   contains tandem Palindromic Amphipathic Repeat Coding
FT                   ELements.; identified by match to protein family HMM
FT                   PF03382"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69208"
FT                   /protein_id="ADK69208.1"
FT                   /translation="MKNLLTILKAVMAFSGAKNHSHTEHNLTTLTNKSEINTRESINDN
FT                   ILQEQDNEFDPLNQNRVTKIGWTQGNKIRPFPKNVNEVPESLPSHITNLDSAFAFNTNV
FT                   KIKGIEKWDTSKVTNFRRVFYVAPKFNQPITWDTSSGVNFISMFHGAESFNSSLGNKFN
FT                   TSKGEWFFGMFQAAKSFNQPLGDKFDTRNAKDLEAMFAIAQAFNQPLPENFLIKEGVGV
FT                   TSMFYYAYKFNKTYHI"
FT   gene            658892..659164
FT                   /locus_tag="MMS_A0628"
FT   CDS_pept        658892..659164
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0628"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69813"
FT                   /protein_id="ADK69813.1"
FT                   /translation="MNGVVEYQKNYYAAFDKNEKRYKFNKNKNIEFVIGADENLYFRTE
FT                   TMCFKAEILEKGSHDWVIADIAKRKQLDEERKHGSDTLGTINKTR"
FT   gene            659510..660535
FT                   /locus_tag="MMS_A0629"
FT   CDS_pept        659510..660535
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0629"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69892"
FT                   /protein_id="ADK69892.1"
FT                   /translation="MKKLLSLLACSFVITTSASFAISCKTIYKQFKEFENLINQSENKT
FT                   MILYLGARGNKSAKSFEQGLEELTKTNSLDQAIKNINETSTNDATSFIYKFKSNLSWNS
FT                   TNNHTKVLNDVEVKKNKNSKTKKERWIIDQKASPSSKQIFKNMTNDVVIKNFKYDSDDK
FT                   IWTKGLTSKILNEYLVKNWAKAFYGETSSSFNKNDNTVTDKVEKLQDKVKNLKGPLFLI
FT                   LRDKMFYGIVSGFETFSKQDQKNATKTIDNYPNGSDIRKNVYDQWIGYLKQAIEMYDVV
FT                   KLLQDTDPMITPKTEWKYQGTNKVEDKKDDKKSDKDQKEKPKEEKPAPAPQPAPAPTPA
FT                   K"
FT   gene            complement(660634..660722)
FT                   /locus_tag="MMS_A0630"
FT   tRNA            complement(660634..660722)
FT                   /locus_tag="MMS_A0630"
FT                   /product="tRNA-Leu"
FT   gene            complement(660733..660808)
FT                   /locus_tag="MMS_A0631"
FT   tRNA            complement(660733..660808)
FT                   /locus_tag="MMS_A0631"
FT                   /product="tRNA-Lys"
FT   gene            complement(660813..660887)
FT                   /locus_tag="MMS_A0632"
FT   tRNA            complement(660813..660887)
FT                   /locus_tag="MMS_A0632"
FT                   /product="tRNA-Gln"
FT   gene            complement(660895..660978)
FT                   /locus_tag="MMS_A0633"
FT   tRNA            complement(660895..660978)
FT                   /locus_tag="MMS_A0633"
FT                   /product="tRNA-Tyr"
FT   gene            complement(660985..661060)
FT                   /locus_tag="MMS_A0634"
FT   tRNA            complement(660985..661060)
FT                   /locus_tag="MMS_A0634"
FT                   /product="tRNA-Thr"
FT   gene            complement(661186..661809)
FT                   /locus_tag="MMS_A0635"
FT   CDS_pept        complement(661186..661809)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0635"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69388"
FT                   /protein_id="ADK69388.1"
FT                   /translation="MKLNDKLKNFFNNIKSYFTTKEKIIVKNKPKPIETKTENNNNNLD
FT                   NNSQFYHDISNNKEYIDKRATLDSQNEFILKVISNKAELLEQLVDIKNTFKHCEDCLNI
FT                   YKKNLDDMKLKILRLKKHIDNNYGFLGDEKEYQNYVFIDDIKTYSQTDESAGLKLVHKL
FT                   EDHFNKYSNYDIDYFVPCDNHKNLIDKYKIVSIKIKDLDKIISN"
FT   gene            complement(661858..662796)
FT                   /locus_tag="MMS_A0636"
FT   CDS_pept        complement(661858..662796)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0636"
FT                   /product="acyltransferase"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69786"
FT                   /protein_id="ADK69786.1"
FT                   /translation="MNQVNSMQEPISQNNKEQEKKVKDHIHVNPWKMLFMWLPLLHIKF
FT                   KAAKIVRKNKKQPDRYTEEYRYNWVKKAVSKLLYVLDVNIKVEGIENWIDKGVILAANH
FT                   QSNIDPAILFAINDFSKQQPLAFIAKEELWTSKKFKNFVRLIDCIPLNRKSPRSALEAF
FT                   KEAKDLVVDYKRSLVIFPEGTRSHSQQMNSFQAASLKVAQMSHAPIIPVSIINSYQVFA
FT                   EKRPKKVEVKVVFGKPISPNKHISLKTEDLTRFVEKIVDTNLKEWENKEMKYELRKLTK
FT                   KDIKQLKEEEKKQNSKKQEKKSIKDLFKIVD"
FT   gene            complement(662992..663324)
FT                   /locus_tag="MMS_A0637"
FT   CDS_pept        complement(662992..663324)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0637"
FT                   /product="putative holo-[acyl-carrier-protein] synthase"
FT                   /note="identified by match to protein family HMM PF01648;
FT                   match to protein family HMM TIGR00556"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69251"
FT                   /protein_id="ADK69251.1"
FT                   /translation="MINNVGIDIVENKRIKLKKEFIIKVLSTNEIQTFNTKTKKQKKEF
FT                   LAGRWAVKEAIIKTLDQAISMNKIDIEYVNQKPVIQNKELQNILISISHEKKYAIGIAL
FT                   KQSDNK"
FT   gene            complement(664223..664393)
FT                   /locus_tag="MMS_A0638"
FT   CDS_pept        complement(664223..664393)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0638"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69592"
FT                   /protein_id="ADK69592.1"
FT                   /translation="MLFCLSALLIYNLNSLKNNSNNIVLKQENKQETDLSKIFNNQTYI
FT                   SIKSKDQNIDL"
FT   gene            complement(664467..664949)
FT                   /locus_tag="MMS_A0639"
FT   CDS_pept        complement(664467..664949)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0639"
FT                   /product="cytidine and deoxycytidylate deaminase
FT                   zinc-binding region"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69114"
FT                   /protein_id="ADK69114.1"
FT                   /translation="MSKRLDYLSWQHYFMLIAKASAMRSKDPNTQVGAIVVNELQQIVA
FT                   TGYNGFPRGVSDDEFPWSKNNEDWLENKYAYVAHAELNAIVSSRSDLSNCDLYVTLFPC
FT                   NECAKIIIQAGIKRIYYANDPYHDKKEFIASKKMLDAVNIKYIKLPDIEISLKVKD"
FT   gene            complement(664952..666253)
FT                   /locus_tag="MMS_A0640"
FT   CDS_pept        complement(664952..666253)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0640"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69849"
FT                   /protein_id="ADK69849.1"
FT                   /translation="MTNSSTSDKKTLENFFIKNFKYKLLKSKVNSSVSYLYSSNEKHQV
FT                   IILNFDNSISFEKEKEYIIKKVEKQIKKPVSVFHIVIDNDNQLTTKSNLIVLHSSIQTL
FT                   ATDLEPYFKNTNLLVFNHTINNELKEDKQPSEETNNKLFTSFLENVKNNKITFSWAVLL
FT                   ILILIPSMLQIVGYFILETNLNSKNVLILAFGGTNWNLTIVGKQWWRIFTYGIAPIKQN
FT                   GLIVDILSLLILGTSFFSISKITEIQLANTKKLILATILSYLILGLFSSSVLPTIYTGG
FT                   LISTMGIFIGVLLIDVSGSTTPMAKFSQAKTVVYILILIGFSFFLGDGWTGLLITGTAV
FT                   ILGSAFWEIFKVNIKEWAWIQYVHIFLILAILAISLTFIFLPHLTPALDQHILITLSTY
FT                   YKKGWFSINSLNKIVNNIGWDGQFNQFGKFITNF"
FT   gene            complement(666246..667178)
FT                   /locus_tag="MMS_A0641"
FT   CDS_pept        complement(666246..667178)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0641"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="5.4.99.-"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00005"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69265"
FT                   /protein_id="ADK69265.1"
FT                   /translation="MNKITLNSLNTTLRLDKLLVELLTSYDYSRSYIQKLIKEECISVN
FT                   NQIITNNNFLVKPNSQITITIKDPILDPNLVKNDEIDLDIIYQDDDLLVINKQNNITVH
FT                   PSLNNTNNTIVNALLASDVELSSINGELRPGIVHRIDKQTTGLLIVAKNDKTHKLLSEM
FT                   FKNHQIYKEYLAIVTGVIKPNKGLIDAPIGRSQTDRKKMSVTAKNSKQAITTFEVVERF
FT                   FKNTLVKCQIQTGRTHQIRVHFNYINHPVLNDPVYGKKHQEFTDFGQYLHAYKLKFTHP
FT                   ITKKEIELISPLPKEFDDKIKELRGENND"
FT   gene            complement(667159..667683)
FT                   /gene="lspA"
FT                   /locus_tag="MMS_A0642"
FT   CDS_pept        complement(667159..667683)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="lspA"
FT                   /locus_tag="MMS_A0642"
FT                   /product="signal peptidase II"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69628"
FT                   /protein_id="ADK69628.1"
FT                   /translation="MPIFISLISFDWISKAIVVSHMKLGETKTFISGFLNFQYVINLGM
FT                   AYGRLQDKAYLVIIFATIFSLFLTTIFIFLNNKKWLIVLIIILAGSWGNLLARLWAPGN
FT                   ENNVYFGVVDFLTWDFSLLNSRDYVFNLADLYVNIAIGLTILFTIIELVLYIKSKIKTK
FT                   KEKIENEQNNS"
FT   gene            complement(667758..670505)
FT                   /gene="ileS"
FT                   /locus_tag="MMS_A0643"
FT   CDS_pept        complement(667758..670505)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ileS"
FT                   /locus_tag="MMS_A0643"
FT                   /product="isoleucine--tRNA ligase"
FT                   /EC_number="6.1.1.5"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF06827; match to protein
FT                   family HMM PF08264; match to protein family HMM PF09334;
FT                   match to protein family HMM TIGR00392"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69150"
FT                   /protein_id="ADK69150.1"
FT                   /translation="MSNKYKDTLLIGKTDFDMRANLNQKEPKFEQFWQENQIYNKKLKL
FT                   NENKKVFVLHDGPPYANGDLHIGHALNKTLKDFIIRFKNATGYYAPFIMGWDTHGLPIE
FT                   SAVTKMGVDRKSMSSVAFRELCYKYALEQVSNQANQFNRLGMFTDYDTKYVTLTHDFEM
FT                   SELRLFEKMYQKGLIYKDLKPIYWSPSSESALADSEIIYKDISSPSIYVGCDVINSDEF
FT                   KNTQLIIWTTTPWTLPSNQLIAIGSKIKYSLIQVENSDKQFILASDLINQVSQNIGWEN
FT                   VKVIKEIDANKLVGLNYVHPLYDTKISKVVLGHHVTSESGSGLVHIASGFGEDDFLIAK
FT                   QNNIKPFAPIDNQGKFTTQISDLDPQLVGMFYDDTNKIITKRLEENKKLLKLKFLTHSY
FT                   PHDWRTKKPVIYRCTLQWFVNLAPVKNDILKNVDQINTHPKWAKKRLYQVLDERTDWTI
FT                   SRQRLWGVPIIAFYDQNDDLVLNEQILNYAINKIEEVGTNAWFSLDADEFLPEQYKNKS
FT                   LKKEKDILDVWFDSGSSAIALSQKYPNLKLPYDMYLEGNDQYRGWFNASMINSTIYSNT
FT                   SPYKQLVSHGMTTDEKGNKMSKSLGNGVDPIAFANDLGADILRLWVASTDFTDDQKIGK
FT                   EIIKQISESYRKIRNTIRFILANLNDFNVKTDYQTKLSEVDMYSLFNLTSFKNKVIQAY
FT                   QELNFSLVYTLVMNYVTKNLSAFYLDFIKDILYINSKNDLRRRQVQTVLYEQLYCLIDV
FT                   LRPILVHTIEEVYQNLNDNNKVESVHLLDNKEQNFVYDKEFINKWDQVMILRDDVNKAL
FT                   EISRENKIINKGFEAVVNIKLDKEYDDLKNIKDLSQIFIVNSINFVDNIDNSFIKTNIS
FT                   SIKVEQKQGLKCQRCWQIFDNLIDDEICNHCNNVVKSLLETKCE"
FT   gene            complement(671256..672245)
FT                   /locus_tag="MMS_A0644"
FT   CDS_pept        complement(671256..672245)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0644"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69713"
FT                   /protein_id="ADK69713.1"
FT                   /translation="MNEKYPNLAKTMINMWNSRFSKIIHKRDEGFAINFSPIKIFSFLN
FT                   SINRNSNKKLKIKEYKNPNLNFWIYSLDNTKLAASIWLNEKQSNKWVIGVHGYNSNRLE
FT                   VLYLVWHYQSLGYNILTFDFRNHGISDSNCITWGYKEKWDLISVVNWLIKHYDVELIGL
FT                   VGTSMGAFTTNYFLLTENELIKKANIKWAISDSSYMSVKNLLQRMIKDYSPKFLSNLSK
FT                   DVLDDILEIYKNEYEVDLTKLDFVDLITINTTYIPVLYIHNRLDKVTSYLDSFRMYQMK
FT                   NNIENSFDNQIEIYDHGSHHTKSIIEFENEYITKSLNFVKLHQKNRHN"
FT   gene            complement(672258..672674)
FT                   /locus_tag="MMS_A0645"
FT   CDS_pept        complement(672258..672674)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0645"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69104"
FT                   /protein_id="ADK69104.1"
FT                   /translation="MFFKKKKNFFKQNEHDQDQIELELTDSDIFEQENPVLKDSYTQTS
FT                   NQFNQNHQTNTSNINQNDMNKSPINTYVFSPMKFSEVQSIVDTLLDQKVVVVDFKNLDD
FT                   NKAKRFKDFLSGVLYIKKGEYIRLNENIYKFIIN"
FT   gene            complement(672686..673846)
FT                   /gene="ftsZ"
FT                   /locus_tag="MMS_A0646"
FT   CDS_pept        complement(672686..673846)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="ftsZ"
FT                   /locus_tag="MMS_A0646"
FT                   /product="cell division protein FtsZ"
FT                   /note="identified by match to protein family HMM PF00091;
FT                   match to protein family HMM PF03953; match to protein
FT                   family HMM TIGR00065"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70067"
FT                   /protein_id="ADK70067.1"
FT                   /translation="MTNEFKQIARIKVLGVGGAGNNAIRRMFEENVQGVEFYIINTDAQ
FT                   ILESSPVPNKIILGEKTTKGLGAGGNPEVGKAAAIESEEELRKVVEGADLIFIAAGMGG
FT                   GTGTGAAPVIAKIAQESGALVIGIVTKPFIFEGRHRNVNAKEGLEELRKYVDSVIVVSN
FT                   DKLLEYIGSIPIVESFKEADTILKQGVQTITDLIAVPATINLDFADVKSVMSKKGNALF
FT                   GIGVASGKDKAVEAAKEAINSKLLEASIEGAKDIIVNITGGRTVSLNDAYDAVGVISQA
FT                   VNNKELNIVFGMAINDDLTDDDEIIVTVIATGFENKNLQNQESNIIKTPRVEPVVQQAQ
FT                   PSKPIQQEQEEEQHEEVDEFDDEMSLTTTDDTEEDFNDDDFPTFLK"
FT   gene            complement(673904..675124)
FT                   /locus_tag="MMS_A0647"
FT   CDS_pept        complement(673904..675124)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69507"
FT                   /protein_id="ADK69507.1"
FT                   /translation="MDKQIFTIIEFNRNIINFQVIKYFNNQEMILYKNSYISEESEILD
FT                   KDQIKDSLNVYKFLTNCFTDFEKNSSFSKIKQIGLMLSNSLNITKKVTNYGLKSKDKKT
FT                   SSTTNLEYIVKKINKLQLYDDTDLKIIDTNLIELQVNNKMIDYQNLKKYYIDNTQNNKL
FT                   VMTFLELSITNELYFALEKLFWKFYKQILFIKPRIVCLNQLVKDQCQDHKLVVDWNWDE
FT                   IEVGVFNNNALLKIFKFSFGINKIIKNLSQSLNISFEMSKDYLFNNLDFSSYNINNLNV
FT                   LSLWNNSENKLDTTNGKQIKQLIKSIISEIYITINQSILKEQNINNYQIYNFGLISKIV
FT                   GIDMIFNELKNNHFISNNFIGDIDFEQDSTAFIGASLFFKNPEFPSQNQKFSNFFKAFL
FT                   INSKKHY"
FT   gene            complement(675133..676059)
FT                   /gene="mraW"
FT                   /locus_tag="MMS_A0648"
FT   CDS_pept        complement(675133..676059)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="mraW"
FT                   /locus_tag="MMS_A0648"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01795;
FT                   match to protein family HMM TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69166"
FT                   /protein_id="ADK69166.1"
FT                   /translation="MDKHIPVLLKESIEYLNIKPDGIYVDCTLGRAGHSSEILKKLNQK
FT                   GFLYAIDQDQIAIDQAKEKLEQINNNFLLIQGNFSNLSALLAINHVFNVDGILYDLGVS
FT                   SPQIDIASRGFSYKMDGPLDMRMDLNSTLTAHQVINTYSESQISEILFKYGEESFSKSI
FT                   SKKIVESRPINSTLELVEIIKSALPQKVLKQKKHPAKKTFQALRIYINNELIALENSLK
FT                   QALDLLNSKARICVITFHSLEEKIVKNIFNNSTNYYQEQLLSNLPIKADLNSKFKLVIK
FT                   KPIKPSLLELEQNHRSHSAKLWVIEKN"
FT   gene            complement(676068..676469)
FT                   /locus_tag="MMS_A0649"
FT   CDS_pept        complement(676068..676469)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0649"
FT                   /product="putative protein MraZ"
FT                   /note="identified by match to protein family HMM PF02381"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69814"
FT                   /protein_id="ADK69814.1"
FT                   /translation="MLFGTYEHCMDAKQRLTLPAKLRNKLSNPIYLTKGYDADLEIWSK
FT                   DDFLLKIKEILNQQNDQKDIRNIERIIWSNTVEIDIDNLGRIKIPYNLIQNLNIGKDVF
FT                   ILGLGNRLEIWSKNKYNQHKNQFIKNLNS"
FT   gene            complement(676576..676755)
FT                   /gene="rpmF"
FT                   /locus_tag="MMS_A0650"
FT   CDS_pept        complement(676576..676755)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmF"
FT                   /locus_tag="MMS_A0650"
FT                   /product="ribosomal protein L32"
FT                   /note="identified by match to protein family HMM PF01783;
FT                   match to protein family HMM TIGR01031"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69061"
FT                   /protein_id="ADK69061.1"
FT                   /translation="MAVPFRKTSKSAKNKRRSHLALSAASLVSCTNCGAMIKPHHVCKE
FT                   CGFYKNKEVKVVEA"
FT   gene            complement(676770..677288)
FT                   /locus_tag="MMS_A0651"
FT   CDS_pept        complement(676770..677288)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69684"
FT                   /protein_id="ADK69684.1"
FT                   /translation="MKLIFNQTDFKLKKHYELQGQLTDLDQIKSNNILIKSFDFISYDL
FT                   DLDYNETLKMITVNGVINYTITGIDSRIGNEIKYSNYIDWNDEYSFTNSSDFNTNIIIN
FT                   EEFNLKDYIIEQINLNIPFNLSLNNDILNKYGLGWSLESEEEFQKSQANKIDPRWEQLD
FT                   NIKIDDNNK"
FT   gene            complement(677288..679672)
FT                   /gene="pheT"
FT                   /locus_tag="MMS_A0652"
FT   CDS_pept        complement(677288..679672)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pheT"
FT                   /locus_tag="MMS_A0652"
FT                   /product="phenylalanine--tRNA ligase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01588;
FT                   match to protein family HMM PF03147; match to protein
FT                   family HMM PF03484; match to protein family HMM TIGR00472"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69796"
FT                   /protein_id="ADK69796.1"
FT                   /translation="MIITRNWLKKYLNLDNISNDQINMALNSLGFEVDSVYDLNSLNSE
FT                   LILGYVEQSKQIPDTHLKLNQVNIGTKSLQIVCGASNVDANQFVVIAPINATIANGLTL
FT                   TSKKIQNYESQGMICALNEIGIDLSVINKEDQLKIYNVSDKNLDLKKYIGSDVKQIIGL
FT                   DDYLFEIDLTLNRSDCLASFQILKELANYFDLKIKNLDNNFSDFKKNNLDLKIDLANQV
FT                   KDQIKTISYSYFELNNKNDKLDSKDEIFLKLNQINSSNHSITNLSLISTLSTAQTHILI
FT                   DLDKLKSSNLKLEFINHDNKELLCLTNNNKLVNIIGLDTQNEFNVDNNSKNVLNIMLNI
FT                   EPNLMRKQQKLLNISNTYLQRYIKPINPNLFNLANQTFSNLLNDYQLINKAYEVKILKQ
FT                   TFKNKQSLEIKLNEINDLLGTNLTIKQIKSLFKHLDFKITNKDDLLDFQIDQNRIDITS
FT                   KNDLCEEVARLYSYDKIDEIPLSFTSFKKAKNLNLKLENKLTNYLIGLGFNNTKTYSLT
FT                   SLNEAKYWNLFNISEFINLVSPLSNLRQTYRTNLSKSLIDVAIFNHSINNKELKLFEIA
FT                   DIYDLNNLKQRHLVFLTSNHIYKNSLNQQLIENNFYYNKEILENIFNLYNLDLSEIQYQ
FT                   SDLNLIKEIHPYINTTIYYQNQLIGYLYKLNPKFESENKLNPTFVCEINLDILNQFKNS
FT                   FIEAKTLSKFQSSSRDLTIEISNDLTYQKVLFNALSDVKYLKSHKIVDLYLDDNLIKNN
FT                   TKALTIQFVFNDLEHQLTENEINQEFEKIIKNIKQMKVVIR"
FT   gene            complement(679681..680733)
FT                   /gene="pheS"
FT                   /locus_tag="MMS_A0653"
FT   CDS_pept        complement(679681..680733)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pheS"
FT                   /locus_tag="MMS_A0653"
FT                   /product="phenylalanine--tRNA ligase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01409;
FT                   match to protein family HMM PF02912; match to protein
FT                   family HMM TIGR00468"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69047"
FT                   /protein_id="ADK69047.1"
FT                   /translation="MIEQLNEILNNFKVKLELVKDLNSWEELKKEFIGKDSSLTTILKS
FT                   IKTISSDKKQEIGKLANQIRVEIINQLNEKQEQLKNKELLVKLEKEKIDVTLTNSSLKF
FT                   GSKHVLNIVIEEISDIFTEIGFEMVSGTEIESDLYNFQKLNLPVDHPARDMQDTFYLDN
FT                   NLVLRTHCTNMTSRMLTKLASLKTEDNNLAVISYGNVYRRDDDDATHSHQFMQIDGFVV
FT                   GNKISFANLKWILKYMCQRLFNKDINIRLRPSFFPFTEPSVEVDVSCFKCDSKGCFICK
FT                   KTGWIEILGAGMINEHVLKLNGLDPNKYSGLAFGIGIERIAMLKFNISNIRNFYENNVK
FT                   FLEQFKFYSE"
FT   gene            complement(680762..681370)
FT                   /locus_tag="MMS_A0654"
FT   CDS_pept        complement(680762..681370)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0654"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69270"
