(data stored in ACNUC7421 zone)

EMBL: CP002116

ID   CP002116; SV 1; circular; genomic DNA; STD; PRO; 4653970 BP.
XX
AC   CP002116;
XX
PR   Project:PRJNA32637;
XX
DT   30-JUL-2010 (Rel. 105, Created)
DT   01-SEP-2017 (Rel. 134, Last updated, Version 6)
XX
DE   Sediminispirochaeta smaragdinae DSM 11293 chromosome, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Sediminispirochaeta smaragdinae DSM 11293
OC   Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae;
OC   Sediminispirochaeta.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-4653970
RX   PUBMED; 21304743.
RA   Mavromatis K., Yasawong M., Chertkov O., Lapidus A., Lucas S., Nolan M.,
RA   Del Rio T.G., Tice H., Cheng J.F., Pitluck S., Liolios K., Ivanova N.,
RA   Tapia R., Han C., Bruce D., Goodwin L., Pati A., Chen A., Palaniappan K.,
RA   Land M., Hauser L., Chang Y.J., Jeffries C.D., Detter J.C., Rohde M.,
RA   Brambilla E., Spring S., Goker M., Sikorski J., Woyke T., Bristow J.,
RA   Eisen J.A., Markowitz V., Hugenholtz P., Klenk H.P., Kyrpides N.C.;
RT   "Complete genome sequence of Spirochaeta smaragdinae type strain (SEBR
RT   4228)";
RL   Stand Genomic Sci 3(2):136-144(2010).
XX
RN   [2]
RP   1-4653970
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Dalin E., Tice H., Bruce D., Goodwin L.,
RA   Pitluck S., Kyrpides N., Mavromatis K., Ivanova N., Chertkov O.,
RA   Detter J.C., Tapia R., Han C., Larimer F., Land M., Hauser L.,
RA   Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D., Spring S.,
RA   Schroeder M., Brambilla E., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Spirochaeta smaragdinae DSM 11293";
RL   Unpublished.
XX
RN   [3]
RP   1-4653970
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Dalin E., Tice H., Bruce D., Goodwin L.,
RA   Pitluck S., Kyrpides N., Mavromatis K., Ivanova N., Chertkov O.,
RA   Detter J.C., Tapia R., Han C., Larimer F., Land M., Hauser L.,
RA   Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D., Spring S.,
RA   Schroeder M., Brambilla E., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (23-JUL-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 5d5246bbc0fc4a0b6da71338c4d2573c.
DR   BioSample; SAMN00017394.
DR   CABRI; DSM 11293.
DR   EnsemblGenomes-Gn; EBG00001022281.
DR   EnsemblGenomes-Gn; EBG00001022282.
DR   EnsemblGenomes-Gn; EBG00001022283.
DR   EnsemblGenomes-Gn; EBG00001022284.
DR   EnsemblGenomes-Gn; EBG00001022285.
DR   EnsemblGenomes-Gn; EBG00001022286.
DR   EnsemblGenomes-Gn; EBG00001022287.
DR   EnsemblGenomes-Gn; EBG00001022288.
DR   EnsemblGenomes-Gn; EBG00001022289.
DR   EnsemblGenomes-Gn; EBG00001022290.
DR   EnsemblGenomes-Gn; EBG00001022291.
DR   EnsemblGenomes-Gn; EBG00001022292.
DR   EnsemblGenomes-Gn; EBG00001022293.
DR   EnsemblGenomes-Gn; EBG00001022294.
DR   EnsemblGenomes-Gn; EBG00001022295.
DR   EnsemblGenomes-Gn; EBG00001022296.
DR   EnsemblGenomes-Gn; EBG00001022297.
DR   EnsemblGenomes-Gn; EBG00001022298.
DR   EnsemblGenomes-Gn; EBG00001022299.
DR   EnsemblGenomes-Gn; EBG00001022300.
DR   EnsemblGenomes-Gn; EBG00001022301.
DR   EnsemblGenomes-Gn; EBG00001022302.
DR   EnsemblGenomes-Gn; EBG00001022303.
DR   EnsemblGenomes-Gn; EBG00001022304.
DR   EnsemblGenomes-Gn; EBG00001022305.
DR   EnsemblGenomes-Gn; EBG00001022306.
DR   EnsemblGenomes-Gn; EBG00001022307.
DR   EnsemblGenomes-Gn; EBG00001022308.
DR   EnsemblGenomes-Gn; EBG00001022309.
DR   EnsemblGenomes-Gn; EBG00001022310.
DR   EnsemblGenomes-Gn; EBG00001022311.
DR   EnsemblGenomes-Gn; EBG00001022312.
DR   EnsemblGenomes-Gn; EBG00001022313.
DR   EnsemblGenomes-Gn; EBG00001022314.
DR   EnsemblGenomes-Gn; EBG00001022315.
DR   EnsemblGenomes-Gn; EBG00001022316.
DR   EnsemblGenomes-Gn; EBG00001022317.
DR   EnsemblGenomes-Gn; EBG00001022318.
DR   EnsemblGenomes-Gn; EBG00001022319.
DR   EnsemblGenomes-Gn; EBG00001022320.
DR   EnsemblGenomes-Gn; EBG00001022321.
DR   EnsemblGenomes-Gn; EBG00001022322.
DR   EnsemblGenomes-Gn; EBG00001022323.
DR   EnsemblGenomes-Gn; EBG00001022324.
DR   EnsemblGenomes-Gn; EBG00001022325.
DR   EnsemblGenomes-Gn; EBG00001022326.
DR   EnsemblGenomes-Gn; EBG00001022327.
DR   EnsemblGenomes-Gn; EBG00001022328.
DR   EnsemblGenomes-Gn; EBG00001022329.
DR   EnsemblGenomes-Gn; EBG00001022330.
DR   EnsemblGenomes-Gn; EBG00001022331.
DR   EnsemblGenomes-Gn; EBG00001022332.
DR   EnsemblGenomes-Gn; EBG00001022333.
DR   EnsemblGenomes-Gn; EBG00001022334.
DR   EnsemblGenomes-Gn; EBG00001022335.
DR   EnsemblGenomes-Gn; EBG00001022336.
DR   EnsemblGenomes-Gn; EBG00001022337.
DR   EnsemblGenomes-Gn; EBG00001022338.
DR   EnsemblGenomes-Gn; EBG00001022339.
DR   EnsemblGenomes-Gn; EBG00001022340.
DR   EnsemblGenomes-Gn; EBG00001022341.
DR   EnsemblGenomes-Gn; EBG00001022342.
DR   EnsemblGenomes-Gn; EBG00001022343.
DR   EnsemblGenomes-Gn; Spirs_R0001.
DR   EnsemblGenomes-Gn; Spirs_R0002.
DR   EnsemblGenomes-Gn; Spirs_R0003.
DR   EnsemblGenomes-Gn; Spirs_R0004.
DR   EnsemblGenomes-Gn; Spirs_R0005.
DR   EnsemblGenomes-Gn; Spirs_R0006.
DR   EnsemblGenomes-Gn; Spirs_R0007.
DR   EnsemblGenomes-Gn; Spirs_R0008.
DR   EnsemblGenomes-Gn; Spirs_R0009.
DR   EnsemblGenomes-Gn; Spirs_R0010.
DR   EnsemblGenomes-Gn; Spirs_R0011.
DR   EnsemblGenomes-Gn; Spirs_R0012.
DR   EnsemblGenomes-Gn; Spirs_R0013.
DR   EnsemblGenomes-Gn; Spirs_R0014.
DR   EnsemblGenomes-Gn; Spirs_R0015.
DR   EnsemblGenomes-Gn; Spirs_R0016.
DR   EnsemblGenomes-Gn; Spirs_R0017.
DR   EnsemblGenomes-Gn; Spirs_R0018.
DR   EnsemblGenomes-Gn; Spirs_R0019.
DR   EnsemblGenomes-Gn; Spirs_R0020.
DR   EnsemblGenomes-Gn; Spirs_R0021.
DR   EnsemblGenomes-Gn; Spirs_R0022.
DR   EnsemblGenomes-Gn; Spirs_R0023.
DR   EnsemblGenomes-Gn; Spirs_R0024.
DR   EnsemblGenomes-Gn; Spirs_R0025.
DR   EnsemblGenomes-Gn; Spirs_R0026.
DR   EnsemblGenomes-Gn; Spirs_R0027.
DR   EnsemblGenomes-Gn; Spirs_R0028.
DR   EnsemblGenomes-Gn; Spirs_R0029.
DR   EnsemblGenomes-Gn; Spirs_R0030.
DR   EnsemblGenomes-Gn; Spirs_R0032.
DR   EnsemblGenomes-Gn; Spirs_R0033.
DR   EnsemblGenomes-Gn; Spirs_R0034.
DR   EnsemblGenomes-Gn; Spirs_R0035.
DR   EnsemblGenomes-Gn; Spirs_R0036.
DR   EnsemblGenomes-Gn; Spirs_R0037.
DR   EnsemblGenomes-Gn; Spirs_R0038.
DR   EnsemblGenomes-Gn; Spirs_R0039.
DR   EnsemblGenomes-Gn; Spirs_R0040.
DR   EnsemblGenomes-Gn; Spirs_R0041.
DR   EnsemblGenomes-Gn; Spirs_R0042.
DR   EnsemblGenomes-Gn; Spirs_R0043.
DR   EnsemblGenomes-Gn; Spirs_R0044.
DR   EnsemblGenomes-Gn; Spirs_R0045.
DR   EnsemblGenomes-Gn; Spirs_R0046.
DR   EnsemblGenomes-Gn; Spirs_R0047.
DR   EnsemblGenomes-Gn; Spirs_R0048.
DR   EnsemblGenomes-Gn; Spirs_R0049.
DR   EnsemblGenomes-Gn; Spirs_R0050.
DR   EnsemblGenomes-Gn; Spirs_R0051.
DR   EnsemblGenomes-Gn; Spirs_R0052.
DR   EnsemblGenomes-Gn; Spirs_R0053.
DR   EnsemblGenomes-Gn; Spirs_R0054.
DR   EnsemblGenomes-Gn; Spirs_R0055.
DR   EnsemblGenomes-Gn; Spirs_R0056.
DR   EnsemblGenomes-Gn; Spirs_R0057.
DR   EnsemblGenomes-Gn; Spirs_R0058.
DR   EnsemblGenomes-Tr; EBT00001625474.
DR   EnsemblGenomes-Tr; EBT00001625475.
DR   EnsemblGenomes-Tr; EBT00001625476.
DR   EnsemblGenomes-Tr; EBT00001625477.
DR   EnsemblGenomes-Tr; EBT00001625478.
DR   EnsemblGenomes-Tr; EBT00001625479.
DR   EnsemblGenomes-Tr; EBT00001625480.
DR   EnsemblGenomes-Tr; EBT00001625481.
DR   EnsemblGenomes-Tr; EBT00001625482.
DR   EnsemblGenomes-Tr; EBT00001625483.
DR   EnsemblGenomes-Tr; EBT00001625484.
DR   EnsemblGenomes-Tr; EBT00001625485.
DR   EnsemblGenomes-Tr; EBT00001625486.
DR   EnsemblGenomes-Tr; EBT00001625487.
DR   EnsemblGenomes-Tr; EBT00001625488.
DR   EnsemblGenomes-Tr; EBT00001625489.
DR   EnsemblGenomes-Tr; EBT00001625490.
DR   EnsemblGenomes-Tr; EBT00001625491.
DR   EnsemblGenomes-Tr; EBT00001625492.
DR   EnsemblGenomes-Tr; EBT00001625493.
DR   EnsemblGenomes-Tr; EBT00001625494.
DR   EnsemblGenomes-Tr; EBT00001625495.
DR   EnsemblGenomes-Tr; EBT00001625496.
DR   EnsemblGenomes-Tr; EBT00001625497.
DR   EnsemblGenomes-Tr; EBT00001625498.
DR   EnsemblGenomes-Tr; EBT00001625499.
DR   EnsemblGenomes-Tr; EBT00001625500.
DR   EnsemblGenomes-Tr; EBT00001625501.
DR   EnsemblGenomes-Tr; EBT00001625502.
DR   EnsemblGenomes-Tr; EBT00001625503.
DR   EnsemblGenomes-Tr; EBT00001625504.
DR   EnsemblGenomes-Tr; EBT00001625505.
DR   EnsemblGenomes-Tr; EBT00001625506.
DR   EnsemblGenomes-Tr; EBT00001625507.
DR   EnsemblGenomes-Tr; EBT00001625508.
DR   EnsemblGenomes-Tr; EBT00001625509.
DR   EnsemblGenomes-Tr; EBT00001625510.
DR   EnsemblGenomes-Tr; EBT00001625511.
DR   EnsemblGenomes-Tr; EBT00001625512.
DR   EnsemblGenomes-Tr; EBT00001625513.
DR   EnsemblGenomes-Tr; EBT00001625514.
DR   EnsemblGenomes-Tr; EBT00001625515.
DR   EnsemblGenomes-Tr; EBT00001625516.
DR   EnsemblGenomes-Tr; EBT00001625517.
DR   EnsemblGenomes-Tr; EBT00001625518.
DR   EnsemblGenomes-Tr; EBT00001625519.
DR   EnsemblGenomes-Tr; EBT00001625520.
DR   EnsemblGenomes-Tr; EBT00001625521.
DR   EnsemblGenomes-Tr; EBT00001625522.
DR   EnsemblGenomes-Tr; EBT00001625523.
DR   EnsemblGenomes-Tr; EBT00001625524.
DR   EnsemblGenomes-Tr; EBT00001625525.
DR   EnsemblGenomes-Tr; EBT00001625526.
DR   EnsemblGenomes-Tr; EBT00001625527.
DR   EnsemblGenomes-Tr; EBT00001625528.
DR   EnsemblGenomes-Tr; EBT00001625529.
DR   EnsemblGenomes-Tr; EBT00001625530.
DR   EnsemblGenomes-Tr; EBT00001625531.
DR   EnsemblGenomes-Tr; EBT00001625532.
DR   EnsemblGenomes-Tr; EBT00001625533.
DR   EnsemblGenomes-Tr; EBT00001625534.
DR   EnsemblGenomes-Tr; EBT00001625535.
DR   EnsemblGenomes-Tr; EBT00001625536.
DR   EnsemblGenomes-Tr; Spirs_R0001-1.
DR   EnsemblGenomes-Tr; Spirs_R0002-1.
DR   EnsemblGenomes-Tr; Spirs_R0003-1.
DR   EnsemblGenomes-Tr; Spirs_R0004-1.
DR   EnsemblGenomes-Tr; Spirs_R0005-1.
DR   EnsemblGenomes-Tr; Spirs_R0006-1.
DR   EnsemblGenomes-Tr; Spirs_R0007-1.
DR   EnsemblGenomes-Tr; Spirs_R0008-1.
DR   EnsemblGenomes-Tr; Spirs_R0009-1.
DR   EnsemblGenomes-Tr; Spirs_R0010-1.
DR   EnsemblGenomes-Tr; Spirs_R0011-1.
DR   EnsemblGenomes-Tr; Spirs_R0012-1.
DR   EnsemblGenomes-Tr; Spirs_R0013-1.
DR   EnsemblGenomes-Tr; Spirs_R0014-1.
DR   EnsemblGenomes-Tr; Spirs_R0015-1.