FT                   /protein_id="ADK69270.1"
FT                   /translation="MTDFILIRNNFFKNNVSKIQKTKYLNMNINWSFSDFDDILNKPNF
FT                   ITYLQNSFKLNFSYLMIDAIETKIDQIRNLFKKTNTSCIDYLLKTNNTNFIEINYKKFL
FT                   LTSYTLLRDFINQIFINWIFNDALNNHWIEFNKTYDNNLMFNYQFERLELDFQKNLFNI
FT                   IKAINKKINDPVIRILISAYIEDINNKQTYLNQIHKNLK"
FT   gene            complement(681379..685827)
FT                   /locus_tag="MMS_A0655"
FT   CDS_pept        complement(681379..685827)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0655"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69844"
FT                   /protein_id="ADK69844.1"
FT                   /translation="MRHIIKSYLKTFFKKNYVSTFGILLFIITLATVIIGMLATPLQLN
FT                   NRINYLAKHNTSYNLILDTRSMNYDPKFTYNYFYLNKEINNKDTNYTKLSELYIKAINS
FT                   ELEQNFNNTSTDKKENNLYIYDSNNLEDKVKIDFIGNLINSDLFRYRNGALVKTESYIF
FT                   NKDYNNDQNNLNSFSNISNQVLNRIISDFHQSMSDGISLDNNAKYDYVVSEFYKAYSRF
FT                   NSFLTINEINLIDKPILTLKFTEILNKLNDNKIDEITKFLVKQLQDLKNKIKNHQKERI
FT                   YLPSFLVFSDKFSKVLSDEKFLYDDRIYIVDQLLDNVQNFTLQTKKTFKIQQSSVGQLL
FT                   PFLTLQLTSDNQIFKNTNKDFNQIQFDKNHKNSEFAKKWDVNINYQQKVNPTQIVISSS
FT                   YAKARNLKINDEFIIPSSNISDIYLSLINKKDAYYLGSINSKIVGIGSTFDDIVSKNSI
FT                   TDYFQDKTSYVVGYTSKEFINSIRNSRWNFSNKFDTSYQVNFRVKNLNNSTSKDLNKHF
FT                   IIKFDNWSDESYSVFDKSSSLITEWYSLRTSQAISSIKVQVIIYIVIGIFVLLLSFVFI
FT                   NFALKKEMNETRRQIGIFKSFGYKVVELSWIFALKTWLTMFFGLIIGYILSIPIQIYSS
FT                   SNFVNSVTFTFNSIYISPLLIIFLILIIPFIFLMGSYWASIIYIKEPVLSLMNNLKKSK
FT                   RTKSGAITNLLSKHNIGFNYRMRLSFIKNAKGKFAVVQILFGFASLTYTLLFVAQAILF
FT                   QSINQSLATIKQDLITKSMWNVNKKIDNISTNDKLGYTNKNDPKTRQTLSYHDLNKKNI
FT                   NTYLNNDLKQTDIRYRVELFFKLLNNTFNSLSNEKKVSMILPLDYAKKTLTPFLQPGKT
FT                   NKNDYEVLIKDKQYYLSYISRFNLYNQNQKWQSALNDFKNNKEIKLTLNDLSQKQHSSD
FT                   LFYDLNHPKKDELQNTIIGLQSTRNNSNNTLFLSSFAKIFSYKLVQAYSLFQVVSHYKQ
FT                   FDNDINKAWMHLQKDNDLLSFNPDDQKYWTIANNPLLEKIINKNLKNKPNKDKKELFDT
FT                   TSNFLIDSLLNSTNLSNASQSILLASMIMQDLNNKLENNPIVSFNQMFYDSSTDLLSAV
FT                   IRVSNSDILNPGSYALNLYRLKDHNFGDVNQFLNFKGVSIKGFQDLSKLPEKHNNLPTF
FT                   NVIVPYYYAKSKNLDINSKIVVETRTTFVKKFVLNVVGINKSETLSISKTPDIFLDYDL
FT                   FANEMFSEDLYKNNNPLIFNQLWSKNKILEGTINFTKLDDSFKTIKYYGNNLAIDIRKD
FT                   APIFLSMYSNIFTEFNNFISKYQELDQQNDIYNTPNPAITTLSRLNSKLFNFNLVKQTI
FT                   SKITTITNQVMSLFILLVSLLLTIILVVVMNIVVDESKKTILTLRAIGYENSEVNWIVM
FT                   GSYIIGAIISFIIAYLLSNLIWWSFLYYVSYKWHIYIFLAFDFKTLFVTFSVIAFVLFI
FT                   GWLFSDKQVKKTALTQVTQAE"
FT   gene            complement(685946..686054)
FT                   /gene="rrf_2"
FT                   /locus_tag="MMS_A0656"
FT   rRNA            complement(685946..686054)
FT                   /gene="rrf_2"
FT                   /locus_tag="MMS_A0656"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(686129..689022)
FT                   /gene="rrl_2"
FT                   /locus_tag="MMS_A0657"
FT   rRNA            complement(686129..689022)
FT                   /gene="rrl_2"
FT                   /locus_tag="MMS_A0657"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(689254..690777)
FT                   /gene="rrs_2"
FT                   /locus_tag="MMS_A0658"
FT   rRNA            complement(689254..690777)
FT                   /gene="rrs_2"
FT                   /locus_tag="MMS_A0658"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(690993..692657)
FT                   /gene="argS"
FT                   /locus_tag="MMS_A0659"
FT   CDS_pept        complement(690993..692657)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="argS"
FT                   /locus_tag="MMS_A0659"
FT                   /product="arginine--tRNA ligase"
FT                   /EC_number="6.1.1.19"
FT                   /note="identified by match to protein family HMM PF00750;
FT                   match to protein family HMM PF03485; match to protein
FT                   family HMM PF05746; match to protein family HMM TIGR00456"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69126"
FT                   /protein_id="ADK69126.1"
FT                   /translation="MSTTIIEMFYNDLKNICQKLNITKEPIIEINKNNTPGLLSSSICL
FT                   ISSKQVNKKPLELAEIFKQELLLTNSYLNIDIAAPGFLNVLVKPEILSNVISNVLSLKS
FT                   KYGNLEKQNKTINIEYVSANPTGYLHVGHARNAVIGSVLVNLFKKAGYNVQTEYYVNDA
FT                   GNQINVLAVTVFVHYLQALNIDAKKPENCYAGDMYDDLAKIIINKYNYQFKDIKYTDNK
FT                   ILDYNVHSLFKQISIDYFLKVIKQQLADFNVKIKHWSSEQEVYDTHQIEKVLKLYESKD
FT                   ALYYKDDALFLKTTQFGDDKDRVLVKSDKTYTYILPDLATHNLRIKRTKADKLINVWGG
FT                   DHHGYIKRMQAGLALLGNDPDILEIQMVQMVRLIKDGSEYKMSKRKGTAVWLVDILELV
FT                   GVDALRYMLASKSSNSHMDLDLDLITLKNSSNPVYYAQYATARCHSILNQARTKKITPL
FT                   VKETNLLNNPKEIELLLVLDNFKEVIKNSANNRSTQQICDYIQNICKIFHSYYAEIKII
FT                   DENNLQLTKLRLGFIKAVLQVLENAFFIIGIQPVLEM"
FT   gene            complement(692659..693207)
FT                   /gene="frr"
FT                   /locus_tag="MMS_A0660"
FT   CDS_pept        complement(692659..693207)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="frr"
FT                   /locus_tag="MMS_A0660"
FT                   /product="ribosome recycling factor"
FT                   /note="identified by match to protein family HMM PF01765;
FT                   match to protein family HMM TIGR00496"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70100"
FT                   /protein_id="ADK70100.1"
FT                   /translation="MTDLILKNAELQMKETIDAYVIHLRQIRTGKASGAILDKVMVNYY
FT                   GSLMPLNQISQITTPEPNLIIIKPYDRNVITEAVGAIHKADLGLNPVSDATLIRIPIAP
FT                   LTEDVRKNLVKKVHKELEGYKIRIRNIRRDAIDEIKKIENISKDLISDNEDQIQQITDK
FT                   FIKQLDDLTKEKEKELMTI"
FT   gene            complement(693218..693931)
FT                   /gene="pyrH"
FT                   /locus_tag="MMS_A0661"
FT   CDS_pept        complement(693218..693931)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pyrH"
FT                   /locus_tag="MMS_A0661"
FT                   /product="UMP kinase"
FT                   /EC_number="2.7.4.22"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR02075"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69267"
FT                   /protein_id="ADK69267.1"
FT                   /translation="MNYKYKTVLLKLSGEALKGNAEVYDKKCLDNIASQIVHLAKNGLK
FT                   LAIVIGGGNIWRGKLGENIGMDAINADYMGMLATVMNGLALESTITKMGYDKIKVYSSL
FT                   PIKTVTDDYNFKKARIKMNEGFISIFVGGTGYSYFTTDTNATIRAIEIGADVILMAKNG
FT                   VKGVYDKDPKQHSDAKFIKRLTHQEVVDKQLRIMDLTAATLAKDANLKIEVFDMSGDNN
FT                   IIKVLENKLESTIIE"
FT   gene            694320..695993
FT                   /locus_tag="MMS_A0662"
FT   CDS_pept        694320..695993
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0662"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69852"
FT                   /protein_id="ADK69852.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRSDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSHEGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADEGM
FT                   SVNRNIRFLESKNWKYIISYRTKAGSKQFKEYILDEKDYINDGGLIYKTRDIVSSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNDRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            696229..696645
FT                   /locus_tag="MMS_A0663"
FT   CDS_pept        696229..696645
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0663"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69858"
FT                   /protein_id="ADK69858.1"
FT                   /translation="MNYIKKYNHLTESERYIIEKMHNDGYSISNISCFLKRNKSTISRE
FT                   LRRNLNHNLEYTQRYASYKYKNRRNHKHIFKFTENSPFKEFTDIFFKIYNKRFFGVKAT
FT                   YNFIKINHNVKTPSIRTVFNWIKTNKWSIKKKID"
FT   gene            697067..697222
FT                   /locus_tag="MMS_A0664"
FT   CDS_pept        697067..697222
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0664"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69903"
FT                   /protein_id="ADK69903.1"
FT                   /translation="MVRRVFKKGFDFNTITNDELNKVVEQINKMPRKIFNWKSAQEVFE
FT                   TLTNSL"
FT   gene            complement(697341..697547)
FT                   /locus_tag="MMS_A0665"
FT   CDS_pept        complement(697341..697547)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0665"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69422"
FT                   /protein_id="ADK69422.1"
FT                   /translation="MKPDAQNRTDSNKSSDDQQQQQKEKTKTKEENKKDLKHSEDTKEP
FT                   WYKRSWNKIKEGWSWLKSKVSKK"
FT   gene            complement(697925..699598)
FT                   /locus_tag="MMS_A0666"
FT   CDS_pept        complement(697925..699598)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0666"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70082"
FT                   /protein_id="ADK70082.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRSDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKKSF
FT                   YRSLDYIAKNKDKILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYVLDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNNRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            complement(699901..700506)
FT                   /locus_tag="MMS_A0667"
FT   CDS_pept        complement(699901..700506)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0667"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69693"
FT                   /protein_id="ADK69693.1"
FT                   /translation="MISFNTEYFGVISGLLIAFILVINLMFNFYLFKFIKKQALITKYN
FT                   KFYFIVFYIISFISLVLAIISLVLFNLKDKIFSQTSSESQKLYPTIVLNAISFVFLISK
FT                   IILLFIFLPRFAIKITENEILYLGEKIEFQTITKIIEDTNTQALYINYKPTKRTYKRIR
FT                   YPKACPFNQVIKNSTTNTNLEISNQDANEYFKKIKELS"
FT   gene            complement(700506..701393)
FT                   /gene="tsf"
FT                   /locus_tag="MMS_A0668"
FT   CDS_pept        complement(700506..701393)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tsf"
FT                   /locus_tag="MMS_A0668"
FT                   /product="translation elongation factor Ts"
FT                   /note="identified by match to protein family HMM PF00627;
FT                   match to protein family HMM PF00889; match to protein
FT                   family HMM TIGR00116"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70030"
FT                   /protein_id="ADK70030.1"
FT                   /translation="MAVDAKLIKELREITQAGMMDCKKALEASDNNIDNAIVWLRENGL
FT                   AKAAKKTDRVAAEGIVLAKENDQKIVILEVNSETDFVAKNEKFLSLVDEIANALLNSNA
FT                   SSLEEGLQVKTDSGLTIEQSLISATATIGEKIALRRFELVNKTSGSSVIYNHANKRVST
FT                   LLVFDNKLDPTDAYNVAMHVAAMAPKYINMDQIPEDFKNAEMHIIKEQAKDDAKLQAKP
FT                   ANVLENILKGKLSKRLAEVSLLDQLFVIDESFKVGDFLKSKHVSLVKMIRYEVGEGIEK
FT                   VVTNFADEVAAQLK"
FT   gene            complement(701405..702283)
FT                   /gene="rpsB"
FT                   /locus_tag="MMS_A0669"
FT   CDS_pept        complement(701405..702283)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsB"
FT                   /locus_tag="MMS_A0669"
FT                   /product="ribosomal protein S2"
FT                   /note="identified by match to protein family HMM PF00318;
FT                   match to protein family HMM TIGR01011"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69528"
FT                   /protein_id="ADK69528.1"
FT                   /translation="MSREITREELSAAGVQYGHQTKRWNPKMKSYIYGVKNKNHIIDLE
FT                   KTITHLNTAQKLLETLGSKQQKILFVGTKRSGKNAVKEAALRSGNFYINNRWLGGTLTN
FT                   LKTILIRIKALWEIEEEEKKGRLSLRTKKEQIKILKEKTKLEKALGGIKQMHKLPAAIV
FT                   VVDPKGDEIAVKEAKKLNIPVIAICDTNADPDMIDYVIPGNDDLQESVNLIINILVEAY
FT                   AEGAQIKMNPSVLKTVVPKREPRQNRVMTPVVENQSTEQQASENVSNTQVSNEPITPVV
FT                   EVEKSSEPKAE"
FT   gene            complement(702489..703607)
FT                   /gene="dnaJ"
FT                   /locus_tag="MMS_A0670"
FT   CDS_pept        complement(702489..703607)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dnaJ"
FT                   /locus_tag="MMS_A0670"
FT                   /product="chaperone protein DnaJ"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF00684; match to protein
FT                   family HMM PF01556; match to protein family HMM TIGR02349"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69910"
FT                   /protein_id="ADK69910.1"
FT                   /translation="MKKKDYYEVLGVSKTASEQEIRQAYRKLAKQYHPDLNKSPDAHDK
FT                   MVEINEAADVLLDKDKRKQYDQFGHNAFDGSSGFSSNFADFEDLFSNMGSSGFSSFTNI
FT                   FSDFFGSNKSDYQRSTKGQSVSVDIYLTFKELLFGVDKIIELDLLTNCSVCFGSGAESN
FT                   SDISICNNCHGTGEVLIQKNMGFFQFQQSAKCNVCNGAGKIIKNKCKNCKGKGKYLERK
FT                   KIEVNIPKGIRPNQQIKLSQKGHASINNGVNGDLIIDIYLKESKVFEIVNNNDILMTYN
FT                   ISYLDAILGNEIIIKTLDGDIKYKLPKSINSNEFIIINNKGLYKSINKDKRGDLIIKVN
FT                   IVVPKNLNKKEKELIEQIYEQTSFNPENNIDQ"
FT   gene            complement(703671..705446)
FT                   /gene="dnaK"
FT                   /locus_tag="MMS_A0671"
FT   CDS_pept        complement(703671..705446)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="dnaK"
FT                   /locus_tag="MMS_A0671"
FT                   /product="chaperone protein DnaK"
FT                   /note="identified by match to protein family HMM PF00012;
FT                   match to protein family HMM TIGR02350"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69352"
FT                   /protein_id="ADK69352.1"
FT                   /translation="MAKEKIIGIDLGTTNSVVSVIEGGQPIILENPEGQRTTPSVVAFK
FT                   NSDIIVGGAAKRQAVTNPNVVQSIKSKMGTTSKVNLEGKDYSPEQISAEILRYMKNYAE
FT                   AKLGQKVTKAVITVPAYFNDAQRKATKDAGTIAGLQVERIINEPTAAALAYGLDKQDKE
FT                   ETILVYDLGGGTFDVSILAIGGGSFDVIATSGNNKLGGDNFDEEIIKWLLGKIKAEYNI
FT                   DLSKEKMALQRLKDEAEKAKINLSSQLEVEINLPFIAMNESGPISFATTLTRSEFNKIT
FT                   KHLVDLTIQPVKDALSAAKKTPSEINEVLLVGGSTRIPAVQELVKSLLNKEPNRSINPD
FT                   EVVAMGAAVQGGVLAGEVTDILLLDVTPLSLGIETMGGVMTKLIERNTTIPAKRTQIFS
FT                   TATDNQPAVDINVLQGERAMAADNKSLGQFQLTGIQPAPRGVPQIEVTFEIDANGIVSV
FT                   SAKDKNTNEEKTITISNSGNLSEAEVERMIKEAQENAANDEVKKKNIELKNKAENYINI
FT                   IENSLLQAGHKISAEQKEQSQKMVDEIKELVKNENYEALEQKMAELEQAMAQAAEFANK
FT                   QNESDPNNNSSEQNN"
FT   gene            complement(705502..706104)
FT                   /gene="grpE"
FT                   /locus_tag="MMS_A0672"
FT   CDS_pept        complement(705502..706104)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="grpE"
FT                   /locus_tag="MMS_A0672"
FT                   /product="co-chaperone GrpE"
FT                   /note="identified by match to protein family HMM PF01025"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70121"
FT                   /protein_id="ADK70121.1"
FT                   /translation="MTEELKNKKINKKYYSQNRNKTKAEFQKADIKKNQYLNLKTKLNN
FT                   VLLEVQNLKELNETLKKELKSEKQLNLAEISNLTKKYNQKELETKKYGASNLAKDLIQP
FT                   LEILKKVVNAPNNNEVVQAYVKGFEMIINQINNVLESHHIKAMNVKVGDMFDPHLHDAN
FT                   EAVETDEYKTNQIVGVLSDGYMIHDKVLVYAIVKVAK"
FT   gene            complement(706106..707128)
FT                   /gene="hrcA"
FT                   /locus_tag="MMS_A0673"
FT   CDS_pept        complement(706106..707128)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="hrcA"
FT                   /locus_tag="MMS_A0673"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="identified by match to protein family HMM PF01628;
FT                   match to protein family HMM TIGR00331"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69450"
FT                   /protein_id="ADK69450.1"
FT                   /translation="MLTNRQIKILQTIVEEFIKTNQPVGSKRILELLNMKISSATIRNE
FT                   SATLEHEGYLEKQHTSSGRTPSTKGYRYYVDNIMKLDSADYTRLKIYLNQLLDLRKYDI
FT                   DKTINYASEIISELTKMTAVVIKKQNIKDIKLKKIELILLSEFLASVLFIFSDGDVQNK
FT                   MFNLKDVALSDLKIAIKLFSDVLVDVKLDEIDQYLNDLKHQLSLSIKQYDYVLNTFINT
FT                   ILESKNEQKETHGMRYMLENPEFNDTNKLKNAVKLVEQLSPFDWFNIAYESNKNMNKIA
FT                   IKIGNEIDQINDDISMIATELKIGNSSTVLTLVGPKRVDYNQVNQLMNLIIEIINTKEN
FT                   "
FT   gene            complement(707133..709274)
FT                   /gene="clpB"
FT                   /locus_tag="MMS_A0674"
FT   CDS_pept        complement(707133..709274)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="clpB"
FT                   /locus_tag="MMS_A0674"
FT                   /product="chaperone protein ClpB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF07724; match to protein
FT                   family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69129"
FT                   /protein_id="ADK69129.1"
FT                   /translation="MEFQEKGKVTDALKKYTRDLTKDAKDNKLDPVIGREEEISRVIQI
FT                   LSRKTKNNPVLIGEPGVGKTAIVEGLAQRIVKGDVPTLLKNKRILELDMGSLMAGAMYM
FT                   GDYESRVKAVVNEIQKSNGEIILFIDELHLIVGAGRTGNNSGMDVSNLLKPALARGELK
FT                   AIGSTTLNEYRQYIEKDAALERRFQRVLVSEPTIDQTISILRGLKDRFETYHGVRIHDN
FT                   ALVSAVKLSSRYITDRYLPDKAIDLVDEACASIRTELASVPIELDQVNRKVMQLEIETS
FT                   ALEKEKDDKSKERWQEAKKELDSLKIEQASLNEKWEKEKEELSRINSVKSSIESLKQEL
FT                   ETAQNDGNYKRAGEIQYSLLPSLEKSLALFEKQTGSKMISEEVTEHEIAKVVSKSTGIL
FT                   VDRLISSEKEKLLNLEDLLKKYVKGQDQAIKAVTSAIMRSRSGIKNPDKPIGSFLFLGP
FT                   TGVGKTEVARSLADILFNSPKKMIRLDMSEYMEKHSVAKLIGAPPGYVGYEEGGRLTEA
FT                   VRRNPYSIVLFDEIEKAHTDVFNILLQILDDGRLTDSLGKTIDFKNTIIVMTSNIASQY
FT                   LLTSDELVQVDDQKIQEELNKVFRPEFLNRIDNIVYFNALSVQTIGEIVDKVLEELSTR
FT                   LQDEQNYFINFSEEARNKIINEGYDRLFGARPIKRYIEKNIETLIAHYIISGEVVENTR
FT                   YLIDVKNNQFTLEEFKQFN"
FT   gene            complement(709437..710303)
FT                   /locus_tag="MMS_A0675"
FT   CDS_pept        complement(709437..710303)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0675"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF08282;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69440"
FT                   /protein_id="ADK69440.1"
FT                   /translation="MNNYPYILSDLDGTISLKDFSISKKTIKVIKKYQKLSNNRFSFCT
FT                   GRVDGANKKIAKQLKVSLPIISCNGALISNLKTNEVLHADYLNNKLISELFKLAHEHDI
FT                   DIVGYTHNTMIGTFNSERVISWQNYMNKTKKKYHWEIKKYNDLLDISNELKNNNLKIVE
FT                   VIISLQNLSDDKANEKLDLIKECIKDKFDLVQSLPKLFNIMKKKTNKLSGLKHFAKALN
FT                   INYKDIIVFGDNHNDIEMVKGVKQGYCVENGVDELKKVAFEVCDSLENDGVAKKIEQII
FT                   KEVQNQK"
FT   gene            complement(710303..710848)
FT                   /locus_tag="MMS_A0676"
FT   CDS_pept        complement(710303..710848)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0676"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="identified by match to protein family HMM PF00588"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69919"
FT                   /protein_id="ADK69919.1"
FT                   /translation="MNKRKINIVLYEPEIAQNVGAIMRTCVAINARLHIIEPLGFIFDD
FT                   RHLSRPSANEYKYVDCIRYDDWNDFITKHPNITLFCLSRYGQKPISDFDFSKINDNVYL
FT                   VFGKESTGIAKPILKEHYNTTFRIPMISETRSLNIANTVGIASYEVLRQWNYLDLVKYE
FT                   TQKGKDYILSERWKGIEE"
FT   gene            complement(710861..711463)
FT                   /gene="rdgB"
FT                   /locus_tag="MMS_A0677"
FT   CDS_pept        complement(710861..711463)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rdgB"
FT                   /locus_tag="MMS_A0677"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   RdgB/HAM1 family"
FT                   /note="identified by match to protein family HMM PF01725;
FT                   match to protein family HMM TIGR00042"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69435"
FT                   /protein_id="ADK69435.1"
FT                   /translation="MDKKVIYLATTNKNKVKEFSEILKDYQIKSLLDIPEYVEIEENKK
FT                   TFKQNALLKAKHLAKYINGVAIGDDTGICVKALNDFPGIYSKRWAYPLTNHYDICNKLL
FT                   DKLKHINQLNKRKAYMTTAIALYDAINKKQFVYQARVNGYIDFQVNESEFGFGYDFIFI
FT                   PKGYDKAYSLMNSELKNQISARKKAIDKLIEYIDNVK"
FT   gene            711664..714162
FT                   /locus_tag="MMS_A0678"
FT   CDS_pept        711664..714162
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0678"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69866"
FT                   /protein_id="ADK69866.1"
FT                   /translation="MKKLIAILSSVMMISTASLPVIACHKKEYKFETNNSLTNTKTAVS
FT                   LFAKDFILADQLQLNFQEIRNLNENKNLELLTKQNNLSLDKDELSLDSLKSTNQFINKY
FT                   FDQNSYKNVLDKNIKLDSNKSLNNFVLDEIFKLIGLGTSDIDKLSADILKVLELTTNLN
FT                   PMFLLSDFDSVNSTLKSFFKKVKPYLKDGLEKLSNPGAKFEDEVKAFQEKIDVNNKFKD
FT                   LKVEDLDNAFYVSLSNAIGLSTVGSSYTPIELKTGEASKSLKQASEALTKALNGPAKSK
FT                   NGQEWNIVAYILQSLQFLQIKLSLFEEARDYTPNSYTNLFSASKKNEEFIKSIYNSKTI
FT                   KEITKDKQSSINIKYIFSFIKKTVDELKDETKKDGFELQKLLGILFLTSNKVEYSEDSS
FT                   KDDSKEYYDNSKAHPSLTILADLAKQALNEKLKPLLALISKETTDDQIQKVVDTLIQQL
FT                   YKWISFTLNSLLTGENNLNKCLTTLFAKGLPVIIESIQKNTKLIPPEVSAQLGFLPFLL
FT                   IPLINKILAIAFPILYSDSEKPAANSFKDLYSGQVFLVNKVNEMFKVFRKTLIDLLTQV
FT                   KADTKSIPFATIRGFLTTLENGYDKIFKNVKEFNLKGLLTTPLNKINETWWKDQPISKS
FT                   LQEQSVTDILDSLLNDLDVKGNEKIDQVKDSNINLTSLTEVAKLVDNYTYKVKDINTSG
FT                   KIHLLEILKNNPEKTLEILGWTSDKNNPIGKDSLIYALLTKVFNVNLDKKDDKSQNAIN
FT                   QISKIISTVNKSIEIKTNWNSVEISFEFKDQKKNKFDQLLSETLIAKVKNKKDNSQSTY
FT                   SFSYSRDKQDKFKFTKITKN"
FT   gene            complement(714218..715597)
FT                   /gene="atpD_1"
FT                   /locus_tag="MMS_A0679"
FT   CDS_pept        complement(714218..715597)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="atpD_1"
FT                   /locus_tag="MMS_A0679"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69890"
FT                   /protein_id="ADK69890.1"
FT                   /translation="MNGKILSISGDVIEVQFKKSNLPSINHLLTTHDNQTYLLVKSVIN
FT                   ETNIKAIIIYAYKQISLSDEIINTNKSFMVPVGSKAKNNIFSFTGISLNNKKDDKQEYV
FT                   EMNSTINNKRELSTEFELIETGIKAIDFFIPIFKGFKLGIFGGAGVGKTVLMKEIIFNV
FT                   NNKYKNTSNIFIGSGERSREGIELYDELTESNLMKNSTMFVSKMNESPGARMSIVPIGV
FT                   TAAEYLRDVKKEDVLLFIDNIYRFIQAENEVSATLGKKPSVGGYQSTLESDVANIQDRL
FT                   FKNKNGAITSFQTVFLPMDDLSDPSAVAVFNHLDSNLVLSRDQAAKNILPAFDPLASSS
FT                   SSVDETLIGKKHFNAIIEVKRILKAYKDLEDVILILGFDELDAESKILVKKALQLENFF
FT                   TQYFFMTEQFTKQKGQYVPLNETIDSVIRIIEGKYIKQSPEIFSYIGSALDLKTDEELG
FT                   L"
FT   gene            complement(715597..717144)
FT                   /locus_tag="MMS_A0680"
FT   CDS_pept        complement(715597..717144)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0680"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69346"
FT                   /protein_id="ADK69346.1"
FT                   /translation="MNIKTNSKHTSPKISAIYDYIVEVKGEFDYKQQQIFTSKKNKEAR
FT                   LFLISATSDTAYLLANLQALKLTINDELELLDNTNEIFTSNEYFGKVIDIYGNIILPEP
FT                   KTVVKKPEDISSEVFKLSHDLMKVQRLNEQLYTGLTAIDLLIPIGKGQRELIVGDRQTG
FT                   KTHIALNTIINQSARNIKCVYVAIGQKKESISRIYNILAQHDALKNTIILDAPANSSYE
FT                   QYLAPYIGMTHAENISNTDDVLIIFDDLTKHANIFREIALLSNRPVGKEAMPGDMFFAH
FT                   SQLLERAGSYKNKKTITALPIIQTIDNDITSLIASNVISITDGQIVTSSKLFLQGILPA
FT                   VDIDFSVSRTGGSVQDKTIRQIAGQINKTYRKYKRQLKLSMLDYNLNSETADLMYKGKM
FT                   IDKLFTSKGFSIFSYNFILMMTKIINWSLIKDIKDEQKALKFIDELINKSVDGKKQFEI
FT                   IKSGNNYDDKMMKNYFLFALKQYSDYVGLNWEIDNEYDFLSLDQSFLEKTAKKLGDK"
FT   gene            complement(717149..719461)
FT                   /locus_tag="MMS_A0681"
FT   CDS_pept        complement(717149..719461)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69681"
FT                   /protein_id="ADK69681.1"
FT                   /translation="MKKNKLLSKSYKIAILLLTTTSSLSLTALIKNTHNNNNNTVLKLY
FT                   QDGNGSGGSGSSGGSGGAGSNGGSGTSGTSGTGANGGSTTTPGTPAKPEISKEFSTFKD
FT                   KAEKKIKETLEKVQKRATEIIDQEIAKLKKLSDSTEKSEEYFKNLQKKVYLTELKKHFS
FT                   NKEEFDKDPSKYGFDITFPKVIANDKNVDTAIIKFNGKTYNNIKISPDNNDRDYSKVVS
FT                   KNGKDGVEKNNKKQDNVITSHRFDVLLDSYSQSWLGKLKDIIYKEDEDLPEFGKDMFFS
FT                   QKNQNSSETSSNGSSNTTSIDGYTIELKKEHKTWQDYIKNKIKNRFVDFDLNQNQSFQF
FT                   NTQSSNSSKPTPPNIPDLNKKPLDPTEKRDQNSVEYAEQLPRLKPILKWQYADHAEGSI
FT                   KSSFNSANEEKNPMFFFINPINTRFKYHVTALDNGRATVKIKDQVKDVERTYYTSDINY
FT                   EVDPRFTFILENLTKKIEAKFLQLYKALLLDEKINYVKLNNDHLQTSLFGLVNLATRIV
FT                   SDSKYLNDVLYNIATSEYQSLSHISSDDDYAGWINRVSNQAFARLLHAISASQLNNQNN
FT                   PWSVLTGGFKSVQEIYQELARVSGTRDQIIKKANDYNVDLSHLDQIYDYLDTSILKAQT
FT                   SANQIGKALNILSWYDNFTNHVKDTSEHSALLKVLIDTSDIKSDEKKVQEFQQTYQKAI
FT                   QKLEENNREKKKPLIIVSSLFLVISLLFIIANTLIFLIKTKRSKNKNAKLTFIISTTIS
FT                   TIITISSIILLIIGLKG"
FT   gene            complement(719463..719906)
FT                   /locus_tag="MMS_A0682"
FT   CDS_pept        complement(719463..719906)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0682"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69205"
FT                   /protein_id="ADK69205.1"
FT                   /translation="MAFSVEINFIENKQTINFNKAIVYFNADEENEWISLTNNSILGYE
FT                   IMLLKILDLSNNQEKYLFANNVNIMVKNNHIVINTFSKQNFLVKSNRKKVYQDQLKELH
FT                   KQISILQANQTIGLTINSLLELKKLKNKYYVLKLKNLLQLKGE"
FT   gene            complement(719906..720817)
FT                   /locus_tag="MMS_A0683"
FT   CDS_pept        complement(719906..720817)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0683"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70031"
FT                   /protein_id="ADK70031.1"
FT                   /translation="MDLKKVETKLNNLKTIQQRLSNEKNILLIDMIKQNALLNYYVKNA
FT                   LWNQNIISLLQNEYKIKNNLISEIKINKNKLINKLKDFIFQPKELWIYLTEEQKYSTDS
FT                   YSRYENHILNSIKKNNADFIVIGDRAKQFCSDNKLNVIYNVDQKQAISKLSWTLTLIIK
FT                   FLFSQYNYKSLRFVINSNKNKDNSFTILPLTKFNVNSLSETETKFDLDHIKEFKIFPDI
FT                   NNYIQTQIDNYIENSIQSLLVESSFYKTKNELIKTNKTINEVDEEVKKLNKKIIRIKRE
FT                   KEIEEIVLLTSNNKKFLIRRDQ"
FT   gene            complement(720819..721313)
FT                   /locus_tag="MMS_A0684"
FT   CDS_pept        complement(720819..721313)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0684"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69306"
FT                   /protein_id="ADK69306.1"
FT                   /translation="MKHKNKQTSDQSFMVFDLYEKIVNANNYIDYQKLLATVLLENQIG
FT                   FDSKVYKEFENSYLLAFKNHFDIVLNDFVITFNVNLKISSDLLVPMLSETESSNTEAIN
FT                   LKTSNNEQYQKFLTTYNNYFISLIKQGFCVEIFPNVILFKSKNTDHLKIVFDKTKVLTR
FT                   G"
FT   gene            complement(721288..722751)
FT                   /locus_tag="MMS_A0685"
FT   CDS_pept        complement(721288..722751)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0685"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70105"
FT                   /protein_id="ADK70105.1"
FT                   /translation="MISLKVEQQKFYDDGSNLILETKKNKIVSIYKTIILSFFFVSMAL
FT                   LLFLSNYSIFNKNIENSYQFLFNFSQPVFEQYNWVVLFRICLLGFLYFYGLKKAYINIE
FT                   PNKPYLKQYTIWFILYLITSISAFILFFTYSPLEAQNIINLIYSLIGLLLIDISYVLFK
FT                   YKTRKKLNPLVYQNKWSLIVDLISRTILVSLVLAIFLVWINQGGEAYEMLANNKFYEYV
FT                   LNLFGIKNFLNFLIIITSFIFIGLLFIGLNIYTILKIVYKQFSFEIIRDKLNFYLTGVI
FT                   VVFIWLISLVFLKIPSTHEVFVKNDNLEYLYLLFSLLNIIITIVYLWFKQFKNRLNSPL
FT                   IKISYLTIFHFIIWTVFMVASFLTTNTTVSMINLLITIVLVAISYYWHIKSSRFNNYYN
FT                   YLLITLNVIMIFIISLVFGFNQILLSHNNKNLFIIPLKANLLQIISIFIVAFQIINVIY
FT                   PLTYMLITSIKISKTFKKELNHETQKQTN"
FT   gene            complement(722782..725361)
FT                   /locus_tag="MMS_A0686"
FT   CDS_pept        complement(722782..725361)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0686"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69475"
FT                   /protein_id="ADK69475.1"
FT                   /translation="MKRFNKLLMYASSSTLLLPITLLVACTPSKVVSKPIDDNEFSKLI
FT                   NSIKTEDDLLKYADIKFKDQRGSEISKGNILPSQLKKENISIIFKGKYIGQISTEVLNV
FT                   NVINQDSSLGNKVNIFVQFTNKKTGTKIPTSFIISGLNENGNFDFSGTRIVNDLDYFGG
FT                   LSGFNDYSNKTQEQRFDYDNSRYITGLKNHLSSGTGTVDLKKLRGLDTKEEQIRTFDKL
FT                   AKEVKFDSYYNAALKGFTLPVYDNSGQFIGLSVNDEQEIGKIASHVDSLGRTEKAKTNG
FT                   LARTIPNDTYRTAAIQTYQVNFTIYKDYAKEIEEAEDNIQLFNKWDEKQIQSYISAQLN
FT                   QLRLNFEDEVSQIEKQLSQPLDGRTTIVENLNKRKSEITTEYEKKLKEISSLNRDNLVE
FT                   WQKKEIEEYKKKREEKIFRTSESGTMWIMDYIDINNPTKFYFGTNSHVAKGIRDDMISF
FT                   SLTRLNSNIKVGQTFGLNSADKNFTKFTFEPAKKEKKLNEAVTAIFHATDFIKKESSPL
FT                   SLLKDDQKTKYSEAGLFADFAVVEIDFEKLLDTNNFSRTIWSDSSDISSKYQDDKNELI
FT                   KKITNDYAKSDKKISFASESILDDKNYKKFDRKLDFNPENSDELKAYRDLDSLYIVGYP
FT                   TSNEDYYLDQYEDEKQLKNKKYDFSLWINNEYKYYKKLVNGEGTSSSFKDYELEKGNFF
FT                   SYQIGYRSFIDKPGLTDAFLAANKVGKKLYSLDEQNKGKAKKYFNYGLEILPRFYAPAG
FT                   GASGSSVRTKDNKLLAVYHAANGWAKTGLAAVFRSNGYDYKNLFGPYKLGQYDLIYGGG
FT                   KDQEKGKSYREALLKKYNNDIKSALLPNGFSDDKVPQQFKFDNGKQK"
FT   gene            complement(725385..727637)
FT                   /locus_tag="MMS_A0687"
FT   CDS_pept        complement(725385..727637)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0687"
FT                   /product="mycoplasma virulence signal region"
FT                   /note="identified by match to protein family HMM PF09610;
FT                   match to protein family HMM TIGR02184; Myco_arth_vir_N"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69122"
FT                   /protein_id="ADK69122.1"
FT                   /translation="MYFLKKKKNKILTIALVATLAASVSFGSVFYYSFSDNHISFDTSS
FT                   NGITDAELAPINNAINDAIVSNRDNKLKPSEEKIIKETEKKIEEKIIIPPAKKEEKIEA
FT                   AKPIPKPVVRKPETKITSPKITRRKQTIIIAGIEVEAEIEGPPGFVTHQRDKDRKISNP
FT                   TKPYQNHTVNKILSVKVTDKLKEQVAKDALNGGNGYDKGAGLFNNSIFNVLKKEFNSGK
FT                   ELNNILSTLESVARQNSGAFQNTLERYKKLLDSPNVINFLKSEAQKEYPKLKSKFQTKN
FT                   QEYIWLIANLDQSKFTKIASTSEKYLEKGLTISPRSAFINEAGEIDSNGWGPPDEYNTV
FT                   TSRLRRDNSEYRVFDYDEYYNRSSDKIANGTYPGWVKKDVSEEYSKKYNFKASDGIRFS
FT                   KLERINPNPTKGKLNSGLVLDLDVSNDEAYRRSKELIEKLQKDGEQITSYRIKNMGEKN
FT                   SDQAFKDILAALPKNIQQLELFFSDKATNTASLIALENKNIKELSLYTSGNSLKKAWSY
FT                   NPLALRNTTWINTIDYNVSAEYSRYDKITTRITFNTLAFDQEDFKNGSYERINDGLRMV
FT                   YYARNNEPFFQGGHGPGLEPDKKLGQNSYPTGLDFSRVIGIKSLKGLRFDDDLDTSNEP
FT                   RKITELTLYNNESYFEISSDELNEANLQHLSTGEGNLEKPKIHFSNGNNTTSIRISGKT
FT                   LLSDEGRKNLDKYLEYNESLRNSGKQIQIPSGSDELKKQLEGWGYKVSTASDRSFT"
FT   gene            complement(727910..730465)
FT                   /locus_tag="MMS_A0688"
FT   CDS_pept        complement(727910..730465)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0688"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0688"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69746"
FT                   /protein_id="ADK69746.1"
FT                   /translation="MKRVNKLLVLLSSTTLALPLTLLVACTSTKSSPKSIDDNEFLKVV
FT                   DSIKSEEDLLKYADLKFKDSRGSYISNGDVIPSQLEKSQVEITFKDNYKGQIRAEVTTI
FT                   NNNGSSSSVRLYVEFKNNKTGKTKSINFVVTGLNKKGVVDPFRNSSVNTISYFDGAGGF
FT                   DSYSNKSQKDRFKYDNEKYINSLEGQISPDKKPINLKTYRGLETSQDNINKFDQKANES
FT                   NFDTYYNAALKGFTLPVYNDKGEVNGLQINDGSEINKGPSTVDSLGRDRFKTNGLARTI
FT                   PNETYKTAAIQTFQVSFTAHKDYAAEIEEAEDNIKLFESWDDKQIENYIDIQLKQLKLN
FT                   FEDESGQIDKQIATTNRENTGIIDNLQKQKNELESKYKKDKDEISKLGKDGLVKWQQKQ
FT                   IQEYKEKKELKQFQASESGTMWIMDYLTENDGKNPTKFYFGTNSHVAKALKDDLLSASL
FT                   TRLNSNISVGQTFNLNGYDKNFTKFVFTPKNSKKITDAITTIFHATDFIKEDKNPLKFL
FT                   EPTQKDKYKEAGIFADFAVIEVDFEKLLNGSEYTHTVWSESKEITSGYETDKDKLISNI
FT                   TNDYASNNSKKVQFVSDSLLDEAYYKKYDRKLDFDKNNSSELEEYKKLESLYIVGYPTA
FT                   NEDYYLDQYEDHTQLSTKKYDFSLWVNSESKYYKKLANKEGYTSSFSKDELEKGNFLSY
FT                   QIGYRSFIDKPGLTDAFLAVHRIGKKLYTLNDNGKTKKYFNYGLEILPRFYAPAGGASG
FT                   SSVRTKDNKLLAVYHAANNIAKTGLAATFRSNGYDYKGLFGKYNLGQYDLIYGGGSDQA
FT                   SGKSYREVMKVKYSSGKSALFDKGFDHTPEEFKFKTQAK"
FT   gene            complement(730485..732737)
FT                   /locus_tag="MMS_A0689"
FT   CDS_pept        complement(730485..732737)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0689"
FT                   /product="mycoplasma virulence signal region"
FT                   /note="identified by match to protein family HMM PF09610;
FT                   match to protein family HMM TIGR02184; Myco_arth_vir_N"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69213"
FT                   /protein_id="ADK69213.1"
FT                   /translation="MYFLKKKKNKILTLVLVTSLATSLSFGSVIYYSFSDANISFDTSS
FT                   NGITDAELAPINNATNDAVVSNRDNKLKPSPKEEIRKTDSTEKLVIPTVRKDDKVTEVA
FT                   KPEFKPEIRKPDSSNIKPAITRSTRKIYISGVEVEAEVEGPPGFHVHEEDKRRGISNPK
FT                   KPYQNQSVGKILNVKVTNELRNSVIKNSLTGGEGYDKGAGLFNNSLFNVFDKDLSNTND
FT                   VEKTLEELEVVANQNASVYENTLERYKRLLDSDNVVNFLKEGAKEKYEELKPKFKTNKQ
FT                   RYIWLIANLDKNKFTKIASTSEKYLKEGLTISPRNAFINENGEIDSNGWGPPNEFNTVT
FT                   SRIQNDNSNYRTFSYDTPYNRSSHSIESGNYPGWTKKDVTSTYTKDYGFEEGKGITISE
FT                   LTRDKPTTAKDKINQGLVLEIDASKDYAYGKTKELIKKFKEKNQKITSYRIKNMGEKDS
FT                   AQNFIEILSELPEHIPQLELFFSDKATNTASLIALENKKIDDLSLYTNGNSLRRSWSYN
FT                   PLALKNITWINTIDYNVSAEYSKYEKISTRITFNTLAFDQKDYEKDGDYSRINDGLRMV
FT                   YYARNNEPFFQGGFGPGLSPDKSLGENSYPTGLDFTRIPKIRSLRGLRFDDEYNSSNRS
FT                   RKITELTLYNTGSAFNISVEELNNANLEHLSTGEGNPEKPKIYFSNGNETTSIKITGQG
FT                   RISEKGREYLSKYFKYGESFKGRPHLVEVESGATELKKQLESWGFNVNVSNGREFT"
FT   gene            complement(732904..733779)
FT                   /locus_tag="MMS_A0690"
FT   CDS_pept        complement(732904..733779)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0690"
FT                   /product="putative transposase InsK for insertion sequence
FT                   IS150"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0690"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69695"
FT                   /protein_id="ADK69695.1"
FT                   /translation="MLKTHKKVKIPILLKIAKLPKSSFYEWKHKLENTIDKDKELKEMI
FT                   VDIFSKSFETYGYRRLKMALKSKGYIVNHKKILRLTKELGVQCIKFRTKNGRYSSYKGT
FT                   VGKIADNVLKRNFHSLQANKLWCTDVTEFKVNGQKLYLSPIIDLYNDEIISYSIQTNPN
FT                   LNLTNSMLDKALKKVKNTNGLLIHSDQGFHYQHISWAKKLEENNITQSMSRKGNCLDNA
FT                   IIENFFGLLKQEIYYGEKYNSVEELTKRIHKYIYWYNNIRIKEKLKGLSPVQFRKQSCY
FT                   NIENFSPCLW"
FT   gene            complement(733788..734330)
FT                   /locus_tag="MMS_A0691"
FT   CDS_pept        complement(733788..734330)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0691"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69470"
FT                   /protein_id="ADK69470.1"
FT                   /translation="MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRF
FT                   EAFGIEGLINKEKKPYYSAKLKLKIVLYKLETNHSYDEVAKKFNIIYSSTIAGWVKKYR
FT                   EYGFLGLNNNIGRPKKIMKNLNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEFWK
FT                   KFHTLLTKEKSTRKKQK"
FT   gene            complement(734407..736005)
FT                   /locus_tag="MMS_A0692"
FT   CDS_pept        complement(734407..736005)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0692"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0692"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69940"
FT                   /protein_id="ADK69940.1"
FT                   /translation="MFNSWTEEQVKNYVNTQLHQLELNFKDNTREIEKQLRETPKNREG
FT                   IIKTLNEQKTKIEIKYREDLDKFNKLDKKGLIEWQQKEIEGYNKKKGQQTLRSSESGTM
FT                   WIMDYIDETNPTKFYFGTNSHVAKAIKDNLVSFSLTRLNSDISVGQTFNLNGFDKNFTK
FT                   FVFEKNENGTKLKDAVSAIFHATDFIKDESNPLKMLEDKQKEKYKDAGIFADFAVIEVD
FT                   FSKLLDNSKYKYSIWSESNEVSHKYDKDQNKLISLITNDYAKSNKQIQFESESLLDDKK
FT                   YKTFDRKLDFDPKKQNEVDEYTKLDSLYIVGYPIAVEDYYLDKYEDYKQLQNREYDYSL
FT                   WVNSESKYYKNLVKKEGTPPSFKEYETDKGNFFSYQIGYRSFIDKPGLTDAFLAVHRIG
FT                   KKLYTLDNNGKPKKYFNYGLEILPRFYAPSGGASGSSVRTKDNKLLAVFHAANNSAKTG
FT                   LAAVFRSRGKNYNNLFGNYKLGQYDLIYGGGKDQISGKSYREALKERYKDKNFKSALFK
FT                   DGFDKIPDQFQFKNS"
FT   gene            complement(736524..736967)
FT                   /locus_tag="MMS_A0693"
FT   CDS_pept        complement(736524..736967)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0693"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0693"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69162"
FT                   /protein_id="ADK69162.1"
FT                   /translation="MKKWNKLLTLVSLSSLALPLTLLISCTSTKQALKSINDKEFFKLV
FT                   DSIKTDDDLLKYADIKFKNSLGSYISKDNVIPTKLEKNQIEIIFKDPYKNQIDSEVVNV
FT                   ISNRSNGFASINEATLYVEFKNNKTGKTKSVNFKVTGLNKKIQ"
FT   gene            complement(736982..739234)
FT                   /locus_tag="MMS_A0694"
FT   CDS_pept        complement(736982..739234)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0694"
FT                   /product="mycoplasma virulence signal region"
FT                   /note="identified by match to protein family HMM PF09610;
FT                   match to protein family HMM TIGR02184; Myco_arth_vir_N"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0694"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69637"
FT                   /protein_id="ADK69637.1"
FT                   /translation="MYFVKKKKNKILIYALLASLATSLSFGSVIYYSFSDANISFETSS
FT                   NGITDAELTPINNATNDAVVSNRDNKLKPNPEKIIKESEKQEPNKLIIPKKEEKEIKEV
FT                   AKPKIKPEIIRPETLKPKPSTTRVKTKIIINGVTVDAEIEAPPGFVVQPNDKTRNIANP
FT                   TKPYQNHIVEKILSIEVTQALRDSVIKNSLTGGEGYDKGAGLFKNTLTNVISREIEENK
FT                   GDIHKALESLEAISNQNSNFFNSSIERYKRLLDSDKVIEYLKPEAKVQYPKLKGEFKTK
FT                   TQEYLWLIHNLDQSKFTKIASTSEKYLKEGLTISPRSAFINEKGEIDSHSWGPPDAYNS
FT                   VTSRLQRDNSTYRVFDYDQYYNRSSDRIEDGTYPGWTKKDVTNDFTSSFGFKKGDGITI
FT                   SRLTRDNKTNAEGKINSGLVLELDVSNIKAYEKSKELIEKFKSHSEKITSYRIKNMGEI
FT                   SSDQKFIDILSALPDEIPQLELFFSDKATNTASLIALENKKIKELSLYTNGNSLRNSWS
FT                   YNPLALRNTTWINTIDYNVSAQYSSHQKITTRITFNTLAFDQKDFENNSYQRINDGLRM
FT                   VYYARNNEPFFQGAFGPGLSPDRSLGDNSYPTGLDFSRVTGIKSLKGLRFDDEYNPSNK
FT                   PRKIAELTLFNDQNYFEISADELNDANLEHLSTGENSPIKPKIKFSNGSDTTKIRITGT
FT                   NITDQARQNLEKYFEYSDSLKANNKQIEVENINSELANKLKSWGYNVSQASNKQFT"
FT   gene            complement(739465..741054)
FT                   /locus_tag="MMS_A0695"
FT   CDS_pept        complement(739465..741054)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0695"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69294"
FT                   /protein_id="ADK69294.1"
FT                   /translation="MPRPDNKGFVYRLGYGYLHELKQYHDDPLAIIKAIIANFPLPWTK
FT                   EQARIKLDEIFKEKKETKKEVLERFKGYEVVEKLFDYFNIFNDCSPTKSTTLKDVVLQL
FT                   IYQRIKNPISVFNTYKTAKKEKIDTHSKNSFYRSLDYIAKNKDEILRNLNAKICANTNR