DR   EnsemblGenomes-Tr; Spirs_R0016-1.
DR   EnsemblGenomes-Tr; Spirs_R0017-1.
DR   EnsemblGenomes-Tr; Spirs_R0018-1.
DR   EnsemblGenomes-Tr; Spirs_R0019-1.
DR   EnsemblGenomes-Tr; Spirs_R0020-1.
DR   EnsemblGenomes-Tr; Spirs_R0021-1.
DR   EnsemblGenomes-Tr; Spirs_R0022-1.
DR   EnsemblGenomes-Tr; Spirs_R0023-1.
DR   EnsemblGenomes-Tr; Spirs_R0024-1.
DR   EnsemblGenomes-Tr; Spirs_R0025-1.
DR   EnsemblGenomes-Tr; Spirs_R0026-1.
DR   EnsemblGenomes-Tr; Spirs_R0027-1.
DR   EnsemblGenomes-Tr; Spirs_R0028-1.
DR   EnsemblGenomes-Tr; Spirs_R0029-1.
DR   EnsemblGenomes-Tr; Spirs_R0030-1.
DR   EnsemblGenomes-Tr; Spirs_R0032-1.
DR   EnsemblGenomes-Tr; Spirs_R0033-1.
DR   EnsemblGenomes-Tr; Spirs_R0034-1.
DR   EnsemblGenomes-Tr; Spirs_R0035-1.
DR   EnsemblGenomes-Tr; Spirs_R0036-1.
DR   EnsemblGenomes-Tr; Spirs_R0037-1.
DR   EnsemblGenomes-Tr; Spirs_R0038-1.
DR   EnsemblGenomes-Tr; Spirs_R0039-1.
DR   EnsemblGenomes-Tr; Spirs_R0040-1.
DR   EnsemblGenomes-Tr; Spirs_R0041-1.
DR   EnsemblGenomes-Tr; Spirs_R0042-1.
DR   EnsemblGenomes-Tr; Spirs_R0043-1.
DR   EnsemblGenomes-Tr; Spirs_R0044-1.
DR   EnsemblGenomes-Tr; Spirs_R0045-1.
DR   EnsemblGenomes-Tr; Spirs_R0046-1.
DR   EnsemblGenomes-Tr; Spirs_R0047-1.
DR   EnsemblGenomes-Tr; Spirs_R0048-1.
DR   EnsemblGenomes-Tr; Spirs_R0049-1.
DR   EnsemblGenomes-Tr; Spirs_R0050-1.
DR   EnsemblGenomes-Tr; Spirs_R0051-1.
DR   EnsemblGenomes-Tr; Spirs_R0052-1.
DR   EnsemblGenomes-Tr; Spirs_R0053-1.
DR   EnsemblGenomes-Tr; Spirs_R0054-1.
DR   EnsemblGenomes-Tr; Spirs_R0055-1.
DR   EnsemblGenomes-Tr; Spirs_R0056-1.
DR   EnsemblGenomes-Tr; Spirs_R0057-1.
DR   EnsemblGenomes-Tr; Spirs_R0058-1.
DR   EuropePMC; PMC3746417; 23991249.
DR   EuropePMC; PMC4511686; 26203324.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002116.
DR   SILVA-SSU; CP002116.
DR   StrainInfo; 162579; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085576
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Spirochaeta smaragdinae SEBR 4228, DSM 11293
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Congo
CC   environment         :: Oil fields
CC   num_replicons       :: 1
CC   ref_biomaterial     :: DSM 11293
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Anaerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02938
CC   Type Strain         :: Yes
CC   Greengenes ID       :: 3810
CC   Isolation Site      :: "Oil field of Congo, Africa"
CC   Cell Shape          :: Spiral-shaped
CC   Motility            :: Motile
CC   Sporulation         :: Nonsporulating
CC   Temperature Range   :: Mesophile
CC   Temperature Optimum :: 35C
CC   pH                  :: 7.0 - 7.2
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4653970
FT                   /organism="Sediminispirochaeta smaragdinae DSM 11293"
FT                   /strain="DSM 11293"
FT                   /mol_type="genomic DNA"
FT                   /country="Democratic Republic of the Congo"
FT                   /isolation_source="oil field"
FT                   /db_xref="taxon:573413"
FT                   /type_material="type strain of Sediminispirochaeta
FT                   smaragdinae"
FT   gene            150..1565
FT                   /locus_tag="Spirs_0001"
FT   CDS_pept        150..1565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation;
FT                   InterProIPR020591:IPR001957:IPR003593:IPR013159:IPR 013317;
FT                   KEGG: tde:TDE0001 chromosomal replication initiation
FT                   protein; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase;
FT                   SPTR: Chromosomal replication initiator protein dnaA;
FT                   TIGRFAM: chromosomal replication initiator protein DnaA;
FT                   PFAM: domain; Bacterial dnaA protein; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79161"
FT                   /db_xref="GOA:E1R6M9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6M9"
FT                   /protein_id="ADK79161.1"
FT                   /translation="MNTQSRWDFSIFWQEALNQLKNELSDQEFVMWFSNISYHSSEEGK
FT                   LILSVPSAFYRDQVKQRYTGIIKEKLYELSGFQLDVDFIVTKRATSESPKEKNEVSDTP
FT                   QPPMAVKPVPVSVSPAKNDPPKKHPDLRPDYTFENFVIGENNTLAANACMAISKNPGTA
FT                   YNPCLIYGGVGLGKTHLIQSIGNYAWAHNPDIKIAYVTAETFTNEFIEAIHHNKNHQFK
FT                   NKYRKVDILLIDDIHFLQEKTGTQEELFHTFNALYETNKQLVFTCDRPVSELKQLTDRL
FT                   RSRFERGLNVDLQAPAFETRFAILKQKVEEKKVPIDDEVIELICRNVTTNVRDLEAALT
FT                   RLIAYADLLHKKVTLDIARQQLKDVFSNPKMSNITVEMIQRVTAEYFNLSPNDLRGKKR
FT                   TKAIAFPRQIAMYITREITEFSTTEVGLEFGGRDHTTVMHACQRVESRMQTDPSLEPII
FT                   QRIVRQIKEYGTK"
FT   gene            1565..1741
FT                   /locus_tag="Spirs_0002"
FT   CDS_pept        1565..1741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79162"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N0"
FT                   /protein_id="ADK79162.1"
FT                   /translation="MKRWYNYEEDMCMNTEGCGYVHFHGITFTSYSDGQLFLSKEIMAD
FT                   INIFTVPIITTIN"
FT   gene            1768..2871
FT                   /locus_tag="Spirs_0003"
FT   CDS_pept        1768..2871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0003"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: tde:TDE0231 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta subunit, C-terminal domain; DNA
FT                   polymerase III beta subunit, N-terminal domain; DNA
FT                   polymerase III beta subunit, central domain; TIGRFAM: DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79163"
FT                   /db_xref="GOA:E1R6N1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N1"
FT                   /protein_id="ADK79163.1"
FT                   /translation="MKFTCEKNALLKEISIAQEIISTRNALSILSNVLLEADDGSLTIK
FT                   ATDLKVSFETRIPVEIAAPGSTTVFCDKFLGILRSLPEGDIEVELVDNRVMIRPLFQKI
FT                   NFQLKSIAGDKFPELQEVSEDLYFEIPQKDLIEMIGQTIFAVSDDETRYYMNGVYVEQD
FT                   GESISMVATDGRRLSLIKRRIESELKEFDAVIIPPKVLQLIRKLSSGEGNLKIAISDRN
FT                   IFVQFDDQRITSNLIEGQFPNYRRVIPDSQDYQLVVNRDQLEEALKRVSLLVEQKSRRV
FT                   YLSVENAMMRLTSEESDIGVAKEELSCSYEGPETTIALNYLYLAEPLKVMRCEEVVLRF
FT                   TEANKAITLEPVPEGDYFHIIMPMQLD"
FT   gene            2880..3956
FT                   /locus_tag="Spirs_0004"
FT   CDS_pept        2880..3956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="COGs: COG1195 Recombinational DNA repair ATPase
FT                   (RecF pathway); InterPro IPR001238:IPR003395:IPR018078;
FT                   KEGG: tde:TDE0230 DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; SPTR: DNA replication and repair
FT                   protein recF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: RecF/RecN/SMC N terminal domain; TIGRFAM: recF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79164"