FT                   KIDVLWFDATTTYFETFSREGYKKPGYSKDGKFKEDQIVIGMATDENGISLHYKIFPGN
FT                   VADPNTLIPFMLEIADIYEVNSVTIIADKGMSVNRNIRFLESKNWKYIISYRMKAGSKQ
FT                   FKEYVLDEKDYINDGGLIYKTRDIASSYNKKRINGHFRRQIISFSQKRATKDKNDRDIL
FT                   IQNFTKKMNKDNLVSCDDLAGSKKYRFFKPINKGAFYELDIEKIQEDQKYDGYYVYETN
FT                   RTDLSVKEVINLYSKQWQIESNFKTLKGKLSLRPMYLSTWNHIVGYICLCFISLVFLNY
FT                   IIYILNSKLGLTGKSKITEHKVINVIKEVKEIEVFVNKQKIETIQVYNDELQESWQTYQ
FT                   ILLELLTKEKVT"
FT   gene            complement(741426..744014)
FT                   /locus_tag="MMS_A0696"
FT   CDS_pept        complement(741426..744014)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0696"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69723"
FT                   /protein_id="ADK69723.1"
FT                   /translation="MKKFNKLLMLISSSTLLIPLTLLVSCKPSTRKTTNKPLNDNEFIN
FT                   LVDSINNENDILKYADIKFKDPSGDLISKESVLPTRLSNNDISITFKNRYEKQVNASVT
FT                   NIKIEHSDNPFSVVNDATIFIEFKNASTNKSKTKSFKITGLNTKNTVDRSGHKVIDELV
FT                   YFGGETGYTKYTNNSQKERFKFDNDKYISRLESEFGGSKGSIDLKRFRGLESSVNDIKN
FT                   FDKQAESSNFDSYYNAALKGFTLPVYKDGKVDGLKINDASETIKGPSPIDSLGRIEKAK
FT                   TNGLARTIPNETYKTAAIQTFQVSFKGWKDYAQEIAEAEYYIKLFERWTDDQIKQYIAR
FT                   QLWQLEQNLKYDLNLVEKDIATTDPELITVIKGFNDKKEQLKKDYEKEKARLSSLKKDE
FT                   LVQWQQEEIEKYKKKKEEKIFQTSESGTMWIMDYINENNNKTPTKFYFGTNSHVAKAIK
FT                   DDLISVSLTRINSDINVGQTFNINSFDKNFTTFTFEAQENKSKISNAVTAIYHATDFIK
FT                   KESSPVELLEKEQKEKYKDAGIFADFAVIEIDFEKLLKTDDYKRSIWNEKTEISDKSPS
FT                   DQEGLIKKITNDYQNSKSKVQFESNSLLEDQFYNTFDRKLDFNHNKPEDVKNYKDLNSF
FT                   YILGYPSSKEDHYLEKYYDQKQLDYQKYDFSLWVNSEYKYYKNIVKKEGYTSSFKDYEL
FT                   EKGNFLSYQIGYRSFIDKPGLTDAFLAVHRIGNDLYTLYDEKEKKVKHYFNYGLEILPR
FT                   FYAPAGGASGSSVRTKDNKLIAVFHAANYVAKTGLAATFRSNGYDYNNLFGNYKLGQYD
FT                   LIYGGGKDQISGRSYREVMQKLYKDKKSALFANGFNEIPESFKFNNNKTK"
FT   gene            complement(744035..746296)
FT                   /locus_tag="MMS_A0697"
FT   CDS_pept        complement(744035..746296)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0697"
FT                   /product="mycoplasma virulence signal region"
FT                   /note="identified by match to protein family HMM PF09610;
FT                   Myco_arth_vir_N"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0697"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69972"
FT                   /protein_id="ADK69972.1"
FT                   /translation="MVYFFKKKKNKILMYALLASLATSLSFGSVIYYSISDANISFETS
FT                   SNGITDAELTPINNATNDAVVSNRDNKLKPNPEKIIKESEKQEPNKLIIPKKEEKEIKE
FT                   AANPEIKPEINKPQSRTIRHTTSRSKTKISINGVEVEAEIEGSAGFHVHDQDRTRRITN
FT                   PTKPYQNHTVGKIISIEVTEELKKSVLNNALVAPDGHEDKGAGLFNNTLMQVFDSELNG
FT                   AFDVIKALETLEEIGKVNSDFFKNNIERYQKLLDSPKVVDFLKENAKKKYPELKTKFKT
FT                   KTQEYIWLIHNLDKSKFTTIASRSEKYLKEGLTISPRNAFINENGEIDSHSWGPPAQFN
FT                   TVTSRMQRDNSEYRIFDYDAWQTRTPGDIDAGNFPGWKKENVTSQFTSKFNFSENDGIT
FT                   VTRLTREKQTNAKDKINTGLVLELDVSNPNAYKKAKNLINKFKTNDEKITSYRIKNMGE
FT                   VDTSQSFKQILDELPNEIPQLELFFSDKATNTASLIALENKKIKELSLFTNGNSLRNSW
FT                   SYNPLSFRNTTYINNLDYNVSYDYPKHEKISTRITFNTLAFDKDDYKNDQNYQRINDGL
FT                   RMVYYARNNEPFFQGAFGSGLTPDKKLGDNSYPSKLDFSRVTGIKSLRGLIFHDEYDSS
FT                   NKSRKITELTLYNNEDFFEISADELDKANLEHLSTGEGSPEKPKINFSNGSSTKGIRIK
FT                   GTSELSESGRKNLEKYFEYSESLKFAGKQIQVDSSSNQLKEQLKSWGYSVSDSSTRSFT
FT                   "
FT   gene            complement(746448..746609)
FT                   /locus_tag="MMS_A0698"
FT   CDS_pept        complement(746448..746609)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0698"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0698"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69395"
FT                   /protein_id="ADK69395.1"
FT                   /translation="MSDNQLIGVSNYLLNSNAQLIISILKDKIPDEVWKNSNVVLELSQ
FT                   KDKLFKFD"
FT   gene            complement(746761..747177)
FT                   /locus_tag="MMS_A0699"
FT   CDS_pept        complement(746761..747177)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0699"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0699"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70058"
FT                   /protein_id="ADK70058.1"
FT                   /translation="MLDEKIAFASKELPEIFKQMSSLQNQLNELLKIEKDLSIRLSKDD
FT                   TFKELDKIITQLNEKHYEKGEYETKLSQINDSEKIIFKLKQKISLLSNDLYSKEFKNKL
FT                   DERLNTFNKYFQKLSDTLYNERYFLTYSNRKWKK"
FT   gene            complement(747195..747491)
FT                   /locus_tag="MMS_A0700"
FT   CDS_pept        complement(747195..747491)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0700"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69169"
FT                   /protein_id="ADK69169.1"
FT                   /translation="MYVQTLEIINNEINELKKKKETLNIDEDFQINLDAFNEIKHNISM
FT                   LSNKIGLLETRKNGINDFINRMNSNRSSVDTKQLELIYNQTDLFQNYIRLLNN"
FT   gene            complement(747829..748158)
FT                   /locus_tag="MMS_A0701"
FT   CDS_pept        complement(747829..748158)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0701"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0701"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69634"
FT                   /protein_id="ADK69634.1"
FT                   /translation="MFIKRLKISTPNQVIRDLEFKKGLNLIVDNTPINDLTQTGNNVGK
FT                   TTVLKLISFCLAGKADDIYKGIESKTTNDIVKDFLINNKVLITLELVENLDNPFSNKIT
FT                   IQRNF"
FT   gene            complement(748149..748376)
FT                   /locus_tag="MMS_A0702"
FT   CDS_pept        complement(748149..748376)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0702"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0702"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69200"
FT                   /protein_id="ADK69200.1"
FT                   /translation="MLLPDNIQPKLSVYYNASLILKTLCKKSNLDIIDLHVDIKTLENM
FT                   PFNIFLLSLDWLYLTNKIDINDQGVVLLCL"
FT   gene            complement(748379..748843)
FT                   /locus_tag="MMS_A0703"
FT   CDS_pept        complement(748379..748843)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0703"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0703"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69408"
FT                   /protein_id="ADK69408.1"
FT                   /translation="MTQKNINVSILAEIINKLSEINLAETKVRIPKVKPFKMQDKINFN
FT                   NLIKTKYIIEDHCFFSSIVYDIYYQFDEQANNRSFAVLQTIRQVYNELTSLNKYSSDEI
FT                   YNKCKNKIKSFVENSINLKVLEIESLLLYIDIILVDAFIRCEIFKEVEII"
FT   gene            complement(749371..750216)
FT                   /locus_tag="MMS_A0704"
FT   CDS_pept        complement(749371..750216)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0704"
FT                   /product="putative tagatose-bisphosphate aldolase"
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0704"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69902"
FT                   /protein_id="ADK69902.1"
FT                   /translation="MKASLKDQLLKARQNHYAIGAFNFDNLEMLKAIVEAAEESNSPII
FT                   AMITESAAKYIGKEIVIASANAIISNTKVPIVLHWDHGYDLNLIKWACDNEFSSVMLDA
FT                   SLDDFNTNVNKTLEIVNYAKSKNVEVESEIGHVGGKEDDTDSNIDKYTSVDEAIKFVNL
FT                   TQIDALAIAVGTSHGIFKTEPNLNFDRIKEIRDSINTPLVLHGSSGLSDTDLKKVINSG
FT                   ICKINIGTDLKLVYANSLKQWFKENPTSYDARKFGRFAIEQMKNVIKQKLEILGSINKA
FT                   "
FT   gene            750419..751153
FT                   /locus_tag="MMS_A0705"
FT   CDS_pept        750419..751153
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0705"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0705"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69552"
FT                   /protein_id="ADK69552.1"
FT                   /translation="MLKDQRRQKILEIVNEKDFVTNRQLAKLLSSTIQTIISDISELDK
FT                   GKKLYKVYGGAKSANSLAKRYELFDEEKQHINIDIKDLIAQKASEYVSNGDLIFLDTGT
FT                   TTKQMIKYLINKKIIVVTNGYSIALKLVEQDIEVILLGGSINPSTHATIGELALKNLDN
FT                   FYFDKVFIGMNNLSSQHFYTTNIKEALIKEKAIKNSDKSFILMDSSKFGSKNVIKVDVL
FT                   KETILISDKDTDEYKGLIINLE"
FT   gene            751162..753048
FT                   /locus_tag="MMS_A0706"
FT   CDS_pept        751162..753048
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0706"
FT                   /product="phosphotransferase system, EIIB"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0706"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69992"
FT                   /protein_id="ADK69992.1"
FT                   /translation="MTKQQKQLALIEEIFINVGGKQNIKDVYNCATRLRLTLYDQSLIK
FT                   LDNLKTLKRTQGCLISSGELQIIIGSEVSQITNLLKEQLQINIDKINGFEIKNSLNVNN
FT                   KKVGLTKRFVKSISAIFGPLIPFLIGFGLIMALQQILIRIGWVHLIKSDSVFQKDYNIF
FT                   DLVINTIANSGFKLIGVMVIWSTTRYLKGNTAIAIALGLIMISPIIPEQGLHLLNIGSW
FT                   EIVIKPFYSKILVFIFTGVVISYFQKLMNKYFHSVANFILNPLLSLLIGGLLAFFVIGS
FT                   IMSIIESYVLKAFNWFVTLPYGISGLIIGLTWQPLVVLGVHNVLFFTAIADLTTTNNPS
FT                   IFLAAAFAAAWAQMGATIAVGIKSKKSVDKSAAIAAALPGIISGPTESCIYAINLPRFK
FT                   PFILGTIAGGIGGWLISIFNVGLNNLAGLGGDVGFLAYTDKLVLAIIIDLVSFVLGILI
FT                   TYVFWNEQQAEEILFKDITKELKIKTGHYSSKLQTLLIKLKIKKEQTSEKQTEIIKTYK
FT                   DIDLLYKDIKKFSKQTLKYEKLVEKLKKIETKNYKIKNNILAKKLEEQKLKLENQIKRQ
FT                   EDIIIKNSKINYTKIKNYIEQLEKITNSNLKDFKTKYYSAINKIALDYKLIN"
FT   gene            753061..753435
FT                   /locus_tag="MMS_A0707"
FT   CDS_pept        753061..753435
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0707"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0707"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69161"
FT                   /protein_id="ADK69161.1"
FT                   /translation="MHNKIHIVSLSPSIDYILKFDNFLKNKTNRPKSQYMYAAGKAIHI
FT                   SMLLNRLNIDNELLVFTNGSFETFFYNDLKKEQIKYKKFKSNGDIRINLKIIDNEQTES
FT                   SSYAPEININELNKLKKIFK"
FT   gene            753440..754003
FT                   /locus_tag="MMS_A0709"
FT   CDS_pept        753440..754003
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0709"
FT                   /product="1-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0709"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69865"
FT                   /protein_id="ADK69865.1"
FT                   /translation="MQKDDVLILTGSLPINTDTNIYAELVELANLKKAYSIVDSFEDVL
FT                   LKAIEKQPFLIKPNKDELEATFNKKLENDFDIINQAKILLQKGCKNVLVSLGKDGAILV
FT                   TSTKIYKASLPKWDYKIENLAGAGDSMIAGFITKYLQTNDYIKALKFSIICGSATAFSY
FT                   KIASKEFIDKLSNYLDEIDIREIN"
FT   gene            complement(753971..754483)
FT                   /locus_tag="MMS_A0708"
FT   CDS_pept        complement(753971..754483)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0708"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0708"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69802"
FT                   /protein_id="ADK69802.1"
FT                   /translation="MQSKIYINNIINKLTRLQYEIKAFNNAKLFDTNKISENILKDILN
FT                   IIYGWSLINANTIKSNISGFDLIDTKNKILIQVSTTFTKTKLEDSLNKQIYKDYLGYNF
FT                   KFLSLIISTNNNWSNIKNPYNLNFDLKNDLIDLTLPLKIKRRFNIKSPFNFHKSLLLIY
FT                   LSNIYFI"
FT   gene            complement(754586..755542)
FT                   /locus_tag="MMS_A0710"
FT   CDS_pept        complement(754586..755542)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0710"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69378"
FT                   /protein_id="ADK69378.1"
FT                   /translation="MVDNNLFSQFISAIGQAKKIVFVGDINQLPSVEIGNVFEDIIKSK
FT                   KITTVELKSTHRQANNSKIVELAYMIKDNNFDLKKLYENQTTENQSKTDLQTIFVDNQE
FT                   QCLKEIINNYNLDNKTGFHEPYKIQIISPFKDDILGVKDINKFIQNNRFKQEKLDENTE
FT                   LCIQINNSEYYQKDKVMYLRNENDLSNGDIGVIQKIHKDSNELKINFNDKIFSTINNAS
FT                   LKNLTLCYACTVHKTQGSEFEKVILVLDPKRSSSFIDKKLIYTAITRARKQLVIIANKN
FT                   SFINGINKNPETRDTTLVKHIKLMYKKRKKSHYSYIF"
FT   gene            complement(756218..756850)
FT                   /locus_tag="MMS_A0711"
FT   CDS_pept        complement(756218..756850)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0711"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0711"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70044"
FT                   /protein_id="ADK70044.1"
FT                   /translation="MLETLGYIKKFTSIKDNKWAVAEFLILKDNKLIKISGSISDMVIG
FT                   VLYHITLNSTPKSKNNQDIFTCTSYKVQDMNKNMFIDYLNSDVFIKCVNSDLVNIITTN
FT                   FTCDYIKEILFNKDQFLNIDINFKSNLKNIYKKLSNIYKFAILESEFTENNLDLFMLKA
FT                   LKEQDKQDNFSFEEILDLLTNNIFYFNYLHNIVDFQLLIKSFYILIV"
FT   gene            complement(757771..758148)
FT                   /locus_tag="MMS_A0712"
FT   CDS_pept        complement(757771..758148)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0712"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0712"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69580"
FT                   /protein_id="ADK69580.1"
FT                   /translation="MARQLTVNDYKDMFVIRPMYFISFLGVLETIALKYKDLKLNKLQR
FT                   EIMFKEKQDILDEFEEFKNNLLDNALKHIDTKFNEINKSAENVKKEANKILEATELVIN
FT                   KHLNTVKNKINNFKIEKVLES"
FT   gene            complement(758221..759378)
FT                   /locus_tag="MMS_A0713"
FT   CDS_pept        complement(758221..759378)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0713"
FT                   /product="conserved hypothetical protein"
FT                   /note="This ORF contains tandem Palindromic Amphipathic
FT                   Repeat Coding ELements.; identified by match to protein
FT                   family HMM PF03382; match to protein family HMM TIGR02167"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0713"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69793"
FT                   /protein_id="ADK69793.1"
FT                   /translation="MKNILKFLSVITLIPTTSLLVISCTSQTKETTKKTENPTQTLSPD
FT                   KQTINKIKNILDQQSEAFGSFHTFQDVVDQIKVYAKNEGIKELDKLELLDKKLANKTLT
FT                   LGNNKNNLKLKYFDIEIPFVLKNVLENEVKTKYSSTNPNEIIQLGYKKNDNYIQLNIEN
FT                   KTITKVPVTLPLKINSFYEAFDGLKSKIVTNLDKWDTSNVKILTNAFNNAKNFNTNISN
FT                   WNTSKVTDMSGVFFDAEKFDQPIGKWNTSKVTDMSAMFFGAKNFNQDLNNWDVKNVKNM
FT                   AQMFWDATKFNGKITNWDVSNVVSTNNMFADAESFNQDISNWNTSNVISMDGMFARAKS
FT                   FTWSLRKWNVKKVVKAQGFRIENKNNLDDDKIPPFKNEVKEYIDD"
FT   gene            759852..760220
FT                   /locus_tag="MMS_A0714"
FT   CDS_pept        759852..760220
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0714"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0714"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69044"
FT                   /protein_id="ADK69044.1"
FT                   /translation="MLNHFFNWLICCSNCSFCLFNKILYWFSNCNLINFSCWFNFSFNN
FT                   LIFDSNSNFWLINCSNSFLLFSNFSISVLLVAFKSEISIVVDSNFLLYSLIKSFSNFYY
FT                   SLIFNNSQFCFSCFNFSK"
FT   gene            760555..762486
FT                   /locus_tag="MMS_A0715"
FT   CDS_pept        760555..762486
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0715"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0715"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69773"
FT                   /protein_id="ADK69773.1"
FT                   /translation="MDQDKKEILIKNINNWKHKLLDLGMKNKSLNFNIKTTKTISSKIQ
FT                   IIYPNLLDFLKSLDTSSKEIYEISNYKMLGLYKTDHLKNQVLYSHNLEEINKNNSFYKT
FT                   KIYTQFGYFESKDILDLTLKKIYKISKTWKDEYSIDVLYLAFGFLKWYKTNDSNEIRYA
FT                   PLLLLPIELKKNLNTWSIHIKKAENFIQNEALVKKIKNDFDIDAELDLNKDDLINIYKS
FT                   YSQKILNQVIDQRWEIIDDIYLANFDFSRINIYKDIEANINSIIESDFFKKIVDQTNNL
FT                   DNDISTINEQNIDTKINILEQYKILDADSSQEIAIQNAILGKSFVLQGPPGTGKSQTIT
FT                   NIITELISRNKKILFVAEKNAALQVVYNNLKKIGLEKYAIPIHDSKINKSEILNELINS
FT                   ANNSQLFLLDDQKLESFISNYQKIKEIFSNYKDVLLKKRSIEFDNVYGYINKYYLYKNY
FT                   LDLNFEINNINKITNQNFEQYLQLINRFYESYKLIGFNYKNNLWYGFNKTNLDFLTKTQ
FT                   IFENLTKFNTEIENIKNYINKANVLANTNTINLEFILKITYLKEITDLYKHIKPLYKNQ
FT                   ILEIKTLNEQLQKVNQLVEFYYIKNLLIQTLNNNWTNLDFINDNQIKQTIDYIKKTINK
FT                   PLKVLSLK"
FT   gene            762568..762924
FT                   /locus_tag="MMS_A0716"
FT   CDS_pept        762568..762924
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0716"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0716"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69128"
FT                   /protein_id="ADK69128.1"
FT                   /translation="MFLDLFNTKKQATDFNEQLIFNIDIKDINQLLNTKQTLEKMINLY
FT                   NDQTISNTLLNILANQNKLDQLTNNINSFYDAYLEFLTLLNKDKTTYLKFSYLEFKNLI
FT                   ENLINNKKPIRSIY"
FT   gene            763094..765235
FT                   /locus_tag="MMS_A0717"
FT   CDS_pept        763094..765235
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0717"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0717"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69885"
FT                   /protein_id="ADK69885.1"
FT                   /translation="MNSNLELFKTKDKEINNIAKDRIIMTLDKKIKESLIFENTNPQYS
FT                   IIKRESAKKRLKMSFKTIFENALEFILNIKPCLMLSPLTVSYLFKDIDYKFDTVIFDEA
FT                   SQIKPETAISSLFRAKQVIIVGDKEQMPPTNFFNTLENDEVVQKTNIEEDISSGYESLL
FT                   SLAEGNLDSIRLKWHYRSKFEDLIYISNKFIYNDLITFPNSKLPKDYEGLRFIYSNPNQ
FT                   QTDEYHTILKALQTLKQIILTYQNKYSFGIVVFNTEIEAKANEYLDKFLEQNPDLLPFF
FT                   NEDVKEPFFIKNIETVQGDERDFIIFIINGKINKNNRVGVVFGEINKQNGYKRLNVAIS
FT                   RAKRGMIVVSNFKHNDVDWFKSEQDGIKMLEKFIKNAELGVDNLKHLDLDSNFKSAFEQ
FT                   EVYEQLVLKGWKVKKQVGSSEFKIDLVVVDPRNQNKFLLAIECDGSAFNLAKSTRDRDR
FT                   LYQQVLESRGWAFHRIWSTDWFKNPSLQIDLIEEKLNKLLNINKENKIENKIISNQTNT
FT                   DKFIKKTNQPTEIFQTYPSINKLIKQVGYHSLANQTGFFIKKVSDLENATSYILNQIGP
FT                   LLLTSVYKIVRDITKQQRVSDTVKLAVSRMISSIGTLDKDQFLIPYGWEFKFRQSTNND
FT                   NKRSISEIHDKEIKHFILTIFKTNNMAISTTDFTKELTLKTYNKSISQNSIDKIQHVLD
FT                   QMVKDKIIVEEIKNVYRLI"
FT   gene            765652..766137
FT                   /locus_tag="MMS_A0718"
FT   CDS_pept        765652..766137
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0718"
FT                   /product="Fic family protein"
FT                   /note="identified by match to protein family HMM PF02661"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0718"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69489"
FT                   /protein_id="ADK69489.1"
FT                   /translation="MTELLNDNLKLNIKIIKDLHYFVLKSKKLNAGVFRKIPVSILNSV
FT                   HTPVQPYLIEPKLEQLLEDYFNSNDHIIKKIAKFHFESIHPFIDGNGRTGRLLINYQLM
FT                   RNGYYPIDIKFENRNLYYQAFDDYHQKNDLSTMIKLIANFELLRLNFYIRTLKENNI"
FT   gene            766419..766574
FT                   /locus_tag="MMS_A0719"
FT   CDS_pept        766419..766574
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0719"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0719"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69153"
FT                   /protein_id="ADK69153.1"
FT                   /translation="MAKKKTNIKIASKNKKEQNDKKKKKKYLIVLAGLLLGTSLITRTT
FT                   VGILKK"
FT   gene            767364..767489
FT                   /locus_tag="MMS_A0720"
FT   CDS_pept        767364..767489
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0720"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0720"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69622"
FT                   /protein_id="ADK69622.1"
FT                   /translation="MIKLNLKKLDILKTIMVNDKFNQFQFMLKKFQKNYQDLLLI"
FT   gene            767564..767722
FT                   /locus_tag="MMS_A0721"
FT   CDS_pept        767564..767722
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0721"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0721"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69266"
FT                   /protein_id="ADK69266.1"
FT                   /translation="MNSMFNNASSFNQDLLNWDVHRVIYVTSFNTNSHPEFDDKKIPKK
FT                   FVDLLKK"
FT   gene            767798..768340
FT                   /locus_tag="MMS_A0722"
FT   CDS_pept        767798..768340
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0722"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0722"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69738"
FT                   /protein_id="ADK69738.1"
FT                   /translation="MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRF
FT                   EAFGIEGLINKEKKPYYSAKLKLKIVLYKLETNHSYDKVAKKFNIIYSSTIAGWVKKYR
FT                   EYGFLGLNNNIGRPKKIMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEFWK
FT                   KFHTLLTKEKSTRKKQK"
FT   gene            768349..769197
FT                   /locus_tag="MMS_A0723"
FT   CDS_pept        768349..769197
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0723"
FT                   /product="putative transposase InsK for insertion sequence
FT                   IS150"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0723"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69397"
FT                   /protein_id="ADK69397.1"
FT                   /translation="MLKTHKKVKIPILLKIAKLPKSSFYEWKHKLENTIDKDKELKEMI
FT                   VDIFSKSFETYGYRRLKMALKSKGYIVNHKKILRLTKELGVQCIKFRTKNGRYSSYKGT
FT                   VGKIADNVLKRNFHSLQANKLWCTDVTEFKVNGQKLYLSPIIDLYNDEIISYSIQTNPN
FT                   LNLTNSMLDKALKKVKNTNGLLIHSDQGFHYQHISWAKKLEENNITQSMSRKGNCLDNA
FT                   IIENFFGLLKQEIYYGEKYNSVEELTKRIHKYIYWYNNIRIKEKLKYEKFCIKELETHI
FT                   L"
FT   gene            complement(769214..769354)
FT                   /locus_tag="MMS_A0724"
FT   CDS_pept        complement(769214..769354)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0724"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0724"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70020"
FT                   /protein_id="ADK70020.1"
FT                   /translation="MKDNNSRFIPWDSISEEELLENAKCKIDDTFNDKEFVALLKKLEK
FT                   M"
FT   gene            complement(769396..770076)
FT                   /locus_tag="MMS_A0725"
FT   CDS_pept        complement(769396..770076)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0725"
FT                   /product="death-on-curing family protein"
FT                   /note="identified by match to protein family HMM TIGR01550"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0725"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69639"
FT                   /protein_id="ADK69639.1"
FT                   /translation="MVVIPIRIFITDKTYFQLKHYNFNFDLITKKNIDYFVISNGKNIF
FT                   YDTDNNKFYMRTKKNTKVWFDFNFSVIDFNEKFSNLINNVYHYSMNKLNKIFFSKDGNL
FT                   YFQEKEKGSLLSGINSTIFKYSYKSENYDIFDFVTEIFIKVLTGHYFIDGNKRTALMLL
FT                   IQLLRIFGYYFYFSDDINLFKHYYYEKIEKELANFVQMLQKKKITYKEIKRWIYSRTIV
FT                   DFKF"
FT   gene            complement(770527..770805)
FT                   /locus_tag="MMS_A0726"
FT   CDS_pept        complement(770527..770805)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0726"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0726"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70123"
FT                   /protein_id="ADK70123.1"
FT                   /translation="MLQELKKLNKSIEKFAKQLNKSKVKSNDSDKIDKAKRFKLFDFNK
FT                   FNNTNPSFEIKQSNLSLQNNQNITDKKIGSKLNKLNIFKKKDKEVKK"
FT   gene            complement(771150..771749)
FT                   /locus_tag="MMS_A0727"
FT   CDS_pept        complement(771150..771749)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0727"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0727"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70122"
FT                   /protein_id="ADK70122.1"
FT                   /translation="MFIWNVSFLFLNYFTNRLLDPIVAAITSSGKARHISNFGESIIKS
FT                   LVTLVGIVSSATFVSKGANLLGDLTGESISVSSPAAVLKLAGKVTTAGIGAGLSKFKNK
FT                   KNNSSPNSTDTSKTSSSSTTNNNSTPVVKQSISDKVNKSKQPSRNSGVILKGESSIAAV
FT                   NQKRINNSKKLAELARSFFLKIKSKPHQKLIVKLSN"
FT   gene            771870..772682
FT                   /locus_tag="MMS_A0728"
FT   CDS_pept        771870..772682
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0728"
FT                   /product="conserved domain protein"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0728"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69483"
FT                   /protein_id="ADK69483.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNYFNTIYAWNCRYLWS"
FT   gene            772651..772920
FT                   /locus_tag="MMS_A0729"
FT   CDS_pept        772651..772920
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0729"
FT                   /product="conserved domain protein"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0729"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70101"
FT                   /protein_id="ADK70101.1"
FT                   /translation="MLEIADIYEVNSVTIIADKGMSVNRNIRFLESKNWKYIISYRMKA
FT                   GSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKKELMDILEDK"
FT   gene            772995..773543
FT                   /locus_tag="MMS_A0730"
FT   CDS_pept        772995..773543
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0730"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0730"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69463"
FT                   /protein_id="ADK69463.1"
FT                   /translation="MNKDNLVSCDDLAGSKKYRFFKPINKGAFYELDIEKIQEDQKYDG
FT                   YYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLSLRPMYLSTWNHIVGYICLCFI
FT                   SLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKEIEVFVNKQKIETIQVYNDELQ
FT                   ESWQTYQILLELLTKEKVT"
FT   gene            complement(773552..774439)
FT                   /locus_tag="MMS_A0731"
FT   CDS_pept        complement(773552..774439)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0731"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0731"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69160"
FT                   /protein_id="ADK69160.1"
FT                   /translation="MFKAIKEFINTIGRIFENLPNFLLWCLLLPLLAIPAGLAVIVDFF
FT                   GRDLIKLLIFGGDDFDVNKLPQAFKTIAIIAAAIAIISFIFFFVFLIAKEDSRKHIKQT
FT                   IKGIVIATLFVSTMPIAFFLLQYVVSIFFDLIKLAFGLENQSASQTVIENILKTGLTRP
FT                   WDTKMDVQSLSLNMKIGIFLNWVEYVNPVFPLITTVLVTWTYIQFSIAIMQKSMELFSL
FT                   FITSPIYGITAVFDGQKIFKKYIREKIIGKSFAVLGLMFIWNVSFLFSYVSQFKHKTRK
FT                   HTYVNFWSHKLCFL"
FT   gene            complement(774732..775955)
FT                   /locus_tag="MMS_A0732"
FT   CDS_pept        complement(774732..775955)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0732"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0732"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69617"
FT                   /protein_id="ADK69617.1"
FT                   /translation="MKLKKTVWIPLVCTPVLLTAIIVPPVVIYKNKQKVSKATDNKKSE
FT                   STNNPTTNRSKELEPVKPTPQSTPTTKPTFIVNPSIETLKVQLENISQILTSTLSNKKY
FT                   KTLQNLESEIRQTIRDNNNSFNRISSKLTDTKSIPEHIWNTTINVNLKIDDSNKNPVLS
FT                   STSINNVSIGVYDIDEIITRKNIWIDIDELKKLVHNSNSEQQKEKLFHYLKKNNPTIAD
FT                   ESVFNKDSYNYDFSNTEVKEVVTSTESGPITIAGHSTIYHYYFSGMEYKESWYQTKLKI
FT                   TKNNSTKDFVDWNNKKTIELTFYAFISAPTKNKYETSNTLFYENRGDFNGGYILIIDKD
FT                   GNEKRVDKETLKKIRNVKWGYEDYDYEKWKKQGWKIEEIITWNDFRSKYDDWPYTIKRF
FT                   PETEREAY"
FT   gene            complement(776320..776523)
FT                   /locus_tag="MMS_A0733"
FT   CDS_pept        complement(776320..776523)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0733"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0733"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69296"
FT                   /protein_id="ADK69296.1"
FT                   /translation="MFKQAVYNVNKTKCLEIGYFTNKNNQVQIQRFPHIIKKVPKVLQN
FT                   QIINLFNAFYKNQNEFIDGIQY"
FT   gene            776896..778728
FT                   /locus_tag="MMS_A0734"
FT   CDS_pept        776896..778728
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0734"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM PF07521"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0734"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69905"
FT                   /protein_id="ADK69905.1"
FT                   /translation="MSNIDKKDLDILNKENENLINTFDDDGDQLNISIDEKEFKPYVFK
FT                   QKEVKRQYQKTNIPTKIFALGGLEEVGKNTYCIEYDNELIMIDAGVKFPESTMLGVSAV
FT                   IPDYSYLAENQKKIKALFITHGHEDHIGGIQYLVQQVKIPVIYAPKLAAMLIRDKLKEY
FT                   KIEDKTIVKEYDADDVWKTKNFKVSYAALNHSIPDAFGILVQTPNGNIFSTGDYKFDWS
FT                   PLGHFAELTKLASMGENGVELLMADSTNSEVEGYTQGEKSIISNIDKLFLQAKGRIFLT
FT                   TFASNVHRIQHIIETAHKYNRKIVILGRSFERIIKIIRQIGHLKISEKEFIKSTDIDKY
FT                   KPEELMILTTGSQGEPMAALSRIANNKHLSINIIPGDTIVFSSSPIPGNRADVEKLVNK
FT                   LTRVGAIVIENTSDNKIHTSGHASQEEQKLLFSLIRPKYFMPMHGEYRMLKKHVETGES
FT                   VNLEKGNGFIMANGDVLELLQGKAKIGKRVEADAVYVDGKDMTGKASNVIREREILSKD
FT                   GLIAVVISLDSQTNKLISQPRIISRGSFYVKDAGSIISDSIQIITNAVNEVLMSSKPTF
FT                   AAIKKAIKSSSSPYIFRVKRRNPLIIPVILNKKS"
FT   gene            778803..779747
FT                   /locus_tag="MMS_A0735"
FT   CDS_pept        778803..779747
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0735"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0735"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69426"
FT                   /protein_id="ADK69426.1"
FT                   /translation="MKNNNLSFFSSPRTQIKVFQWVGTIFAVIGMLISLYFLNKINVKA
FT                   LDQSKQVLLALGYAIMGYMFWKTIISAIIILRFVKKSTDEELVANRYILASLSLNLGGF
FT                   LTPWVLTSLPNVTTQSTIKPKWFLSRSFAIITTIGSAIFLGILFWQLKTIEPNTNWFDQ
FT                   TKEWYWILVGFIIGNGVLLVVGLLAFVLFFNKNSKERFKGNTFTSFLMKTIAVFYLVIV
FT                   TVELILLMIYSILRLIGNILNTARRVLQADNMFIGVLYLLFGLLSTFFQIYYVIFLTIM
FT                   ISQTIKGIWRKDGVITIKVYDKIQDNKNKYDLR"
FT   gene            complement(780000..781673)
FT                   /locus_tag="MMS_A0736"
FT   CDS_pept        complement(780000..781673)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0736"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0736"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70033"
FT                   /protein_id="ADK70033.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKLATKDKNNRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            complement(781766..782416)
FT                   /locus_tag="MMS_A0737"
FT   CDS_pept        complement(781766..782416)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0737"
FT                   /product="putative transposase InsK for insertion sequence
FT                   IS150"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0737"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69734"
FT                   /protein_id="ADK69734.1"
FT                   /translation="MLTFFSKSFETYGYRRLKMALKSKGYIVNHKKILRLTKELGVQCI
FT                   KFRTKNGRYSSYKGTVGKIADNVLKRNFHSLQANKLWCADVTEFKVNGQKLYLSPIIDL
FT                   YNDEIISYSIQTNPNLNLTNSMLDKALKKVKNTNGLLIHSDQGFHYQHISWAKKLEENN
FT                   ITQSMSRKGNCLDNAIIENFFGLLKQEIYYGEKYNSVEELTKRIHKYIPTFPT"
FT   gene            complement(782400..782549)
FT                   /locus_tag="MMS_A0738"
FT   CDS_pept        complement(782400..782549)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0738"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0738"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69094"
FT                   /protein_id="ADK69094.1"
FT                   /translation="MLKTHKKVKIPILLKIAKLPKSSFYEWKHKLENTIDKDKELKEMI
FT                   VDIF"
FT   gene            complement(782558..783100)
FT                   /locus_tag="MMS_A0739"
FT   CDS_pept        complement(782558..783100)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0739"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0739"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69374"
FT                   /protein_id="ADK69374.1"
FT                   /translation="MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRF
FT                   EAFGIEGLINKEKKPYYSAKLKLKIVLYKLETNHSYDEVAKKFNIIYSSTIAGWVKKYR
FT                   EYGFLGLNNNIGRPKKIMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEFWK
FT                   KFHTLLTKEKSTRKKQK"
FT   gene            complement(783735..786353)
FT                   /locus_tag="MMS_A0740"
FT   CDS_pept        complement(783735..786353)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0740"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69917"
FT                   /protein_id="ADK69917.1"
FT                   /translation="MPIFQDLTPNIKINDPVYDAALDEAFQKKEIRNIALTGPYSSGKT
FT                   STWLSYSRNRKLGKIITVSLGKYNNIKITSNKNKKNYYDNRIERQIINQISSQIHPLKI
FT                   PLSKYSFIKNKNLFSIIMNIFLSCCFIFSIIGWVHRILLSDSLVFKESLNWLLLILFFV
FT                   PLVIWIYKFLKNNKLYISRIKFDKMEANLEEKHLPKTTVFDKDIREIIYLLYSPNTNVV
FT                   VFEDLDRFHNPKIFIKLKEINFILNSYIEAKIFKRKPVKFIYIINNGLFSPHIRTKFFD
FT                   FIIPIVPVVNYSNSESKFSEFIELIGESDSLDKDIIWKISLYVNDIRLIKNIVNEFFVY
FT                   NSAIRSENNQINKNKLFALITLKNLMPKEFDLLQMNKGYVFNVFEKIQKCQKNNSEIIQ
FT                   NKLSNANNELSSLFKNYPEFEGNDKLSKTDNILFFKDIYELINSDLIKTNFYVIKTIFY
FT                   DDTTIVEKVQLRELRDNYPFVNHCSNIKKIVVYNDPKIIECYENIESLEDQLNKKSIKF
FT                   LLKSLSRDEITDLFDSTSDKQMNKRYVSFLKFLFIEGLIDESYLNYISYFYKGSLGIND
FT                   RIFIKNLLEYVDNHNFDIKLENPKLVLKRLDENQLKSDLSFNFYLFKEFVNSHNSRATM
FT                   DMFNSVWPSKPQLVAKSLSQFDFDTINNFVNIFVREKDGIVKIRRFLDSIHDNLVVRKY
FT                   LYSGDIIKDILVSINLKFFKVFRIHFSDFIFNNIPDILNYKDQHYLRKIIQSLILTGQE
FT                   ERVKYINNNIDRYSLNIRNVMNMYEFIMGEACDFNKLLPNVFEEEKMSKIKEWIEKNFS
FT                   EFVREYIELTEIYKYYKNDESILISIINSSEINDDYKRKYIELNKIVLLNLDKITNLKK
FT                   E"
FT   gene            complement(786413..786916)
FT                   /locus_tag="MMS_A0741"
FT   CDS_pept        complement(786413..786916)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0741"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0741"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69532"
FT                   /protein_id="ADK69532.1"
FT                   /translation="MRKITKYTRKYILDVVKNGFWEKRFGIWKFYRYSYNGKLDYKDFL
FT                   YRIYNFDTINNKTGKILVTKKINWSRLTKNCIFNDSNFKLIEFSPIYNKFDGNKNKGNE
FT                   VDPLLIFLCEIFHPEVRREEVDWSRLFKKINSILSIEGITLRLTDEGNCIWEESKKGFF
FT                   SPVV"
FT   gene            complement(787093..788307)
FT                   /gene="pgk"
FT                   /locus_tag="MMS_A0742"
FT   CDS_pept        complement(787093..788307)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="pgk"
FT                   /locus_tag="MMS_A0742"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="identified by match to protein family HMM PF00162"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0742"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70005"
FT                   /protein_id="ADK70005.1"
FT                   /translation="MNYNNKKTLKDIDVKNKTVLVRVDFNVPIQNGVITDDNRIIAAFP
FT                   TINYLLENDAKIVLFSHLSRIKSKEDKLKKSLAPVAKRLEELLNKQVKFINQTRGQELE
FT                   KAISSLQSKEIILVENTRFEDVLDDQVVKYESKNNSELGKYWASLGEVFVNDAFGTAHR
FT                   AHASNVGIASNIKVSAIGFLVEKELKMLFQAVNEPKKPFIAILGGAKVSDKIGVIENLL
FT                   PKVDKLLIGGGMSYTFLKALGKTIGKSLLEEDKIDLAKHYLEIGKDKIVVPVDTACAKE
FT                   FADVSPTIFEGNIPDEWDGLDAGPKTIELFKQEIKKAKTIVWNGPVGVFEFKNFENGTK
FT                   SVCQAIAEQTQNGAFTLIGGGDSASAAINMGFKDKFSWISTGGGASLEFMEGKELLGIS
FT                   AIQDK"
FT   gene            complement(788422..789438)
FT                   /gene="gap"
FT                   /locus_tag="MMS_A0743"
FT   CDS_pept        complement(788422..789438)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="gap"
FT                   /locus_tag="MMS_A0743"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by match to protein family HMM PF00044;
FT                   match to protein family HMM PF02800; match to protein
FT                   family HMM TIGR01534"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0743"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69117"
FT                   /protein_id="ADK69117.1"
FT                   /translation="MSKKVAINGFGRIGRLTFRQLFEKDIEIVAINDLTDTKTLAYLLE
FT                   FDTAQGIFCEGEISHTDNSIIIKGKEVKVFAEKDASNLPWSELKVDLVIESTGFYTDKE
FT                   KASAHIKAGAKKVVISAPATGDLKTVVYGVNHKSLTSDDVIISGASCTTNCLTPFTKAL
FT                   DDAFTIKKGFMTTVHAVTNDQRLLDLNHKDVRRGRAAAWNIVPSTTGAAKAVSLVLPHL
FT                   KGKLDGYALRVPTITGSITDLTVEFENQELTVEQINNAVKKALESDADLAKAMKYETKP
FT                   IVSSDIIGSKYGSIFDATLTKVMNVDGKQLVKVCSWYDNESSYVSQLVRTTIYFMSL"
FT   gene            complement(789539..790477)
FT                   /locus_tag="MMS_A0744"
FT   CDS_pept        complement(789539..790477)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0744"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0744"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69724"
FT                   /protein_id="ADK69724.1"
FT                   /translation="MKLSDYKNNVKIKKLIEDSQNSNDIITDKVLLENQNILDEFLLNY
FT                   KECNLDTKCEQVVKNYQVDLVFKDHQFYLKNVLCVHGKQTEKLFIIKKNYWFCDFDLNL
FT                   FHLTIDEYFNTQLNNSLFTLLDQNEKNIRKTILKTIIKQIQKGYKKGFYLYGNSGVGKT
FT                   YIFKVLANTLASKNKTVIFSTLRSLIDKLKESFNSSEINSLTLIKKIKTVDFLFLDDIG
FT                   GENLSLWARDDFLFEVLNYRMENQKPTFFTSNFSIDLLEKNLQFTKQYNNFLTTQDVFK
FT                   LEKIKIDRLISRIKTLAKEINLIGKNKRQTN"
FT   gene            complement(790487..791671)
FT                   /locus_tag="MMS_A0745"
FT   CDS_pept        complement(790487..791671)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0745"
FT                   /product="replication initiation and membrane attachment
FT                   protein, DnaB/DnaD family"
FT                   /note="identified by match to protein family HMM PF07261"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0745"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70086"
FT                   /protein_id="ADK70086.1"
FT                   /translation="MLSKNFSYSVSLNFELDQEQYKSLTCLYQPLISAQAISLYLTLIQ
FT                   EVRISNILKEEALESKRLLNITNFSYKELIKTLDLLNAFKLIKVYVKKSDYSLIKFEIL
FT                   APLKSDEFFNHTYLNSLLLNKLESNDYEITKFMLVNETKINTNQYKQIVVDLTDIYDQS
FT                   LIADINIFDTEVNSFNTYLKKLNQLINVDYVLNSLKDKDIDLDFIQQSTLKSLYDLLTI
FT                   KKLSEDQIIYLITNSYDFINKNIDLNIFKKLLINLITKKETNFDNKELLDLINQTTWSE
FT                   YSKKKYDIDLSSYTTVFENIKQNYCLSNGIINCLIDFSYKKNNGQIIVKYIAKIAKTLF
FT                   DKNINTTLKVMQFLKNIQSKSINYNYETMFDSNDFNLQTEAIFEFSEEELKCLV"
FT   gene            complement(791828..792652)
FT                   /gene="mutM"
FT                   /locus_tag="MMS_A0746"
FT   CDS_pept        complement(791828..792652)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="mutM"
FT                   /locus_tag="MMS_A0746"
FT                   /product="DNA-formamidopyrimidine glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="identified by match to protein family HMM PF01149;
FT                   match to protein family HMM PF06831; match to protein
FT                   family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0746"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69599"