FT                   /db_xref="GOA:E1R6N2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N2"
FT                   /protein_id="ADK79164.1"
FT                   /translation="MGFLALKTYQYRNLKDAEVCLDAPRVFLVGENGQGKSNLLEAIYL
FT                   LSFGSSFRTRRDQELIRRGCGELALHGKTAEHDISFLLSGKNGTTKSIKLDGKPVTDRK
FT                   ELVRIFPAIVFCHDDISFVNGSPERRRWFFDQTMSLHEPLFIDTLRSYRKILKLRNMAL
FT                   KEDRRDLLDVYDIQLARAGMEIQEKRREAIEGFNTTFSSLHEKVSGLEGEMKIAYRPSW
FT                   KGCKGEEDVGVLLHRRRESDLEMKTSGSGPHRDRFAFLLEGRDFSSIASTGQLRLLSLL
FT                   LRVGQARFFYEKCGRRPVLLLDDVLLELDPRRRQRFLGTLPEADQIFFTFLPDRQYSEL
FT                   KGNDTMLLRVKEGEFIEE"
FT   gene            3965..4435
FT                   /locus_tag="Spirs_0005"
FT   CDS_pept        3965..4435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="InterPro IPR007922; KEGG: vpr:Vpar_0005 protein of
FT                   unknown function DUF721; PFAM: protein of unknown function
FT                   DUF721; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF721)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79165"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N3"
FT                   /protein_id="ADK79165.1"
FT                   /translation="MKKASEILSQFFDQAQLEKAQKYSSFFRSWRTIVGIDIASHTRVR
FT                   EIERDVLIVEADHPGWAQMIELKKRRILRDINKKYPEFSLSNIRVWIVQQLGAVYPVER
FT                   EEGNRNEWHYEPPVFGEKEKNERKSAGDDGRLQQMLDSIGKMVKGSERDNRH"
FT   gene            4517..4672
FT                   /locus_tag="Spirs_0006"
FT   CDS_pept        4517..4672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0006"
FT                   /product="ribosomal protein L34"
FT                   /note="InterPro IPR000271; KEGG: btu:BT0440 50S ribosomal
FT                   protein L34; PFAM: ribosomal protein L34; SPTR: 50S
FT                   ribosomal protein L34; TIGRFAM: ribosomal protein L34;
FT                   PFAM: Ribosomal protein L34; TIGRFAM: ribosomal protein
FT                   L34, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79166"
FT                   /db_xref="GOA:E1R6N4"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N4"
FT                   /protein_id="ADK79166.1"
FT                   /translation="MKRTYQPSRVKRNRKFGFRARMKTRGGRLVLARRRKKGRKKLSVA
FT                   DEKKPY"
FT   gene            4683..5030
FT                   /locus_tag="Spirs_0007"
FT   CDS_pept        4683..5030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0007"
FT                   /product="ribonuclease P protein component"
FT                   /note="InterPro IPR000100:IPR020539; KEGG: tde:TDE2399
FT                   ribonuclease P protein component; PFAM: ribonuclease P
FT                   protein; SPTR: Ribonuclease P protein component; TIGRFAM:
FT                   ribonuclease P protein component; manually curated; PFAM:
FT                   Ribonuclease P; TIGRFAM: ribonuclease P protein component,
FT                   eubacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79167"
FT                   /db_xref="GOA:E1R6N5"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N5"
FT                   /protein_id="ADK79167.1"
FT                   /translation="MKHSADIGRVFSSRTRVSCLGAKLMYRTNNTERNRFTVTLVRKYG
FT                   NAVQRNRAKRVAREAYRLIKPEIRQGYDMVLLLYRSEDTLSNRSRQLSDLLHKAQLLGK
FT                   RHPLFLSIKDQ"
FT   gene            5039..6796
FT                   /locus_tag="Spirs_0008"
FT   CDS_pept        5039..6796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0008"
FT                   /product="membrane protein insertase, YidC/Oxa1 family"
FT                   /note="COGs: COG0706 Preprotein translocase subunit YidC;
FT                   InterPro IPR001708:IPR013308:IPR019998:IPR020001; KEGG:
FT                   tde:TDE2396 putative inner membrane protein translocase
FT                   component YidC; PFAM: 60 kDa inner membrane insertion
FT                   protein; SPTR: Inner membrane protein OxaA; TIGRFAM:
FT                   membrane protein insertase, YidC/Oxa1 family; membrane
FT                   protein insertase, YidC/Oxa1 family domain containing;
FT                   PFAM: 60Kd inner membrane protein; TIGRFAM: membrane
FT                   protein insertase, YidC/Oxa1 family, C-terminal domain;
FT                   membrane protein insertase, YidC/Oxa1 family, N-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79168"
FT                   /db_xref="GOA:E1R6N6"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N6"
FT                   /protein_id="ADK79168.1"
FT                   /translation="MDKRTLLAVILSTIVISVGFMIQNTFFAPPLPESPAVTEQAEASG
FT                   NTNASDGSVSSNDNSQQQPTAPVLQAQGIIPFGDEPGEKMVSLDTKVFKATFSSRGALL
FT                   TSMKLKEHFENGEPLEMIWRGNDAEGAFGISFGGPEREIAHVPFFVRNIDENTLEFYRE
FT                   FAVQTSSGPVPFTLTKRFRFNPSDYLFEVLVKIENSVNAYPALDEDGYAYTLSFGPQIG
FT                   PQVEKMDGRYAYRRYFTYENGKQKNYRMKNGSVSVDNRVSWAAVLGKYFAVIGVPDATD
FT                   YDLLFTEGSEPGLPTTSRLFFSRPPLKSSVSEDVFRFYMGPKISRVLTQYNDPDKNGFG
FT                   TRDLHLEEVMDQGRLLGWLEVIMKKLLVFFYSIIPNWGVAIILLTILVKVVLFPITHKS
FT                   YESTSKMQMLQPKMKEIQDKYRDNPNKMNQEMAELYKREKVNPMGGCLPMLLQMPMFIA
FT                   MYGLFNKYFDLRGSSFIPGWITDLSSPESVYSFAPFKIPILGWSDIRLLPMFFVATMIL
FT                   SSKMTQSPSSAGSQNSSMKMMTYMMPIFFFFFLYNAPSGLLVYWIVTNVLTIGQQKAIS
FT                   KIQKRKEEG"
FT   sig_peptide     5039..5122
FT                   /locus_tag="Spirs_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            6836..7519
FT                   /locus_tag="Spirs_0009"
FT   CDS_pept        6836..7519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0009"
FT                   /product="single-stranded nucleic acid binding R3H domain
FT                   protein"
FT                   /note="COGs: COG1847 RNA-binding protein; InterPro
FT                   IPR001374:IPR004088; KEGG: tde:TDE2395 Jag protein,
FT                   putative; PFAM: single-stranded nucleic acid binding R3H
FT                   domain protein; SMART: single-stranded nucleic acid binding
FT                   R3H domain protein; SPTR: Protein jag; PFAM: R3H domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79169"
FT                   /db_xref="GOA:E1R6N7"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N7"
FT                   /protein_id="ADK79169.1"
FT                   /translation="MVKEFEGKTEKEAIDNAVSALNIDREEFDVEIVESVKGGLFRKGA
FT                   VKIRVFIEDDDDGFDVGDRYSEDVDPQAQDDFEKASVTFLETLIEKMGFPGTVSINFRE
FT                   EKKIGLTIDSQHSGILIGKKGKNLDALQLLVNVYCGKLHEGRRVIVDAENYRSRHEESI
FT                   IRLADRTAAQVRKTKRSRLLEPMNPFERRLVHTTLNDIDDVETRSEGEGLYKQVRIIYK