FT                   /protein_id="ADK69599.1"
FT                   /translation="MPELPEVVTVTNTIKPKIINRTILNSQIFTNKIISSTNVDQFINL
FT                   TKNQKIYDVYNLAKYIVIELKEHVIISHLRMTGKWVIENSDQYAYKKSWLRAELLLDNN
FT                   LVFRFYDMRGFGTLNLYNKQTFLKDSHLDKLGPIPLNNQTSADYLFNKLQKSNKAIKTV
FT                   LLDQHVISGLGNIYVNEVLFLSKINPLVSANLITKDQTKEIIKNCETVLSQAILLKGTT
FT                   ISDFESLPGITGGYQTKLLVHMNNKNCKICDTKISKIKVNGRGTYYCSKCQN"
FT   gene            complement(792663..795398)
FT                   /gene="polA"
FT                   /locus_tag="MMS_A0747"
FT   CDS_pept        complement(792663..795398)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="polA"
FT                   /locus_tag="MMS_A0747"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00476;
FT                   match to protein family HMM PF01367; match to protein
FT                   family HMM PF02739; match to protein family HMM TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0747"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69833"
FT                   /protein_id="ADK69833.1"
FT                   /translation="MKTKILVVDGNSLIFRAFYATAYSPNTSLLKTKSGVLTNAVYSFI
FT                   NMLLSVIHQRGPYDHILIAFDKSKKTFRHDLLSDYKANRIKTPNELVEQFSIVREFLTK
FT                   ANIQWFEQENIEADDIVGSICKYAEKQFDDLQAEILSSDKDMYQLITNKVICLNPVQGV
FT                   NELEEVDTNKLFEKWQILPNQVPDYKAIVGDSSDNLKGVNGIGQKGAIKLIQQYESLEN
FT                   IYNSLEQLKGAIKTKLEQDKKMAFLCKDLATIKTDVVLENFSFNKLDFNVDNIYEFLNK
FT                   YEMYSLKKRFTNILNLDFNPYQNKKQNLDVKIINSWSKDYEDSINYLYVESLEEDYHKD
FT                   KIIGIGISNNKGNFYLDFKNKAQQLSFFEDTTLSSTDSLFEEFLNNSNLKKYTYDIKKT
FT                   TYLLKNHKYNVLASNFDFDFMVACYSLNANVISDLSNQIKLVDNMIELETIDEIFGKGV
FT                   KKNPDIDLDIKSKYISKKAYLLKKYSDQLIEQLKQTNTYDLYLKIDHPLIEVLYDIEVQ
FT                   GILIDKEQLKLQTQQILKKINHIEGQMKILVAEEIDNNFNFSSPKQIQELLFDKLKLPN
FT                   LEKGTTSKEVLEKLITFHPIINLLLEHRKYTKLYITYLKGFEKFIFDDNKVHTIFNHTL
FT                   TNTGRLSSSYPNIQNISIRDNEQKEVRKIFITNNNKTFLSYDYSQIELRVLAQMSKESN
FT                   LIKAFNQDADIHLQAAKLIFNLSDDQITSEQRRIAKVFNFGILYGLTDFGLANDLNMNV
FT                   NQAKQMIKDYYSAFPSLLDFKEKQVEIATNQGYITTLSNRRRYIDELNSTNHNIRQFGK
FT                   RIAVNTPIQGTASDILKVAMISIYKKLKEQNLDARIVCQIHDEIILEVNDNQLEQTKKI
FT                   VVSELENALEKLFLDLNIKEQVVVKLKVGESVGKTWFDLK"
FT   gene            complement(795407..798370)
FT                   /locus_tag="MMS_A0748"
FT   CDS_pept        complement(795407..798370)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0748"
FT                   /product="putative DNA polymerase III DnaE"
FT                   /note="identified by match to protein family HMM PF01336;
FT                   match to protein family HMM PF07733; match to protein
FT                   family HMM TIGR00594"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0748"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69187"
FT                   /protein_id="ADK69187.1"
FT                   /translation="MNYISLLTIKNQYDFLESLITIDQYIEFIKKNKLSYAFYSETHTM
FT                   YGVAEFFKKATDNNIKPIIGLTIEFEDSTKLIIYAKNKKGYQILNFVSSFLNDGFNHYD
FT                   YEIKEYILELVNNNVVVIGLISDLDFKTHLIDKLNDDFYDVKELNLYFNQISYLDINDQ
FT                   KTYNILNAIKTNKTIDQIQNTNNYFYPDNDYLIKNYSLENIKKVINEINFKVDFNLFDS
FT                   NKKHLVKYKNINNLSSFEYLRQVCLLSLKKYQQKIKPNLDLKLYISRLNYELEVIKQMG
FT                   FSDYFLIVSDYVNFAKKNDILVGPGRGSAAGSLISYLLRITDIDPLEYDLLFERFLNPD
FT                   RSNLPDIDLDFQDNRREEVLEYLFEKYGKYHVGMITTYQTIGYKMAWRDVCRVFNIDLL
FT                   IVNKISKVLDQYTNSDFLEFIKENKLLNDYFQNNVFKEIFITMHKIVGLPRQTSTHAAG
FT                   IVLTDCDLRELVPIKIGFNGINQTQFDMNYLDDLGLIKMDILGLRNLTTIQEIKHLIYL
FT                   NQNLKISLNKIDLNDKKAFELLKNKQTSGIFQLESKGMTDLISKMQVDSIELISIASAL
FT                   YRPGPQEMISIYLENKKTNKFKIIDQSVFEILKPTYGIIIYQEQVMQMLNKVVNFSYAK
FT                   ADIIRRAMSKKNNKVMQSMKLEFINSAVKNNFSYNKANLIWNWIEKFSNYGFNKSHSIS
FT                   YSYISYWLAYFKAHFTTEFYTSLLDQNIGNEIKTQQYIKELYDYKIKVNKPSVINANFN
FT                   YQIINKQIYMPLTCIKSIGYEVVKKINLAKSENENMYLDIHNFILAMIKQKISVNVLQT
FT                   LIKAGALDIFNYNKKTMIENLDLLISQANAYKQVNNILDDEKINLIIYDEYEDEILASF
FT                   EKELYGFFIEQNPILKLKTSNFDLNLIDISKLEYNKVQVILGYILKIKEIKDKNNNKMA
FT                   FVTIFDNTSELELTIFSSDYKDIYQDLVINKAYVFKVLKTKTNNKTSIKFVSLIKAI"
FT   gene            complement(798680..800353)
FT                   /locus_tag="MMS_A0749"
FT   CDS_pept        complement(798680..800353)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0749"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0749"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69182"
FT                   /protein_id="ADK69182.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKLATKDKNNRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            complement(800525..801769)
FT                   /gene="tyrS"
FT                   /locus_tag="MMS_A0750"
FT   CDS_pept        complement(800525..801769)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="tyrS"
FT                   /locus_tag="MMS_A0750"
FT                   /product="tyrosine--tRNA ligase"
FT                   /EC_number="6.1.1.1"
FT                   /note="identified by match to protein family HMM PF00579;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00234"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0750"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69652"
FT                   /protein_id="ADK69652.1"
FT                   /translation="MKNSILEELKWRGLIKQITNESKILDAQNNNDAVYCGFDPTADSL
FT                   HVGHLMMIITLKRFADYNFKPIALIGGATGMIGDPSFKANERVLQTKDQVEHNINKISA
FT                   QLKQIIPNVNFVNNNTWLSNISLIDFLRDIGKHFNLSYLLAKESIATRIQTGLSVTEFC
FT                   YTMLQAYDFYYLYKNNNCSIQIGGSDQWGNITSGIDFISDTINKNNKAAGLTINLLTKS
FT                   DGQKFGKTESGTIWLDKTKTSEYEFYQFWFNQTDQDSINLLKCLTFLTKEQIDNLIKEH
FT                   QNQSSKHLLQKALASEMTKFVHQQQGLDKALKLTEAFFSGDLFSLTNDLFKMALNSLPN
FT                   TQINKDTKVIDALIEVKAASSKREAREFLTNKAIMINNQIIEDENTLISSFDLIQNKYL
FT                   LVKKGKKKYFVILIK"
FT   gene            complement(801778..802839)
FT                   /locus_tag="MMS_A0751"
FT   CDS_pept        complement(801778..802839)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0751"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0751"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70094"
FT                   /protein_id="ADK70094.1"
FT                   /translation="MQNKTKFKFDSRIKDGYFIADYFKKTVEILKNFKHDQIITMQFFQ
FT                   RNDNVVLCGISEVIDLLKFASPNYDDLEIYALNDGDIINSKEPVLKIIGKYQDFGWLEG
FT                   MIDGILSRNTSIATNSKQIIDAANHKDVLNMLDRADNYLTLASDGYASYIGGFRLFVTQ
FT                   ASLEYIDDKTVLQPSGTMPHALIQAFNGDTLKAADAFYKTYPNNKLVVLIDYDNDCVNM
FT                   ATKIGKHFKEKLYAVRLDTSENLVDKFFINNKEYINQTNSNGVSEQLVREVRKALDSVE
FT                   CNHTKIIVSSSFSANKIKEFESKNVPVDIYGVGSALAKINIHFTGDAVLINNQKQAKFG
FT                   RENIENLRLKKVK"
FT   gene            complement(802817..803425)
FT                   /locus_tag="MMS_A0752"
FT   CDS_pept        complement(802817..803425)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0752"
FT                   /product="tRNA binding domain protein"
FT                   /note="identified by match to protein family HMM PF01588"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0752"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69629"
FT                   /protein_id="ADK69629.1"
FT                   /translation="MNSIKFGIFYSKQFNSLLVSFFNKKVTFTQQINNITILKNNDEII
FT                   GANIFNVDPNLNLKSGFCSEDPKAVNYVSQALKNIYEVKQELQFVIGRIIECEAIEGTH
FT                   LNICQVDIKSEVLQIICGASNARKKVVCVVATLNSWLPNGQQIVQSKIRDVGSFGMLCS
FT                   YKELNIENDQQGIIELGNEYNNKIGESFWKEYYAKQDQV"
FT   gene            803500..804339
FT                   /locus_tag="MMS_A0753"
FT   CDS_pept        803500..804339
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0753"
FT                   /product="EDD domain protein, DegV family"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0753"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69348"
FT                   /protein_id="ADK69348.1"
FT                   /translation="MVNIKIAVLTDSSFDGKVSDYQDLYVIPLMIVTQDNQTYYDDENL
FT                   SKDKFYNLLNSQVLKTGQTTPGDMLKMWDELLTKYDQVIFLPISKGLSGQYNTFKMLQQ
FT                   TEKKYENKVFVCDTSAVSVIMQEVVNKVFDWIKQNKTANEICDLVSYLANDFVTYIIPK
FT                   NLDTLKQGGRISPAAAALAKILKITPILKYDGSIDKQSTTRTFKKALKEALSLLKEEIK
FT                   DLKTIDISYSRTDEKTLELIETIIKEEQLEIRLKSELTNVIASHTGTDTVALVGWKK"
FT   gene            804350..805201
FT                   /locus_tag="MMS_A0754"
FT   CDS_pept        804350..805201
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0754"
FT                   /product="EDD domain protein, DegV family"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0754"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69961"
FT                   /protein_id="ADK69961.1"
FT                   /translation="MKFGILVDSAAVYDPAEFKNTIIDVIPLHIVFPNNDEYLDIKNIV
FT                   EQEKILEKVSMGENIKTSQASSGELEKKYDELLEQYEHIIHIPITNNLSSMLQTATLVS
FT                   QDEKYKDKITVYQNNDLAAQGIALTALSLAKAIKSNKIKTAQQAIDFIDNFKEKVLIAI
FT                   IPGDLKKLSNGGRAKGVITTVLNLLKTKLLIIWAKEPKKEAIGRTYNSLIEKLIKNLSN
FT                   KFKKNKYKLYFLSTPLTSSKTVEIVKQILSDEKINFVHGNVPNIYTIHAGVETIGFVAI
FT                   EE"
FT   gene            complement(805238..805312)
FT                   /locus_tag="MMS_A0755"
FT   tRNA            complement(805238..805312)
FT                   /locus_tag="MMS_A0755"
FT                   /product="tRNA-Trp"
FT   gene            complement(805350..805425)
FT                   /locus_tag="MMS_A0756"
FT   tRNA            complement(805350..805425)
FT                   /locus_tag="MMS_A0756"
FT                   /product="tRNA-Sec"
FT   gene            complement(805501..805965)
FT                   /locus_tag="MMS_A0757"
FT   CDS_pept        complement(805501..805965)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0757"
FT                   /product="transcriptional regulator, Fur family"
FT                   /note="identified by match to protein family HMM PF01475"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0757"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69113"
FT                   /protein_id="ADK69113.1"
FT                   /translation="MIHLSKTQQTKYKQIVEKLKLKKIRLTDIRSIVIKMLIVSDHLTI
FT                   QQIINNLESEINNINVMSVYNTIDLLLKEHIVFANTFNGKDISYEIAADKSVHLKCDDC
FT                   LKVIHLDDKSIENYHFLELLDLCEKNGIKLSHFKIEGHGYCLECSSKENK"
FT   gene            complement(805966..806187)
FT                   /locus_tag="MMS_A0758"
FT   CDS_pept        complement(805966..806187)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0758"
FT                   /product="putative acyl carrier protein"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0758"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69718"
FT                   /protein_id="ADK69718.1"
FT                   /translation="MAIYNQIVKELKSRGAKGNITKDSEFKSLGLDSLDLMDMVVTLEE
FT                   KLNIRISDDQLLSLRTIDDLLKVIEELQ"
FT   gene            complement(806211..806573)
FT                   /locus_tag="MMS_A0759"
FT   CDS_pept        complement(806211..806573)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0759"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0759"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69467"
FT                   /protein_id="ADK69467.1"
FT                   /translation="MKLNKNFKILIMFILIVSCILSTIASIYFSNVFSLNKNNLLKQSI
FT                   NITKPIIDNSKYLNKLLTNDNKLNINSFKTIFLKELKKQNKELFLLDDLITFSYDNTSV
FT                   SVEYQNYKWSYKIVYN"
FT   gene            complement(806560..806697)
FT                   /locus_tag="MMS_A0760"
FT   CDS_pept        complement(806560..806697)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0760"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69661"
FT                   /protein_id="ADK69661.1"
FT                   /translation="MKFIDCNDCNLINPNISKYLFSKEFFLNLEVHPNLESELNKYEVK
FT                   "
FT   gene            complement(807369..807629)
FT                   /locus_tag="MMS_A0761"
FT   CDS_pept        complement(807369..807629)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0761"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0761"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69683"
FT                   /protein_id="ADK69683.1"
FT                   /translation="MSIEFKEIEVKNSRVTQKPNYLVDVIFSKQKYQEDKKEFYKLYLV
FT                   ISKNLRYYDESKLSNNLSDLFYSISYKNKDKLVKLFSNEKN"
FT   gene            complement(807729..807804)
FT                   /locus_tag="MMS_A0762"
FT   tRNA            complement(807729..807804)
FT                   /locus_tag="MMS_A0762"
FT                   /product="tRNA-His"
FT   gene            808122..810017
FT                   /locus_tag="MMS_A0763"
FT   CDS_pept        808122..810017
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0763"
FT                   /product="peptidase family M13"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01431;
FT                   match to protein family HMM PF05649"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0763"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69073"
FT                   /protein_id="ADK69073.1"
FT                   /translation="MKYNVKDNLFKAINNEWLETAKIPSDRSSTSEFDELDIRNEKIVT
FT                   RMAKKILQQNKTNKLSDVNLINFANFYKLTSDIEKRNELGVSPLKPYFDEILNLSSLKE
FT                   LQDNYVKFMLRGYELPISFGVFLDFLDSSIQTLYVSIANHILPDKSHYDTKEQKTAFLK
FT                   SFKAMARKLLTLFIKDTSEINKIIRKALKFDEIIAKYSLTSLQKVRYTELYKPYDYKKI
FT                   VAKTKNFDIASIVSKVINDEVDKIIFSDDNFALNIDKILNEKNFELIKAWMLIKLVLTF
FT                   APYLDEKTRTLASRYSLFVSGQDKVENKNKHALNLALKFFSMPIGVYFGKKQLGAKAKK
FT                   DVEKMVKHMIGIYKERLKNNTWLSQNTIDKAILKLNTLNAHIGYPTELRPYYSELTTTS
FT                   NLLIENVLKFNEILNKYNFNQYKQPINKNYWIMTPYQVNAYYHPMYNHIVFPAVILQGA
FT                   FYSIKHTSSENYGGIGAIIAHEISHAFDNNGANFDEKGCLKMWWTQEDFAKFTDKTKAM
FT                   INLFEGVETDYGKCNGQLTVSENIADAGGVSCALEAAQKEPDYSAEKFFINWAKVWKAK
FT                   FKPERAKRLLEQDPHAPAELRANIQANNNEEFVKSFNIQPEDKMYIAPEKRVKIW"
FT   gene            810748..812271
FT                   /locus_tag="MMS_A0764"
FT   CDS_pept        810748..812271
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0764"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0764"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69568"
FT                   /protein_id="ADK69568.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKSYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYRMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKLATKDKNDRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   GTVPNVFINLKPYCWLHLFMFHFISVFKLHHLHSKFKIRTDWKKQNHWA"
FT   gene            812273..812425
FT                   /locus_tag="MMS_A0765"
FT   CDS_pept        812273..812425
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0765"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0765"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69916"
FT                   /protein_id="ADK69916.1"
FT                   /translation="MINVIKEVKEIEVFVNKQKIETIQVYNDELQESWQTYQILLELLT
FT                   KEKVT"
FT   gene            812888..813223
FT                   /locus_tag="MMS_A0766"
FT   CDS_pept        812888..813223
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0766"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0766"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69284"
FT                   /protein_id="ADK69284.1"
FT                   /translation="MELKESQTGKSPKKGKGTGRPKKNKEEYDKERYEVIKNIDREVLE
FT                   WLITDLFKEEILKKNRVGNLDEMIEKIKEKFGTNITNKEIMKILGLPKSTFYYKLKKQQ
FT                   IVRIKNL"
FT   gene            813349..813993
FT                   /locus_tag="MMS_A0768"
FT   CDS_pept        813349..813993
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0768"
FT                   /product="integrase core domain protein"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0768"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69034"
FT                   /protein_id="ADK69034.1"
FT                   /translation="MNKLGLFCHVRTTCKKKREPKNTNVYYPNIANRDYNGQLNDIYAS
FT                   DVSYIPAPIDVDGRHVYLSILIHHRTKKIVSYNLSIHNDTNLIMNHFRKTKFPKNFIIH
FT                   TDHGATYSSIEYLEYIKQQGGIVSMSRIGNSLDNREAEYFFSILKSEMFINFEKKVKEI
FT                   TFSQLKKSIKNFIEWYNSERILRKFKWKTPQELLNFYFINYKLLFNKFSST"
FT   gene            complement(813967..814899)
FT                   /gene="arcC_1"
FT                   /locus_tag="MMS_A0767"
FT   CDS_pept        complement(813967..814899)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="arcC_1"
FT                   /locus_tag="MMS_A0767"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="identified by match to protein family HMM PF00696"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0767"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69784"
FT                   /protein_id="ADK69784.1"
FT                   /translation="MSKIVIAIGGNALGNSPTEQLEIVKKTAKSLVDFIVQGNDIVIVH
FT                   GNGSQVGMINNAFDIANKNEVKSPILDFPECGSMSQGYIGYHLQQAIDNELKLRNINKP
FT                   TVSLITQTLVDKNDAAFSKPTKPIGSFMNESEAKKLAKQNNWNISEDAGRGWRRVIASP
FT                   KPIDIIEKDAILQLVNNSFIVIAGGGGGIPVYLKDDKLVGIAAVIDKDFAAAKIAEIID
FT                   AESLIILTAIDKVMINYKKENQQALDQITLAQAQEYIDQNQFAPGSMLPKVQAVMSFVK
FT                   KTNGKPAYIGSLEQADKVLQNLSGTKFVK"
FT   gene            complement(815015..816109)
FT                   /gene="aguA"
FT                   /locus_tag="MMS_A0769"
FT   CDS_pept        complement(815015..816109)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="aguA"
FT                   /locus_tag="MMS_A0769"
FT                   /product="agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="identified by match to protein family HMM PF04371;
FT                   match to protein family HMM TIGR03380"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0769"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70079"
FT                   /protein_id="ADK70079.1"
FT                   /translation="MSKKMNSTPKKDGFWMPGEWEKHDQCWMIWPERSDNWRLGAKPAQ
FT                   RVFVNVANAIAKYEKVTMLVSHQQFENARNLLDQNVRVIEMSNDDSWMRDVGPTIVKNK
FT                   DGEIRGVDWVFNAWEGFKGGLYFPWDKDDAIARKVCEICNIDYYRTDFVLEGGSIHTDG
FT                   DGTLYTTEECLLNENRNPDLTKEQIEENLKEYCGVEKVIWLPLGVYNDETNGHVDNLLN
FT                   VVSPGHVVLTWTDDTTDPQYERSKLAYDILTNTLDAKGRKIKVTKLHQPGPLFITKEEA
FT                   EGIDVCDTMSREPEQRMPASYANYYIANNAIILPIFGDKYDDLAVKTLQSVYPNHKIET
FT                   VMAREILLGGGNIHCITQQQPTTK"
FT   gene            complement(816116..816664)
FT                   /locus_tag="MMS_A0770"
FT   CDS_pept        complement(816116..816664)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0770"
FT                   /product="amino acid permease family protein"
FT                   /note="This ORF is the C-terminal portion of an amino acid
FT                   permease disrupted by a frame shift mutation"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0770"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69674"
FT                   /protein_id="ADK69674.1"
FT                   /translation="MITWSTGANKAIQEAASDGEFPKIFGTVLKNDSPLWATIITGSVC
FT                   TVLLIIAGLLSPSGEISEIFWQLYAFSSIIFLLPYLLIFPSFIIIRYKYPDLKRPFKIP
FT                   GPKWFQWVVVITPMIILCLSIILFLFGEIMVGAKTWELNSGGGYVLFALIGTVICIGIG
FT                   ELLIWWSSYKNKKNLVKGE"
FT   gene            complement(816639..817532)
FT                   /locus_tag="MMS_A0771"
FT   CDS_pept        complement(816639..817532)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0771"
FT                   /product="amino acid permease family protein"
FT                   /note="This ORF is the N-terminal portion of an amino acid
FT                   permease disrupted by a frame shift mutation"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0771"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69075"
FT                   /protein_id="ADK69075.1"
FT                   /translation="MSKTKKGLRLFDIIAFTFSAVFVLDSFASAAAIGWQSIIYWTLLA
FT                   FLYFLPYGLITAELGAAYSDNGGIYAWVKNACGNKWAARTNWFYWLNVGLWMSSVYIAF
FT                   SSTLSKIFFPNSPLSLWTQIGIAIGITWLTVLVGLLNFKYTKWLPNFSSISKLVVTIGL
FT                   IAAAITWLAQGNPVSTKINDAEYGILPSFSKGIVFLPVIIYNLSGFELGSNTANEMKNP
FT                   KRDIPLSTILAGVTIVISYIIGTIAVNIILDVKTLDVSNGIIQTIEKVFPEWLTKILGI
FT                   FTIYFFWKYDYLKYRC"
FT   gene            complement(817553..818650)
FT                   /gene="argF"
FT                   /locus_tag="MMS_A0772"
FT   CDS_pept        complement(817553..818650)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="argF"
FT                   /locus_tag="MMS_A0772"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="identified by match to protein family HMM PF00185;
FT                   match to protein family HMM PF02729; match to protein
FT                   family HMM TIGR00658"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0772"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69324"
FT                   /protein_id="ADK69324.1"
FT                   /translation="MNKVRHFIDTQDLSKKEIFEIFRLMKMLKEARYCGAVPELLKNKT
FT                   LAMIFEEPSTRTRVSFEAAMTLLGGHAQYLKPGELHLGVRESLYDTTKVLSHMCDGIMC
FT                   RALKHETVLNLAKYADVPVLNGLTDYNHPTQAICDVFTMLEYMPATKNLEYEDIKFEDI
FT                   KVVFIGDRTNVCSSTMHITTKLGMNFVHISPKRYQSPQEWIDIANENIKQANSGSVLVT
FT                   DDLEQVRGADIVYTDLWWWVDQEDEAEERVKAFKPTYQVTPELMEKAGKQALFMHCLPA
FT                   SRNVEVYDEVIDSDQSIAFEQAENRLTAQMGLLVYYLYPQIDKSSNAVKDYYRGKVEAF
FT                   MEHQDRSWKQRYTYNNDYAETKNKK"
FT   gene            818884..819771
FT                   /locus_tag="MMS_A0773"
FT   CDS_pept        818884..819771
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0773"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0773"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69931"
FT                   /protein_id="ADK69931.1"
FT                   /translation="MQEKIIEIKNLTKQYNNGYGIFDINLEVNKGEIYGYLGPNGAGKS
FT                   TTIRHLMGYIKQNKGKALIFNKDCWKHSYKIQPNVGYLPGEINFPEQENGLSYIKFIYK
FT                   LRKQNNWDYVERLIKYWEFNPNIKIKKMSKGMKQKLGLVLCLMHQPKVLILDEPTTGLD
FT                   PLIKNKFIQLILKLKQNNTTIFLSSHVFEEVEKLCNKVAIIKNGRIINKLDLDQIKNTN
FT                   DREYKVTFKDQNIYKDEFLISTNDLLATYKVPINKVNYFFNQLKSYEINLLEEVPFSLE
FT                   NYFLKFYKKEGETE"
FT   gene            819773..820255
FT                   /locus_tag="MMS_A0774"
FT   CDS_pept        819773..820255
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0774"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0774"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69499"
FT                   /protein_id="ADK69499.1"
FT                   /translation="MFNFQLWKNSFKNTLIVWLFCIPFFSFISIILLVSIKSDSKSINI
FT                   TAYQTILKILFDQYGVLIISTFLISGTISLMTRPIEKGHLTYILSSNLSRTNIVLSRFL
FT                   YFLFSITVYVFVVFLINAVFMKINHINTEELNLKLNLTMFFILNNSMCNWINLFYV"
FT   gene            820248..820535
FT                   /locus_tag="MMS_A0775"
FT   CDS_pept        820248..820535
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0775"
FT                   /product="ABC transporter, permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0775"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70098"
FT                   /protein_id="ADK70098.1"
FT                   /translation="MFSCIFNKGAWVLIFNGAIFTIFVASDVISQVGKALNRQFLIDFK
FT                   NFTILSLIDFNRLSIKTISEFYISYAILIGIIVLSSSIGIISFTKKDLTW"
FT   gene            complement(820567..820977)
FT                   /locus_tag="MMS_A0776"
FT   CDS_pept        complement(820567..820977)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0776"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0776"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69066"
FT                   /protein_id="ADK69066.1"
FT                   /translation="MIINNDINSIVLKSEAKKEEKNNSKTLANLIKNTKLGSFNKTPTA
FT                   SEIIKRVNEVNKLENDKKLKETDVDIKIGSKKATIILKTNKSDIVVIEYKNTHKIAETV
FT                   GGVLAGVVVLIGAGFLSYKLIKKQKASRKQDW"
FT   gene            complement(821135..822697)
FT                   /locus_tag="MMS_A0777"
FT   CDS_pept        complement(821135..822697)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0777"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0777"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69635"
FT                   /protein_id="ADK69635.1"
FT                   /translation="MKKTVKLTIILLVVAVIYFGYSAWLDGVAIYAIRGVKNDGKDSFF
FT                   SLMTSTSAWVNNWKTILIEKLGESSEWGKKVAAFNGSTSWTDWVNAINQSGYKLTGFMA
FT                   PDSLLYTLLSPFKLILVGGVFAMFIPLLKQLLFNTIIGIKSYLKNRDMNVLFNYSKTIE
FT                   FVENLKTKISEGDFEGVKTAYSSYSSLAFKPVFLTNLMNEIYKTLIKFGDVTVFKNGCI
FT                   SVLESIQEMYLKEKRRAMNNGRGDEMFYDIKRGFEYSSYSSRYFVKYYEAMSKDFKKLG
FT                   WKIFSIEISRFSLFLLFALLPSILLSGIISGILLKLITENSSNITALVTIGSFIMLWVI
FT                   FAIIFHGFYIFFKKDYKINKHILIKPAITYYSLLLLAFMTLTAGCVGIAQVGNIAQPFT
FT                   APLMTKWFGALAYLVLTTCLVMYALATLVDNYRSGKQLSVKLIVNNIVLPGFIWTITTG
FT                   ANFVALFAKSEQVMEYSSLISGINTLVMVIFWIYLFTAQFLINNLITSKTAKILKQTKV
FT                   IQK"
FT   gene            complement(822764..825178)
FT                   /gene="leuS"
FT                   /locus_tag="MMS_A0778"
FT   CDS_pept        complement(822764..825178)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="leuS"
FT                   /locus_tag="MMS_A0778"
FT                   /product="leucine--tRNA ligase"
FT                   /EC_number="6.1.1.4"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00396"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0778"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69157"
FT                   /protein_id="ADK69157.1"
FT                   /translation="MDFSHKAIEKKWQKYWKENNIYKTTNNSEKKAYILDMFPYPSGAG
FT                   LHVGHIKGYTATDVYSRFKRMQGYDVLHPIGWDAFGLPAEQYALKTGNDPREFTLQNIE
FT                   NFKIQLNKMGFSYDYDKEINTADPNYYKTTQWIFKQLYKKGLAENRDIDVNWCQELGTV
FT                   LANDEIIEKDGLMVSERGEYPVVKKKMRQWVLKITDYADKLLDGLDNLDWPNSVKELQR
FT                   NWIGKSEGCEINFKSNDINIPVFTTRADTIFGVTYIVLASENELVLKLTAPEKLEEVKK
FT                   YIELTANKSEIERKDESRTKTGVFIGSYATNPLTKEQIQIWISDYVLNDYGSGAIMAVP
FT                   AHDKRDWDFAAKFNLPIKFVIQTKDQSKAFVGEGIHINSEFLNDLDRIQALQVIHDYVD
FT                   KNNLGKRKINYKLRDWLFSRQRFYGEPFPVLYDKDNNIVLIEDNNLPITLPITDYIKPT
FT                   NTGESPLANVKNWVNVKIGDKEYKRETNTMPQSAASSWYFIAYILANSKNNLIDLTSDE
FT                   AKKRLEKWLPVDLYIGGQEHAVGHLLYARFWTHFLYDLGLLPTNEPFKRLFNQGMILGP
FT                   DNRKMSKSWGNVINPDDVIDTHGADALRLYEMFMGPLDASLPWSFDGLDASLKWLNRCY
FT                   RMINKIEFSNTNNHKLDYVYNDVVKKVTQMIQELKFNTAISQLMVLVNAIYKEELNTVY
FT                   KPYIEGFVKMLSLFAPHLSEELWEKLGNNSSVTLQTWPEFDETKIIKNAVVIALQVNGK
FT                   LRSTIEVEKGTDKETLIKLAQENENIIRFIKDHKNLKYIAVVDRIVNIVIE"
FT   gene            complement(825315..825391)
FT                   /locus_tag="MMS_A0779"
FT   tRNA            complement(825315..825391)
FT                   /locus_tag="MMS_A0779"
FT                   /product="tRNA-Ile"
FT   gene            complement(825464..828268)
FT                   /locus_tag="MMS_A0780"
FT   CDS_pept        complement(825464..828268)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0780"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0780"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69821"
FT                   /protein_id="ADK69821.1"
FT                   /translation="MKKILAILSSLTLVSTGVFSTVLACKKTPTPTTKPNTNNNKVLKN
FT                   NSLDNIKTTSAMLLKQAVLADVYGYNFDFLKSYFNNKNLNEQAKKYKLNTEIKDNITLS
FT                   TDFEDALANYFSNNLVIKKNDNVNLNGIKGTDIDFLTSVLPKTVFGATSKQISAAISII
FT                   LENISGAGITGLLDLAKNIDINSKFSDFVKNLKVSKELITTLLNTIFTNDKFLKELEEE
FT                   IDKFDALTLYKDFELSELSNLALLNILDGINGILDKDYQLVSSDIKKNNGSSLNVRLWD
FT                   TSKTFINKVAKFDQTSNVATIPSLSNSTSSSILSANIKRNIKTAASLIRGLELFQYLFS
FT                   LFDDTRKDEFKISDENIFDKSKKNNEFIKGIYKINGSTGGSNNGSNKIESLKKNETPTS
FT                   STSQTTLNLKYIIDTLQYYLGNLDKPDKAYRLRQFIAILFSGKYAENSYKLENTNSGTT
FT                   GINQEYKSIFFEFNGSDKNKIKEIKLNGFQIFPTSILFESLSNIKLQNIKIDNAIFNLA
FT                   KPFIEKINLKNFFESEVFLKKGIADFLISLINLITDSFVYNQALINDNFDKILDNLVTI
FT                   LKKLKTEDLLKALFKETNGIVSSLKPLVEKYVKFEDISKKIDDFIKNKDTYSLVKVGIK
FT                   SLVPIFGNKFFEYIYNDKVEQTFDTLANLSNDVLIRTLVDKLKIQIPAALNFILPYFKK
FT                   NAVSLRTIFPPNVHLNLKNLFTIKLSDFIKLENKPNFGSDYLDKSITTILNELSGADGP
FT                   GSKLKDLDNAYGFKIESLKDFINKIFKYDYKWNGVNSENGGNLISLLLNNPNKFKEIIG
FT                   LTEEGMKPNSNSLIDILSNKLIPNDKSKNQDSLQWFASVLNKVIINLNKKPNFTTSLEK
FT                   HFNDEKFNSFEFSDTKTEKSGLITSQTISTTINNQKYILVITRDPKQPTFIVESLSKQL
FT                   VQNN"
FT   gene            complement(828427..828825)
FT                   /gene="rpsI"
FT                   /locus_tag="MMS_A0781"
FT   CDS_pept        complement(828427..828825)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsI"
FT                   /locus_tag="MMS_A0781"
FT                   /product="ribosomal protein S9"
FT                   /note="identified by match to protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0781"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70068"
FT                   /protein_id="ADK70068.1"
FT                   /translation="MFKDKVIYRGTGRRKSSIAQVILTPGSGLITVNGKPALEFFPYAT
FT                   LVQDLEQPLVATNTLKDFDIIVKVIGGGFTGQAGATRLGIARALLQASEDYRKLLRDQG
FT                   LLTRDARIKERKKYGLRGARRAPQYSKR"
FT   gene            complement(828825..829280)
FT                   /gene="rplM"
FT                   /locus_tag="MMS_A0782"
FT   CDS_pept        complement(828825..829280)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplM"
FT                   /locus_tag="MMS_A0782"
FT                   /product="ribosomal protein L13"
FT                   /note="identified by match to protein family HMM PF00572;
FT                   match to protein family HMM TIGR01066"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0782"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69461"
FT                   /protein_id="ADK69461.1"
FT                   /translation="MKQTTMISAKDTNKKWYIVDAENKTVGRLATQVALVLRGKHKVDF
FT                   TPHINNGDHVIIINAEKAIFSGKKESNKFYYHHSMHPGGLKKRSVEVQRELDATKILER
FT                   AIRLMLPKNVQGSNQYRALHVFKGSNHPFAAQKPEVLEISTKKGDVK"
FT   gene            complement(829410..833555)
FT                   /locus_tag="MMS_A0783"
FT   CDS_pept        complement(829410..833555)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0783"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0783"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69143"
FT                   /protein_id="ADK69143.1"
FT                   /translation="MKTKNKKNKWLGLILKNSLKNSFKYKSQLFGLVLLVMIMSLIMSL
FT                   ISAINSRVLDKYDDLITNSNQHNLVLKLDPYENVSTSLITSNNQIQAQQQYINRLNEKL
FT                   YSRYNFKFDWSRTESREFKQVKSLNNLQTLKAVSKQYLTDNKVDQLVIVKGRNINSNKE
FT                   VLIDPIYAKKHNIKINDIIRFQKDVLGDQLLVNSLENKTTTKQQFEDINKITKQGLTDN
FT                   NGIYQIKYASSFDWYQVVGFANSADFIFPTINAYSPIPNRLNEGIIYVDPLRFGLIKQT
FT                   DGFYKYDSTSSKLVVSSNNEWESFYSLKTNQKLSDETIDWMNQYFSQLINKKAQDKWIY
FT                   KLEDPNYRFNSRTSVIKKTIGAYNIYSFIVLLAVISVVLYTTFLITKKQILNSRGQIGT
FT                   MRAIGYKKRQMALNYVMMPFFTSIVGGILGYILSCLVSIIIINRFSNYFSLDYGVFSFD
FT                   WIGLLNNLIFMWLIISAISFLIGYLIMKKGAINLLENRNVKKISKLGSLIKSLSNKRKF
FT                   NHRLRAALLVNSGSKLTGVGFVVLIATILFTISFVSPKLLKNNKIYAYNGVKYNQIVEY
FT                   SQPTYNNPFSFIRVFNPDKKSDDKYSIIKNNNRYLATSLPTKNNQYDLQTIINDYLNQT
FT                   YSNAYYSLAIDLQDKQEVQAINLALSNMKLLQAQDIALTKQYFKYISSLSITPSSIHHI
FT                   LLKNWPDYDNLINKLKEIKENEFETLLNQFKYLQQFYATYTNSIGLAINRSYINSFDLK
FT                   DKKDLRIQKFNNNSSDQNNLKTKAYDDILNSDLLALSKSSFSSKEFKNKIIDQFKLTNS
FT                   QSSLGMYHILDNKWNKSNSISDQFLDISAFDFINKKYKLDDLKDLVIKLSLWFSVMFYK
FT                   RDDQALIQAAYSRAPYFVKQNLKISYNSNKDYTLGFNLTTFNKNYEQLGTLLNVKTLDN
FT                   KHTFKIYGIQNNHDYIDLYDQNKTDLIKKLFGSEQNSIIINQTIAKRLNLKPNDTISLN
FT                   VLQNELQHIKNNKITVFKTSDWSMKQDTNYDSFIQRSDISTNNLKVKTNNSVLELNNGF
FT                   SDVNSYYQSYLNNELKLGTKIQNKTFKIVGVHDGYNENMAWIKESDAQEILNYKQNKSI
FT                   WWKDIFAPQWNKTFSSIQAKQVLNDSLDLNNKSLTDYSYEQFVNEFINNKNHKNHKIAK
FT                   KVLQIFDNQFPIFNYKYSKSNDIGNLDTIVSTYSKIADYNPVSLNGQHLENKTSYDGIG
FT                   QGVIQTITPIQITKQILDQISNLVMLALVLAIITILMIAFVIILLTTSLIISDNTRFIA
FT                   TLKVLGYSNKYITENILGMYFIVIANMLVIGFISGWFIFDSTIKSLYSIIVLPIIFPIW
FT                   LPFAVILAVGGIYLITLIVGFNSIYKTDATLTLKDNDV"
FT   gene            complement(833650..834405)
FT                   /locus_tag="MMS_A0784"
FT   CDS_pept        complement(833650..834405)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0784"
FT                   /product="putative tRNA pseudouridine synthase A"
FT                   /note="identified by match to protein family HMM PF01416"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0784"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69620"
FT                   /protein_id="ADK69620.1"
FT                   /translation="MKTGILLSLCYDGSNYHGWINQTNAISIQTTLNKAIKKVIKTGQF
FT                   KTIGASKTDTNVHALDQKVLLIIYFTPILEKFIKAINKALPSDIKILDAKFVDPNFNIR
FT                   EVEYKIYHYYINDHQFDIFTNRYEYFWKHQKIDIIKLQEIFNLFIGEHEFKLFSGLKEN
FT                   EWNQYQTKRTIDDIKVLRINNKVVIEFKASGFIRYQIRIIIANCLNAYLNHKISTTKLV
FT                   EMLQGIGKKTPFIIDAKGLVLQKIQFNKN"
FT   gene            complement(834408..835418)
FT                   /locus_tag="MMS_A0785"
FT   CDS_pept        complement(834408..835418)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0785"
FT                   /product="cobalt transport protein"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0785"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70066"
FT                   /protein_id="ADK70066.1"
FT                   /translation="MRISFGRYIPKNSLIHKMDPRLKLFMIMVLIISVFFPIGLTGYLI
FT                   ISSIIIGLFALSQLSFKMLVRLLVPVTFIFAIIVLMNFFFIHPSSNAVGQISSWIEKNP
FT                   NKIFWTKYNGTIVGKLDVDAVSQITNSLGKELKNLQPIGYFFNWKVFWFSEKALYSALV
FT                   MGMRIYLMITLTCILTGSTPSLQLTLAIEDLLSPLRLIKAPVYILSMIISIALRMIPTL
FT                   IDEAGRIMKAQASRGIDIKNGKFKDKVKSLTSLIIPLLVSSFQKAEDLAYAMDARGYDP
FT                   NATRTRFVQFKFRIVDAIIFVLGISFAIFMMVYGSNPHGIFTNWHISHIDSLVAY"
FT   gene            complement(835432..836343)
FT                   /locus_tag="MMS_A0786"
FT   CDS_pept        complement(835432..836343)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0786"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0786"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69460"
FT                   /protein_id="ADK69460.1"
FT                   /translation="MQKVNKKTNQNLKDIDFSKDIILDNVSYTYAKKTPFEFKALNNTS
FT                   LTFKKNKVTCVIGTTGSGKSTMIQLTNGLIISETGQTIVGDYAIPANTKKIKEVKRLRK
FT                   EIGLVFQFPEYQLFQETIEKDIAFGPVNLGENKQEAYNKVPELLKLVQLPEDYVNRSPF
FT                   ELSGGQKRRVALAGIIAMDGNTLVLDEPTGGLDPKGEEDFINLFERLNKEYKKRIIMVT
FT                   HNMDQVLRIADEVIVMHEGKVIAIGSPFEIFSNMELLTKIEIDPPKLYQLMYKLKNKGI
FT                   DLLNKKIRTIEDFAEELAKVLK"
FT   gene            complement(836331..837557)
FT                   /locus_tag="MMS_A0787"
FT   CDS_pept        complement(836331..837557)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0787"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0787"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69424"
FT                   /protein_id="ADK69424.1"
FT                   /translation="MDNSAIFEEFNSKKISQDDLEATITSLNNYFVKLNDLNNQYINLI
FT                   RQDNIDKIEKQNIRQQQKQVKVEIKKISATTKLFKQNLKLAESLYKKIKLTNNQDDINK
FT                   AKHEVEIAKSMLLQLKEVINGQGKSIKLKKLSDIAIEINHLSFKYGPEFPNAIDDVSFT
FT                   INQGEYVTIIGHNGSGKSTISKILIGVLNAQHGEIKIFGNIVNDHNIEQARKFLGIVFQ
FT                   NPDNQFIGSTVEADIAFGLENKRIDPKKMPDIILDSAKKVGMEWALKKEPLNLSGGQKQ
FT                   RVAIASTLALDPDIMIFDEATSMLDPKGKREIKEIMVQLRETRTKTILSITHDMDEILN
FT                   ADKVIVLDHGKLVRVAKPLEIVEDKDFLRNIQLDVPFVGLVREELEKKGIKIASTQNID
FT                   ELVEQICKK"
FT   gene            complement(837794..839467)
FT                   /locus_tag="MMS_A0788"
FT   CDS_pept        complement(837794..839467)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0788"
FT                   /product="transposase, IS4 family"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0788"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70040"
FT                   /protein_id="ADK70040.1"
FT                   /translation="MKKSRNDVKRQWRTSIARVKKGEYLSIGVPRPDNKGFVYRLGYGY
FT                   LHELKQYHDDPLAIIKAIIANFPLSWTKEQARTKLDEIFKEKKETKKEVLERFKGYEVV
FT                   EKLFDYFNIFNDCSPTKSTTLKDVVLQLIYQRIKNPISVFNTYKTAKKEKIDTHSKNSF
FT                   YRSLDYIAKNKDEILRNLNAKICANTNRKIDVLWFDATTTYFETFSREGYKKPGYSKDG
FT                   KFKEDQIVIGMATDENGIPLHYKIFPGNVADPNTLIPFMLEIADIYEVNSVTIIADKGM
FT                   SVNRNIRFLESKNWKYIISYKMKAGSKQFKEYILDEKDYINDGGLIYKTRDIASSYNKK
FT                   RINGHFRRQIISFSQKRATKDKNDRDILIQNFTKKMNKDNLVSCDDLAGSKKYRFFKPI
FT                   NKGAFYELDIEKIQEDQKYDGYYVYETNRTDLSVKEVINLYSKQWQIESNFKTLKGKLS
FT                   LRPMYLSTWNHIVGYICLCFISLVFLNYIIYILNSKLGLTGKSKITEHKVINVIKEVKE
FT                   IEVFVNKQKIETIQVYNDELQESWQTYQILLELLTKEKVT"
FT   gene            complement(839627..839986)
FT                   /gene="rplQ"
FT                   /locus_tag="MMS_A0789"
FT   CDS_pept        complement(839627..839986)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplQ"
FT                   /locus_tag="MMS_A0789"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by match to protein family HMM PF01196;
FT                   match to protein family HMM TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0789"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69186"
FT                   /protein_id="ADK69186.1"
FT                   /translation="MSYIQKRGQNTAWRTALMRNLTTELIINESLEVTQTRAKELRRHF
FT                   DHMITLAKRGDLHSRRQAASWLRDIDADKKETALQKLFNKLAKKYENRNGGYTSILKLD
FT                   NRKGDNAPMVIIKLI"
FT   gene            complement(840006..840959)
FT                   /gene="rpoA"
FT                   /locus_tag="MMS_A0790"
FT   CDS_pept        complement(840006..840959)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpoA"
FT                   /locus_tag="MMS_A0790"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01000;
FT                   match to protein family HMM PF01193; match to protein
FT                   family HMM PF03118; match to protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0790"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69805"
FT                   /protein_id="ADK69805.1"
FT                   /translation="MKQFVRPEFILLKEGQDKNYGKFSVSPLERGFGITLGNAIRRTLL
FT                   AATPGASVYAIKIAGATHEFTSIPGIIENVTKIILNIKQLVLKIDTSIYSDDEVVQLRI
FT                   RSDIQGPIYAGDLDIPAGVEILNKDLLIATISEGGVLDLVLYAKNSRGYKTFKDNKNEK
FT                   NIEPGMITIDSNYSPIIKVAYSVDSAKIGRAIDLEKLELEVTTDGSITAIDAISIASRI
FT                   LVAHLEFFIDLNREISVLEVIGTNQTDDKELDRTVEELDFTQRSLNCLKRAGINTLREL
FT                   VSKNEDEIGSIRNLGRKSLKEIKDKVASLGLAFRQS"
FT   gene            complement(840963..841352)
FT                   /gene="rpsK"
FT                   /locus_tag="MMS_A0791"