FT                   GSANY"
FT   gene            7607..8773
FT                   /locus_tag="Spirs_0010"
FT   CDS_pept        7607..8773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0010"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG0192 S-adenosylmethionine synthetase;
FT                   InterPro IPR002133; KEGG: tde:TDE2470 S-adenosylmethionine
FT                   synthetase; PFAM: S-adenosylmethionine synthetase; PRIAM:
FT                   Methionine adenosyltransferase; SPTR: S-adenosylmethionine
FT                   synthetase; TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase, C-terminal domain;
FT                   S-adenosylmethionine synthetase, central domain;
FT                   S-adenosylmethionine synthetase, N-terminal domain;
FT                   TIGRFAM: S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79170"
FT                   /db_xref="GOA:E1R6N8"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N8"
FT                   /protein_id="ADK79170.1"
FT                   /translation="MDTKRKVLFTSESVSEGHPDKVCDQISDAVLDACLREDSTSRVAC
FT                   ETFTTTGMVLVGGEISTSTYVNLQDVVRGVVKRIGYDRPEYGLDWESMAVIDTIHNQSS
FT                   DISMGVTAGENKYKSQGAGDQGMMFGFACNETEELMPAPIIFAHRLLQKAAAVRKSGEC
FT                   SWMRPDAKSQVTVQYEGGKPVRIDTIVISHQHSPSVSIKEIEASLRKRVIEPVLGDTGL
FT                   IDEKTRFFINPTGRFVIGGPHGDSGLTGRKIIVDTYGGMGRHGGGAFSGKDPSKVDRSA
FT                   AYMARYVAKNIVAAGLCDRCELELSYAIGVPFPISVMVDTFGTATVPEERIEAAVEKVF
FT                   DLSPEGIIRELGLLAPIYEATAAYGHFGRDGFSWERVDKTEELKKAVG"
FT   gene            8785..9717
FT                   /locus_tag="Spirs_0011"
FT   CDS_pept        8785..9717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0011"
FT                   /product="protein of unknown function DUF340 membrane"
FT                   /note="COGs: COG2431 membrane protein; InterPro IPR005642;
FT                   KEGG: vvy:VV1444 hypothetical protein; PFAM: protein of
FT                   unknown function DUF340 membrane; SPTR: Putative
FT                   uncharacterized protein; PFAM: Membrane protein of unknown
FT                   function (DUF340)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79171"
FT                   /db_xref="GOA:E1R6N9"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N9"
FT                   /protein_id="ADK79171.1"
FT                   /translation="MEGIVSLLILLAFLGGGMMCAKSTFAPKPKGVTCIIAVILRILLL
FT                   FMGIRIGRLGMNIREVQTIGLLGLVFGSATIFGTVLFLIILNGLSGGNESKHKRGRSES
FT                   RRPSAKRLLWESLGLFAFVIVGIVAGKILPFASLIPNEAGTWTLYCLLFFIGMQMMQSD
FT                   IKFVSLLRDRRMLLLPLVTALGSICGGIMVSPLFHLSVGEAAALSAGFGWYSLSGVLIS
FT                   DLGNPLLGSAAFLVNLVRESLALFMIPLLGGLGLPHLAIGVGGATSMDVTLPLVETSCG
FT                   AGYVPLSIAHGALLSLLVPFLVPFFWGFA"
FT   gene            complement(9730..10791)
FT                   /locus_tag="Spirs_0012"
FT   CDS_pept        complement(9730..10791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0012"
FT                   /product="metallophosphoesterase"
FT                   /note="InterPro IPR004843; KEGG: cch:Cag_0430 hypothetical
FT                   protein; PFAM: metallophosphoesterase; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79172"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P0"
FT                   /protein_id="ADK79172.1"
FT                   /translation="MNKQFYHLKLEELYTKAKEIEIHDNQRFVIFSDLHVGNGKYGDDF
FT                   RPNAKLFQTALHDYYYEKGYTLILNGDIEELHRYTLAEIRSTWKSLYSLFDAFDAENRL
FT                   YKLSGNHDSKLFNLPGEPLRYKLYESLKLNYKGMTLFLFHGHQPSYFYEKFNEISGLLL
FT                   RFIAKPLRIKHYSVAHDKGRRFKIEKRTYEFSIEKNIVSIIGHTHRPLFESLSKLDSLK
FT                   YKIENLLRRYAKSGDEKQKFLEKQIEEIKKEIDKSIMTKGKEQAISSLYSSQTLAPSVF
FT                   NSGCVIGKRGMTAIEIKGGKISLVHWFNEDVDEKYRKNDGKNTSQLDNTGFFRTVLKRD
FT                   SLDYIFTKIRLLT"
FT   gene            complement(10866..11339)
FT                   /locus_tag="Spirs_0013"
FT   CDS_pept        complement(10866..11339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0013"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="COGs: COG1762 Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type); InterPro
FT                   IPR002178; KEGG: cca:CCA00348 PTS system,IIA component;
FT                   PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; SPTR: PTS system,IIA
FT                   component; PFAM: Phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79173"
FT                   /db_xref="GOA:E1R6P1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P1"
FT                   /protein_id="ADK79173.1"
FT                   /translation="MVTLCRLIGKNGICQLSKTNKSQAILELISHARQFANKPWADDFY
FT                   CEVMRKELLQSTGLGKGIAVAHGTCQGIDQVYVALGISQEGIEYDAIDSQPVHLLFLVA
FT                   NPPETQLEYLSALSTLVRLLRNDSFREKIMHCVTAEQVYLLFKQRGCTIPIRT"
FT   gene            11411..11728
FT                   /locus_tag="Spirs_0014"
FT   CDS_pept        11411..11728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0014"
FT                   /product="ferredoxin"
FT                   /note="COGs: COG0633 Ferredoxin; InterPro IPR001041; KEGG:
FT                   lic:LIC12506 adenylate/guanylate cyclase; PFAM: ferredoxin;
FT                   SPTR: Adenylate cyclase; PFAM: 2Fe-2S iron-sulfur cluster
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79174"
FT                   /db_xref="GOA:E1R6P2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P2"
FT                   /protein_id="ADK79174.1"
FT                   /translation="MATLIVEGYDRLITASPAISLLNTLLREGIPISHLCGGKAQCGTC
FT                   RVKILDGESFCSPMGERERLRLSGKEGTLPESVRLACQTYIRGRVVVRILASGRSLDKK
FT                   E"
FT   gene            11795..12805
FT                   /locus_tag="Spirs_0015"
FT   CDS_pept        11795..12805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0015"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843:IPR001761; KEGG: sth:STH770 LacI family
FT                   transcriptional repressor; PFAM: periplasmic binding
FT                   protein/LacI transcriptional regulator; regulatory protein
FT                   LacI; SMART: regulatory protein LacI; SPTR: LacI family
FT                   transcriptional repressor; PFAM: Bacterial regulatory
FT                   proteins, lacI family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79175"
FT                   /db_xref="GOA:E1R6P3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P3"
FT                   /protein_id="ADK79175.1"
FT                   /translation="MKKQTINDVARLSGVGKATVSRVFSGSPLVSEATRERVLETAREI
FT                   GYHPNPVARALTTAKTGNITIVLPSLQSFVMSQIVRGAMFAANKNGYSLFVLDSGEDSD
FT                   KSGADYSDLLHEHASDGVIFCYESARQQMESVSLRRPVLFLESTPTKESLDCIRTDNRT