FT   CDS_pept        complement(840963..841352)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsK"
FT                   /locus_tag="MMS_A0791"
FT                   /product="30S ribosomal protein S11"
FT                   /note="identified by match to protein family HMM PF00411;
FT                   match to protein family HMM TIGR03632"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0791"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69090"
FT                   /protein_id="ADK69090.1"
FT                   /translation="MANPKPQAKKKIKKNIPKGIAHIHSTFNNTIVTVSDEKGNVLSWS
FT                   SAGAIGFKGSKKSTPYAAQLISEAAAKGAMDNGVKTVSVEVKGPGPGRDAAIRALQMAG
FT                   LEITSIKDTTPIPHNGVRPRKRPRG"
FT   gene            complement(841378..841743)
FT                   /gene="rpsM"
FT                   /locus_tag="MMS_A0792"
FT   CDS_pept        complement(841378..841743)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsM"
FT                   /locus_tag="MMS_A0792"
FT                   /product="30S ribosomal protein S13"
FT                   /note="identified by match to protein family HMM PF00416;
FT                   match to protein family HMM TIGR03631"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0792"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69688"
FT                   /protein_id="ADK69688.1"
FT                   /translation="MARISGVEIPNNKRVVVSLTYIYGIGLPTAQSVLKTLNISEDIRV
FT                   KDLTEEQIKNISMEISKYKTEGKLRREVSLNIKRLMEIGSYRGLRHRKGLPVRGQSSKT
FT                   NARTVKGPRKTVANKKK"
FT   gene            complement(841780..841893)
FT                   /gene="rpmJ"
FT                   /locus_tag="MMS_A0793"
FT   CDS_pept        complement(841780..841893)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmJ"
FT                   /locus_tag="MMS_A0793"
FT                   /product="ribosomal protein L36"
FT                   /note="identified by match to protein family HMM PF00444;
FT                   match to protein family HMM TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0793"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69996"
FT                   /protein_id="ADK69996.1"
FT                   /translation="MKVRSSVKQICDKCRVIRRKGRVMIICVTPKHKQRQG"
FT   gene            complement(841962..842186)
FT                   /gene="infA"
FT                   /locus_tag="MMS_A0794"
FT   CDS_pept        complement(841962..842186)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="infA"
FT                   /locus_tag="MMS_A0794"
FT                   /product="translation initiation factor IF-1"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF01176; match to protein
FT                   family HMM TIGR00008"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0794"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69526"
FT                   /protein_id="ADK69526.1"
FT                   /translation="MAKETEMEFEGTVVEVLPNAQFKVKLENGVVINAHVSGKIRMHYI
FT                   RILPGDKVTIVISPYDMTRGRITYRKIGK"
FT   gene            complement(842198..842953)
FT                   /gene="map"
FT                   /locus_tag="MMS_A0795"
FT   CDS_pept        complement(842198..842953)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="map"
FT                   /locus_tag="MMS_A0795"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM TIGR00500"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0795"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69880"
FT                   /protein_id="ADK69880.1"
FT                   /translation="MITIKNQEQIQKMKIAGQVLAKGLNLLKSMIKPGVNCLDLDKAFE
FT                   EFIKQNGCESNFKNYQGFPKTICISINDQLIHGIPKNRILQNGDIVSIDAGCMYQKWHA
FT                   DSAFTMVCGIANNKKNDILIRVTEKALDLAIAELKPGIRVGTIGSIIQNYVESHNFSVS
FT                   RDYTGHGIGLALHEDPYIPNYGIPNTGVRLQENMVICIEPMVQMGTYKTKLADDNWTVY
FT                   SADHSMTAHFEHTILITKDGCEVLTKEER"
FT   gene            complement(842953..843594)
FT                   /locus_tag="MMS_A0796"
FT   CDS_pept        complement(842953..843594)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0796"
FT                   /product="putative adenylate kinase"
FT                   /note="identified by match to protein family HMM PF00406;
FT                   match to protein family HMM PF05191; match to protein
FT                   family HMM TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0796"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69340"
FT                   /protein_id="ADK69340.1"
FT                   /translation="MNIMLLGAPGCGKGTQAEQLVNKLNFIQVSTGDLMRKEISLNTRL
FT                   GLKCQEYMNAGKYVPDQIVNQIVSQFLKNTNDKLIFDGYPRTLEQAKSLEQMLDLYNKK
FT                   IDYVFYIDVNDQILIKRITNRLVCPLCKASFNLETRKPKQEGLCDFDNTKLVKRSDDSL
FT                   DKVQIRLQTYKEQTLPLIDYFKTNSKFIEIKADDLSAEQVFNQIKGELKI"
FT   gene            complement(843722..845170)
FT                   /gene="secY"
FT                   /locus_tag="MMS_A0797"
FT   CDS_pept        complement(843722..845170)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="secY"
FT                   /locus_tag="MMS_A0797"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by match to protein family HMM PF00344;
FT                   match to protein family HMM TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0797"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69562"
FT                   /protein_id="ADK69562.1"
FT                   /translation="MVIKKPANKVDKKTTFKSSTKKKNLFKSNFFTKNKDLILRILFTL
FT                   LALIIIRLGVYITVPGVTLDKRFATDSSRIQFFQLLSTLGGGSIGRFSILALGVSPYIT
FT                   ASIIVQLLSTDVIPVLTRWSKSGERGRKKLDKLTKIIMIPFALMQAEATIFTLSSQGLI
FT                   VPGWDSTNVIANSAFYYVLIPLVMLGGSFFMLWIADQITIKGIGNGISIVIFIGIIISM
FT                   PTNLKATFEYWVSNSGEEANIFFSGLLNFMIYISVFLLVILSVVIMNEAERKIPIQQTG
FT                   SGLTDSNEHTPYLPLKLNNAGVIPVIFASAIISTPITISQIIEAVNPDSGFVIFTRDYL
FT                   SFNTWWGISIFGILVVLFTFLYSQVQINPEKVAENFQKSGTFIPGIKPGKDTTKYLTGI
FT                   INRLSVVGSVFLAIIALLPYVISKLTQLPSNLAIGGTGLIICISVAIQTVQQLKGRIIQ
FT                   QNFIEKKKEKFTNNTNKNKTSHIW"
FT   gene            complement(845170..845607)
FT                   /gene="rplO"
FT                   /locus_tag="MMS_A0798"
FT   CDS_pept        complement(845170..845607)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplO"
FT                   /locus_tag="MMS_A0798"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by match to protein family HMM PF00256;
FT                   match to protein family HMM PF01305; match to protein
FT                   family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0798"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69057"
FT                   /protein_id="ADK69057.1"
FT                   /translation="MKLNELKYTPGSKTKATIVGRGMASGKGKTATRGHKGQNSRSGGG
FT                   VRPGFEGGQTPLFRRLPKVGFTSLNQKQYTILNLSDLETLGLEKIDHESLINSKIIKNN
FT                   ASLIKILANGTLTKKVDVKVNKISKAAKDAIEKLGGKVEVI"
FT   gene            complement(845626..846390)
FT                   /gene="rpsE"
FT                   /locus_tag="MMS_A0799"
FT   CDS_pept        complement(845626..846390)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsE"
FT                   /locus_tag="MMS_A0799"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by match to protein family HMM PF00333;
FT                   match to protein family HMM PF03719; match to protein
FT                   family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0799"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69415"
FT                   /protein_id="ADK69415.1"
FT                   /translation="MTEEMNVVETSSEMNSNVEKASTQVKETKKFERRTRPQSKSKQVK
FT                   DEFEEKVVTIRRVTKVTKGGRHFRFAAVVVVGNKKGLVGMGTGKANEVPEAIKKAIKEA
FT                   KKNLVSVTLRNTTVPHEVLGTFGAGKILIKPAKVGTGIIAGGPARAVIELAGISDVYAK
FT                   SLGSNNAINMIRATFEGLSSMQTLKRVQELRYGKTFDTQKVKPVEQKVAEVKGVEKKQP
FT                   KQAVKKVAVKKAENQENRVEVITNAETESKAE"
FT   gene            complement(846409..846759)
FT                   /gene="rplR"
FT                   /locus_tag="MMS_A0800"
FT   CDS_pept        complement(846409..846759)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplR"
FT                   /locus_tag="MMS_A0800"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0800"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70063"
FT                   /protein_id="ADK70063.1"
FT                   /translation="MKFTKAEARKRRHFRVRQKVVGTAERPRLNVFKSNTNFYAQIIDD
FT                   TKGVTLVSASTLKMDLKSKSNTLAAQKVAEEIAKKALAANITQVVFDRNGYLYHGKIKA
FT                   FAETARENGLKF"
FT   gene            complement(846785..847327)
FT                   /gene="rplF"
FT                   /locus_tag="MMS_A0801"
FT   CDS_pept        complement(846785..847327)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplF"
FT                   /locus_tag="MMS_A0801"
FT                   /product="ribosomal protein L6"
FT                   /note="identified by match to protein family HMM PF00347;
FT                   match to protein family HMM TIGR03654"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0801"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69899"
FT                   /protein_id="ADK69899.1"
FT                   /translation="MSRIGNRLLQIPNGVEVKIAENNLITITGSKGTLSKQFSPLIKIE
FT                   VEENKLITKRLNEQKHTKQLHGTTNSLLQGMLTGVSEGFKKELQITGVGYKAAVNGSKL
FT                   NLSLGYSHPVEFEIPKGVEIQAVKPTELVISGIDKQLVGQVAANIRAYRKPEPYKGKGI
FT                   KYKNETIIRKEGKAAGK"
FT   gene            complement(847341..847730)
FT                   /gene="rpsH"
FT                   /locus_tag="MMS_A0802"
FT   CDS_pept        complement(847341..847730)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsH"
FT                   /locus_tag="MMS_A0802"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0802"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69556"
FT                   /protein_id="ADK69556.1"
FT                   /translation="MTTDVIADMLTRIRNANQRYLKTVSVPSSKVKLEIARILKEEGFI
FT                   SNFTVEGDVKKTINIELKYQGKTRVIQGLKKISKPGLRVYAQANEIPQVLNGLGISIVS
FT                   TSQGIMTGKKARLANAGGEVLAFIW"
FT   gene            complement(847750..847935)
FT                   /gene="rpsN"
FT                   /locus_tag="MMS_A0803"
FT   CDS_pept        complement(847750..847935)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsN"
FT                   /locus_tag="MMS_A0803"
FT                   /product="ribosomal protein S14p/S29e"
FT                   /note="identified by match to protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0803"
FT                   /db_xref="EnsemblGenomes-Tr:ADK70041"
FT                   /protein_id="ADK70041.1"
FT                   /translation="MAKKSLKVKQAKHQKFNVRNYTRCNHCGRPHAVLKKFGICRLCFR
FT                   KFAYEGQIPGIKKASW"
FT   gene            complement(847954..848496)
FT                   /locus_tag="MMS_A0804"
FT   CDS_pept        complement(847954..848496)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /locus_tag="MMS_A0804"
FT                   /product="ribosomal L5P C-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF00281;
FT                   match to protein family HMM PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0804"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69146"
FT                   /protein_id="ADK69146.1"
FT                   /translation="MKSRLEIKYKDQIVPELFKELNYKSIMQVPKIQKIVINMGIGDAT
FT                   TDPKKLDAAISELEKLSGQKPIVTKAKKSLAVFKLREGMAIGAKVTLRGKKMYDFLDKL
FT                   INVALPRVRDFRGVSKTSFDGFGNFTTGIKEQIIFPEVDYDKVIRLRGMDITIVTSAKT
FT                   NKEAFALLQKVGMPFEK"
FT   gene            complement(848515..848841)
FT                   /gene="rplX"
FT                   /locus_tag="MMS_A0805"
FT   CDS_pept        complement(848515..848841)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplX"
FT                   /locus_tag="MMS_A0805"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0805"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69612"
FT                   /protein_id="ADK69612.1"
FT                   /translation="MAKSRILKGDVVKVIAGSHKGQIGPITSITKDKQWVSVQGITVKK
FT                   HVKPTNEDSEGGIKDIPAKLHISNVALQDPKNKDQVTKVGFEIINGKKVRIARKSKTQI
FT                   KTAK"
FT   gene            complement(848855..849223)
FT                   /gene="rplN"
FT                   /locus_tag="MMS_A0806"
FT   CDS_pept        complement(848855..849223)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplN"
FT                   /locus_tag="MMS_A0806"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0806"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69248"
FT                   /protein_id="ADK69248.1"
FT                   /translation="MIQTLSKLKVADNSGAKEVRVIRNLGGSVRKFSGIGDIIICSVIS
FT                   ATPGAVIKKGQVVKAVIVRTTRELRREDGTYIKFSENAAVLIKEDKTPRGTRIFGPIAR
FT                   EIKEAGFAKIASLAPEVL"
FT   gene            complement(849239..849496)
FT                   /gene="rpsQ"
FT                   /locus_tag="MMS_A0807"
FT   CDS_pept        complement(849239..849496)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsQ"
FT                   /locus_tag="MMS_A0807"
FT                   /product="30S ribosomal protein S17"
FT                   /note="identified by match to protein family HMM PF00366;
FT                   match to protein family HMM TIGR03635"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0807"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69641"
FT                   /protein_id="ADK69641.1"
FT                   /translation="MQRNSRRVLIGKVVSDKMDKTITVLVETYKNHPIYKKRVKYSKKY
FT                   KAHDENQVAQMGDKVEIMETRPLSKTKNFRLVRVIEKATL"
FT   gene            complement(849496..849912)
FT                   /gene="rpmC"
FT                   /locus_tag="MMS_A0808"
FT   CDS_pept        complement(849496..849912)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpmC"
FT                   /locus_tag="MMS_A0808"
FT                   /product="ribosomal protein L29"
FT                   /note="identified by match to protein family HMM PF00831;
FT                   match to protein family HMM TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0808"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69279"
FT                   /protein_id="ADK69279.1"
FT                   /translation="MAKSKMLDLRNLSVDELIKTNESKRAELFALKFQAAVGSLEQTHR
FT                   IKEIKKEIARIELALSEKRLSGENTNKVIKADYNKAVAEAEKAGKEVRAKQRKFLEEQY
FT                   GQQSQTELNEADIQKAMQAAEQETVEPDTKGETK"
FT   gene            complement(849912..850325)
FT                   /gene="rplP"
FT                   /locus_tag="MMS_A0809"
FT   CDS_pept        complement(849912..850325)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplP"
FT                   /locus_tag="MMS_A0809"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0809"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69779"
FT                   /protein_id="ADK69779.1"
FT                   /translation="MLQPKRTKYRKPHRVSYEGKAKGAKEINFGEFGLMALDGAWIDNH
FT                   QIEAARIAMTRYMKRDGKIWMRIFPHMAMTKKPAEVRMGSGKGNPEKWVAVVKKGTIMF
FT                   EVAQVNEQVAREALRLAMHKLPIRCKFVKRGEN"
FT   gene            complement(850328..851029)
FT                   /gene="rpsC"
FT                   /locus_tag="MMS_A0810"
FT   CDS_pept        complement(850328..851029)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsC"
FT                   /locus_tag="MMS_A0810"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by match to protein family HMM PF00189;
FT                   match to protein family HMM PF00417; match to protein
FT                   family HMM PF07650; match to protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0810"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69949"
FT                   /protein_id="ADK69949.1"
FT                   /translation="MGQKVSPNVLRLGIVRDWENRWYAEKDQYVKWLDQDIKIRTALFK
FT                   LLKDAAVSKIDIERTTKDLTLFIKTARPAIVLGQEGKNIEKIVLAVRKTVKNKKLIVNV
FT                   RVIEIKSPDADATLVARWIGEQISNRASFRTVQKLAIKKALKAGAKGIKTAVSGRLGGV
FT                   EMARTEGYLEGSVPLSTLRNNIDYALYEAPTTYGQIGVKVWINHGEVFKKERMNNSQIM
FT                   AKPRTNKGGKR"
FT   gene            complement(851047..851382)
FT                   /gene="rplV"
FT                   /locus_tag="MMS_A0811"
FT   CDS_pept        complement(851047..851382)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplV"
FT                   /locus_tag="MMS_A0811"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0811"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69915"
FT                   /protein_id="ADK69915.1"
FT                   /translation="MEAKAKLSMIRISPRKMRLVADTIRNKAVLVAVATLKNLNKDAAE
FT                   PILKLLNSAVANAVNNNGMEADKLYVKTIFVNEGPTLKRFRPRAHGRAYEIFKRTSHVV
FT                   IVVSDEK"
FT   gene            complement(851406..851672)
FT                   /gene="rpsS"
FT                   /locus_tag="MMS_A0812"
FT   CDS_pept        complement(851406..851672)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rpsS"
FT                   /locus_tag="MMS_A0812"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by match to protein family HMM PF00203;
FT                   match to protein family HMM TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0812"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69775"
FT                   /protein_id="ADK69775.1"
FT                   /translation="MARSLKKGPFVDESLFKKVTAAKDGEVIKTWSRRSTIFPEFIGKT
FT                   FGVYNGKEFIPVYITEDMVGNKLGEFAPTRKFGGHGDDKGKKK"
FT   gene            complement(851694..852542)
FT                   /gene="rplB"
FT                   /locus_tag="MMS_A0813"
FT   CDS_pept        complement(851694..852542)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplB"
FT                   /locus_tag="MMS_A0813"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by match to protein family HMM PF00181;
FT                   match to protein family HMM PF03947; match to protein
FT                   family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0813"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69401"
FT                   /protein_id="ADK69401.1"
FT                   /translation="MAIKKYKSTTNGRRNMTTIDYSAVLTTKNNPEKSLVVSKNSKAGR
FT                   NNRGLITTRHKGGGHKQKYRIIDFKRNKRDIFGTISTIEYDPNRNAFICLINYVDGEKR
FT                   YILFAKGMQVGMKVVASENADIKVGNVAPLKNIPEGTLLHNVELKPGKGGQIARSAGSS
FT                   VQLLGKDDDGKYVTLRLSSGEVRKVLAECYATIGEVGNEEYNLVNWGKAGRNRWRGIRP
FT                   TVRGSVMNPNDHPHGGGEGRAPIGRKSPVTPWGKKALGVKTRNTKKTSEKLIVRKRSNK
FT                   K"
FT   gene            complement(852597..852881)
FT                   /gene="rplW"
FT                   /locus_tag="MMS_A0814"
FT   CDS_pept        complement(852597..852881)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplW"
FT                   /locus_tag="MMS_A0814"
FT                   /product="ribosomal protein L23"
FT                   /note="identified by match to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0814"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69588"
FT                   /protein_id="ADK69588.1"
FT                   /translation="MHITEVLKKPVLTEKSFAGHKDNVYTFLVDKKANKVQIKKTFEEI
FT                   FEVKVESVRTINYDAKEKRLGKYVGKKPSYKKAIITLKEGQKLDVLSDL"
FT   gene            complement(852881..853507)
FT                   /gene="rplD"
FT                   /locus_tag="MMS_A0815"
FT   CDS_pept        complement(852881..853507)
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="rplD"
FT                   /locus_tag="MMS_A0815"
FT                   /product="50S ribosomal protein L4"
FT                   /note="identified by match to protein family HMM PF00573;
FT                   match to protein family HMM TIGR03953"
FT                   /db_xref="EnsemblGenomes-Gn:MMS_A0815"
FT                   /db_xref="EnsemblGenomes-Tr:ADK69276"
FT                   /protein_id="