FT                   GMRLLVEYLFELGHKRIAAVFGRRSPYSENRYIHFIAAMEGVGLPVTEDHLLFSNWAIE
FT                   DGYRDFRSLMGLPFSSRPSAIVFISDFMATGALRAAADMGIAVPDEVSIAGTDDAETSA
FT                   FLIPGLTTLGFDPHGLGEKAVEQLIRRIQYPDEEALHLVVPVTLRKRGSTGPVKW"
FT   gene            13031..14173
FT                   /locus_tag="Spirs_0016"
FT   CDS_pept        13031..14173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0016"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="COGs: COG1454 Alcohol dehydrogenase class IV;
FT                   InterPro IPR001670:IPR018211; KEGG: lsp:Bsph_4187
FT                   NAD-dependent methanol dehydrogenase; PFAM: iron-containing
FT                   alcohol dehydrogenase; SPTR: Putative uncharacterized
FT                   protein; PFAM: Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79176"
FT                   /db_xref="GOA:E1R6P4"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P4"
FT                   /protein_id="ADK79176.1"
FT                   /translation="MKKAILNLPTALYCGRGCRSGLAECIPQEAKVALVTDKGLVGAPP
FT                   LDLVTTIFDEADISWKLISDIDPNPDEETVLRVVKAVKAMQADVIVAIGGGSPLDTAKA
FT                   AACMARNDGPLSDYQWEGKPFVNAPLPLYALPTTAGTGSEVTGVAVITSRNMKKGINAR
FT                   EIFPKAAFVDPELMIGLPPYLTAITGMDALTHAIEAYVGLGANPFSDALCEKAIELIAD
FT                   HLPRAFSYGGDIEAREAMGTASSLAGLAMDQAGLGIVHSLSSPVCAYLHVSHGLANAML
FT                   LPHGMRYNLPARHEKFAVVAELMGYDTTGMTPRDAAEAAVVAVEDLLEELELGSAIEEV
FT                   VHNAVDFEEFGNNASKMFLIRNNPRGADSKACRSIFETIF"
FT   gene            complement(14170..14577)
FT                   /locus_tag="Spirs_0017"
FT   CDS_pept        complement(14170..14577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0017"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="COGs: COG0229 Conserved domain frequently associated
FT                   with peptide methionine sulfoxide reductase; InterPro
FT                   IPR002579; KEGG: bpt:Bpet1710 methionine sulfoxide
FT                   reductase B; PFAM: Methionine sulfoxide reductase B; PRIAM:
FT                   Peptide-methionine (R)-S-oxide reductase; SPTR: Peptide
FT                   methionine sulfoxide reductase; TIGRFAM:
FT                   methionine-R-sulfoxide reductase; PFAM: SelR domain;
FT                   TIGRFAM: methionine-R-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79177"
FT                   /db_xref="GOA:E1R6P5"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P5"
FT                   /protein_id="ADK79177.1"
FT                   /translation="MESSSKMPHGESEWRDKLGPERYYVCRMKGTEAPFSGKLWDEHRK
FT                   GTYHCVGCGTPLFRSETKYDSGSGWPSFMDLIDQKRVERRTDSSHGMIRTELLCARCGC
FT                   HLGHLFEDGPQPTGLRYCINSVSLKFIAATS"
FT   gene            14633..15154
FT                   /locus_tag="Spirs_0018"
FT   CDS_pept        14633..15154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0018"
FT                   /product="nitroreductase"
FT                   /note="COGs: COG0778 Nitroreductase; InterPro IPR000415;
FT                   KEGG: bvu:BVU_2535 putative NADH dehydrogenase/NAD(P)H
FT                   nitroreductase; PFAM: nitroreductase; SPTR:
FT                   NADPH-oxidoreductase; PFAM: Nitroreductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79178"
FT                   /db_xref="GOA:E1R6P6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P6"
FT                   /protein_id="ADK79178.1"
FT                   /translation="MNQIIETILQRKSVRHYGAGEIPKEDLETIMRAGMAAPSGMNKQP
FT                   WAFVAVRDRQQLDMLGDALPYAKMLLQATAAVIVCGDLRTLSNEEAKLWVQDTSAATEN
FT                   ILLAAEALGYGAVWTAVYPEADRMKPVVEILGLPERVIPLNAIAVGQPLEDRDRPKNKW
FT                   KPEKIHYDRW"
FT   gene            complement(15219..16184)
FT                   /locus_tag="Spirs_0019"
FT   CDS_pept        complement(15219..16184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gem:GM21_3782 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79179"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P7"
FT                   /protein_id="ADK79179.1"
FT                   /translation="MKRVITVMILALLIAVPMFGQIQYSDLESSFATFADDVAEALPFA
FT                   AAATGLTWSDARVKGFPHFGIGLSVSAVTIPKEAFEDVATALGFELPSEITDSSLGVPL
FT                   PGYAVDARLGLPFIPFDIGAKFGYLTPSMGDALEGSTGLTAEYILAGLQVRYPLLKDRL
FT                   LIPAVSVGLGYTYLNGSVAMETTGMANQIDFPGGETLNIGNPDAVFAWKTHAIDLSVQA
FT                   SKSLLILTPYLGAGYSYGWSRAGGGVNADITGDVDAVEDNYDVEITDDGFVVYSDASGG
FT                   SFRAFGGLSFNLTILKLDLNAQYNFTTQSLGGGLNARIQI"
FT   sig_peptide     complement(16110..16184)
FT                   /locus_tag="Spirs_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            16325..17554
FT                   /locus_tag="Spirs_0020"
FT   CDS_pept        16325..17554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0020"
FT                   /product="uncharacterized flavoprotein"
FT                   /note="COGs: COG0426 flavoprotein; InterPro
FT                   IPR008254:IPR016440; KEGG: pca:Pcar_2284 uncharacterized
FT                   flavoprotein; SPTR: Uncharacterized flavoprotein; PFAM:
FT                   Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79180"
FT                   /db_xref="GOA:E1R6P8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P8"
FT                   /protein_id="ADK79180.1"
FT                   /translation="MQAIRIRDGIYRISANIGNKDLFEGIWPLPNGVSLNSYLVKGEKI
FT                   ALIDLVKDWDDAPGQIASQLASVGVSFDQIDYLIINHMEPDHTGWLRELREKNPKLQIL
FT                   ASKKSIPLIKNFYGIEEGVKAVSSGDSLDLGDGKTLFFEDTPNVHWPETMVTWERSSKV
FT                   LFSCDAFGSFGAMGNKAFHDELSASEKDFFDRETLRYYANIVSTFSPFVERAIKKLENL
FT                   EIDVVAPSHGPIWREEPEKIVEQYAQYASWMKGPALPEITFVWSSMYGNTQRMVEPVLE
FT                   GIRSEGVPVHVHRVPQEHVSFVLADAWRSTGIVLGMPTYEYKMFPPMAHVLDILDRSHV
FT                   QSRTAFRFGSYGWSGGAQKQLEEFTSSMKWNCMEALEFAGAPDADDLALGRERGAELAR
FT                   AVKKMCQADK"
FT   gene            17596..18168
FT                   /locus_tag="Spirs_0021"
FT   CDS_pept        17596..18168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_2057 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1393)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79181"
FT                   /db_xref="GOA:E1R6P9"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P9"
FT                   /protein_id="ADK79181.1"
FT                   /translation="MKIRAGQLLLERPGLIFILFLGMGINLVGYYIVYWLELPLFLDSM
FT                   GTFLAAAVLGPWLGAACGFFSNLLIGLIDNPVMIPFALVNIVIGIIVGLFSLHFRFRSL
FT                   FVVIIGALVSALVSSLLGTVITVFVFGGVSGGVIDAFVAGMATSGREIFSSTFLVRLPV
FT                   NIGDKLFSAFLIWIFLLLFPERWKGYA"
FT   gene            18168..19775
FT                   /locus_tag="Spirs_0022"
FT   CDS_pept        18168..19775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0022"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterPro IPR001638:IPR003594:IPR011495:IPR005467; KEGG:
FT                   rci:LRC120 signal transduction histidine kinase; PFAM:
FT                   histidine kinase dimerisation/phosphoacceptor; ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; extracellular solute-binding protein
FT                   family 3; SPTR: Multi-sensor signal transduction
FT                   multi-kinase; PFAM: Histidine kinase; Histidine kinase-,
FT                   DNA gyrase B-, and HSP90-like ATPase; Bacterial
FT                   extracellular solute-binding proteins, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79182"
FT                   /db_xref="GOA:E1R6Q0"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q0"
FT                   /protein_id="ADK79182.1"
FT                   /translation="MRNFFAVLFFSLVICVPEIFCLQNLTVVGGANGNVPYEYLDDKGR
FT                   PRGILVDVWDLWSKESGVEVSYLLVDNFKDVMDLAGNDASGPIVLAHDRIPGFSDDAGR
FT                   FEHGEVYYEVQPSIFYHKRISGIIRIEEMAGYVVGVAADSGIEAPLAEAYPSLVIRSYD
FT                   SRQALLAAVLSHQIHLFVGYPPSMIHQIGITGNARAFRSGKALSFSMPFAPVLVKGPKE
FT                   LLEDIQEGFSSMSPFARNLTIHRQTGFFRGWSIRWPLIAAVGLVLMVGLLFSLFWFWKL
FT                   QLDKRIRQATDALVEQRRQLEISRDALAHALREKEILLKEIHHRVKNNLQIISSLANLI
FT                   RNTGGTTDEGRDRFAELQSRVVSMAKVHEVIYTNEQFEQVPLRDLIKEISELLISSIGM
FT                   GLAIRLSVKCDNLAINVGDATAFSLIIHEAVANAIKHAFAPGRNNVLEILVREINNTVV
FT                   LCIKDNGAGFPAELDFDGKNHLGLFMIKQLATQLRGEFVLKNCGYEGSGAQITVEFPLP
FT                   EARFVGLPEENNRDYLRR"
FT   gene            complement(19760..20260)
FT                   /locus_tag="Spirs_0023"
FT   CDS_pept        complement(19760..20260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppu:PP_0636 cold shock DNA-binding
FT                   domain-containing protein; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79183"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q1"
FT                   /protein_id="ADK79183.1"
FT                   /translation="MKKYTIMFIIAAGMVFSSGSTLFAEGAQEDEDFRDNPYQTVTVSG
FT                   KIYASFSGFPELKGDDGKTYRLMFPMFLADSLELSNGESVSVEGFSAPANWRPTRNPSD
FT                   AVYLRLVKATIDGQTYDLSRFYGHMGPGGPGRFHEGWGCFESGYDDSNHMVPAPGMGGY
FT                   RRR"
FT   sig_peptide     complement(20189..20260)
FT                   /locus_tag="Spirs_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            20456..21319
FT                   /locus_tag="Spirs_0024"
FT   CDS_pept        20456..21319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0024"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="COGs: COG1737 Transcriptional regulators; InterPro
FT                   IPR000281:IPR001347; KEGG: cdl:CDR20291_1955 RpiR-family
FT                   transcriptional regulator; PFAM: helix-turn-helix protein
FT                   RpiR; sugar isomerase (SIS); SPTR: Putative uncharacterized
FT                   protein; PFAM: Helix-turn-helix domain, rpiR family; SIS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79184"
FT                   /db_xref="GOA:E1R6Q2"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q2"
FT                   /protein_id="ADK79184.1"
FT                   /translation="MDILEQIKSEYPNYNSTRKRIASFILENPTRCCFLSLKEFAEEAR
FT                   STEVTVLNFCRSLGLGRYVELKKALQSHVLIWTRPADRMKALASRSSDSNELFDQVVKS
FT                   EQKALRSTFEHNGPKQILSFIQMIRKARRVFVAAHGASRIFSSVITYRLSLLGVDISEL
FT                   DMDNPHKTIFRLLSCNPEESLLIAIATPPYGKNTIATTRMCRSRGISVVTITDSTLSPL
FT                   VSMAETALICPTELMGLTNSPTSIMAIIDIIAVLFLAEKQEDEFSHQEDLAQQYEHYLK
FT                   LFNSEL"
FT   gene            21403..22392
FT                   /locus_tag="Spirs_0025"
FT   CDS_pept        21403..22392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0025"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: fnu:FN0397 peptide ABC transporter permease; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Putative uncharacterized protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79185"
FT                   /db_xref="GOA:E1R6Q3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q3"
FT                   /protein_id="ADK79185.1"
FT                   /translation="MWKYILKRLLMMIPVLIGVTFIVFFIMALTPGDPAAIILGDQASA
FT                   EALALKRIELGLDKPIPIRYLNYVNDMFHGDLGTSYKNQIKVWDQVWDKFPNTAILAVA
FT                   GILVALLIGIPIGILSAKKQYTFMDNSSMVLSLIGVSMPNFWLGLLLSLFFALKLGWLP
FT                   SQGMGTGFFPLLRSLVLPAITLGTGAAATVVRMTRSSMLEVIRQDYISTARAKGLSEKA
FT                   VTRHHMLKNAMIPIVTAVGLQFGQLLGGAMLTETIFSWPGLGRLMVDSITSKDIPMVLG
FT                   AVIFMAVMFSFVNLLVDIIYAFIDPRIKSQYDKAGVKRIGFRKRSIAA"
FT   sig_peptide     21403..21486
FT                   /locus_tag="Spirs_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            22389..23273
FT                   /locus_tag="Spirs_0026"
FT   CDS_pept        22389..23273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0026"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: fnu:FN0398 peptide ABC transporter permease; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Putative uncharacterized protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79186"
FT                   /db_xref="GOA:E1R6Q4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q4"
FT                   /protein_id="ADK79186.1"
FT                   /translation="MSSGPKARSLWKETWRRLKKNRLAVAGMLFLITLVLIAIATIVID
FT                   LVMHNAIYNDYVIKQNLRLRLKGPSPEHIFGLDEFGRDIFLRMIWGIRYSLFMGTIAIA
FT                   LSTIAGGILGAIAGYYGKATDNIIMRFMDVLLAIPSMLLATAIVAALGTSLTNLLLAIA
FT                   ISYVPTFARTVRASVLTIKDQEFIEAARALGAGDGRIIFKYIIPNSLAPLIVQATLGVA
FT                   GAILSIAGLSFLGLGIQPPTPEWGSMLSSARSYIREGWHITVIPGLGIMLTILALNVMG
FT                   DGLRDALDPHLKN"
FT   sig_peptide     22389..22508
FT                   /locus_tag="Spirs_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            23285..24262
FT                   /locus_tag="Spirs_0027"
FT   CDS_pept        23285..24262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0027"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component;
FT                   InterProIPR010066:IPR003593:IPR003439:IPR013563:IPR 017871;
FT                   KEGG: fnu:FN0399 peptide ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Putative uncharacterized protein;
FT                   TIGRFAM: oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter; Oligopeptide/dipeptide
FT                   transporter, C-terminal region; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATP-binding
FT                   protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79187"
FT                   /db_xref="GOA:E1R6Q5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q5"
FT                   /protein_id="ADK79187.1"
FT                   /translation="MDEPLLTVDNLTVNYETDDGIVQALNGVSISVGQGETLGLVGETG
FT                   AGKTTLARGIMRLVPSPPGKIKSGSIMFEGRDLLKLSEAEMRTVRGKSVSMIFQDPMTS
FT                   LNPILSIGEQIQEVIATHNRELSKEKLRKQANDMLELVGISADRAHEFPHQFSGGMKQR
FT                   VIIAIALACNPKLLIADEPTTALDVTIQAQVLDMIRTLKEKMNTAMLLITHDLGVVAQN
FT                   CNRVAVIYAGEIVEMGTIRQIFKNPTHPYTIGLLESIPSLAKKEVHRLNPVKGMMPDPT
FT                   NLPVGCKFNPRCKHAFEPCYGKVPPLTDIGAGQLVRCYLAKERG"
FT   gene            24264..25232
FT                   /locus_tag="Spirs_0028"
FT   CDS_pept        24264..25232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0028"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component; InterPro
FT                   IPR010066:IPR003593:IPR003439:IPR013563; KEGG:
FT                   aco:Amico_0787 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Oligopeptide transport ATP-binding
FT                   protein AppF; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter;
FT                   Oligopeptide/dipeptide transporter, C-terminal region;
FT                   TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79188"
FT                   /db_xref="GOA:E1R6Q6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q6"
FT                   /protein_id="ADK79188.1"
FT                   /translation="MAEKQEILRVEHLKKYFDTPSGSLHAVDDLSFSINKGETLGVVGE
FT                   SGCGKSTLGRTILRLHEPTSGNIWFEGREINSCNKREMKNLRKHMQIIFQDPFASLNPR
FT                   MTVGETISESLLIQKLVGRKDKAKLEKEVTELMDMVGIAPRLINSYPHELDGGRRQRVG
FT                   IARVLALRPQFIVCDEPVSALDVSIQAQVLNLMQDLQEEFGFTYLFITHDLSVVKHLSN
FT                   EILVMYLGKMVEKAPASALFANPLHPYTQALLSAIPVPDPDFPVSRILLEGELTSPIDP
FT                   KPGCRFARRCPKATEACLKGDIPFIEVEPNHFAACIMIGKT"
FT   gene            25281..26810
FT                   /locus_tag="Spirs_0029"
FT   CDS_pept        25281..26810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0029"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COGs: COG0747 ABC-type dipeptide transport system
FT                   periplasmic component; InterPro IPR000914; KEGG: fnu:FN0396
FT                   dipeptide-binding protein; PFAM: extracellular
FT                   solute-binding protein family 5; SPTR: Putative
FT                   uncharacterized protein; PFAM: Bacterial extracellular
FT                   solute-binding proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79189"
FT                   /db_xref="GOA:E1R6Q7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q7"
FT                   /protein_id="ADK79189.1"
FT                   /translation="MKKALTCLLFLLIACSFVFANGASEASAASGGYKDTITFAQGADV
FT                   TSFDPHIGKETPAVAVTNHIYDTLVDIDSVSGEVVPQIAERWEQISDVSYRFFIRKGLK
FT                   FHNGEDLTADDVKFSLDRAIASAAVSYIVDFIKDVKIEDDYTVVVTTKAPYAPALRNLA
FT                   VPFAAIVPKDYVEANPDILKTKPVGSGPYKFVSWAQSDSCKLEAFDDYYAGAPKTKYLV
FT                   MKVIPEAAQRTIALETGEVDLSYDILTSDLKRVRENEKLTLYEAPSLTCFYISMNMRKK
FT                   PFDNKLVRQAINYAIDRQLLVDTVNSGTGAPADAIIAPAVFGYYSPGQYDYNPEKAKKL
FT                   LAEAGYPNGFSCSLWVNNNQTRVEMCQAIQEMLREVGITCKIEVMEFGAFISRSTSGEH
FT                   DMAYFGWVTSTKDADYTYYSLEHSSQQGAAGNRTFIADPEVDRLIELARTNTDTDTRRE
FT                   AYKDLAILLKDIANNAPIIYTAITAGSSNKVENFALDPIGYHKLEGVTVHN"
FT   sig_peptide     25281..25340
FT                   /locus_tag="Spirs_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            26872..27633
FT                   /locus_tag="Spirs_0030"
FT   CDS_pept        26872..27633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0030"
FT                   /product="Creatininase"
FT                   /note="COGs: COG1402 Uncharacterized protein putative
FT                   amidase; InterPro IPR003785:IPR019775; KEGG: aco:Amico_0022
FT                   creatininase; PFAM: Creatininase; SPTR: Putative
FT                   uncharacterized protein; PFAM: Creatinine amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79190"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q8"
FT                   /protein_id="ADK79190.1"
FT                   /translation="MLLSEMTWPQAEKYFKESDLVIIPIGSIECHGKHMPLGTDTLIPD
FT                   KIIELLRRQEDRFLIAPTIPYGACESLYPFPGTVNLGTDLLYELMKTIVENLKRHGAKK
FT                   FVVLNGHGGNIKALERIGYELDADGCLMAILNWWLNVWEMNPEWKGGHGGGEETAAVMA
FT                   IDPDLVDRSYIDLPLEITDLSDTIKGSGFNTVQYDNITVTIPRLTNHVTSNGWIGPDHP
FT                   KYATVEWGSEMLQTFTNFMVSFLKEFEKVEL"
FT   gene            27640..28716
FT                   /locus_tag="Spirs_0031"
FT   CDS_pept        27640..28716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0031"
FT                   /product="Glutamyl aminopeptidase"
FT                   /EC_number="3.4.11.7"
FT                   /note="COGs: COG1363 Cellulase M and related protein;
FT                   InterPro IPR008007; KEGG: efa:EF2724 M42 family peptidase;
FT                   PFAM: peptidase M42 family protein; PRIAM: Glutamyl
FT                   aminopeptidase; SPTR: Putative uncharacterized protein;
FT                   PFAM: M42 glutamyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79191"
FT                   /db_xref="GOA:E1R6Q9"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q9"
FT                   /protein_id="ADK79191.1"
FT                   /translation="MDKQASIRRIQRLSDANGISGFEDAVVELIRQEAEDLGNFSEDSL
FT                   RNLYLERSGNGKDRPVLLLDAHTDEVGFMVKAIRPDGMLEFITIGGWVPFNIPAHLVRV
FT                   RNRDGLYIPGVVASKPPHFLTEAERKAPLEVRDLVIDVGASSAEEIEHEYLIEIAAPVV
FT                   PDAHCSYDEVHDILMGKAFDNRLGCAAVVSAMEELRGDELPLNIVGAFASQEEVGTRGA
FT                   AVTAQRVTPDLAIVFEGCPADDTVVPAYQAQTVLKRGPMLRHIDARMITNPRFQRYALD
FT                   IAKREAIPVQRAVRTGGATNGAPIHLSNQGVPAIVVGIPVRYAHTHYGISSYSDFAHGV
FT                   ELAVKIIRNITHDIIAGF"
FT   gene            28718..29767
FT                   /locus_tag="Spirs_0032"
FT   CDS_pept        28718..29767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_4032 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79192"
FT                   /db_xref="GOA:E1R6R0"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R0"
FT                   /protein_id="ADK79192.1"
FT                   /translation="MGIGRMFPLEAVGNKRQEYPASLGSDVCFCMSGRCAIYACLLDFL
FT                   PSDSRRVVYAPAYTCETVLASYLKAGYSCRFYDIDPEGLRPRFREEELDEVSLLSLCGY
FT                   YGVSTYDREFVRRCAERGIVIIHDTTHTPFQPDPAADYIAGSMRKWMGIACGGIAAKRK
FT                   GHFSISPLPVDPEHLAGRYASLELAGKAQKGDLHASSEASSVFWETELALRKSFDAYGS
FT                   DEQSRRILEYYPYDDMIARRRANYGLLLGLLGPPTGWAPVFPLLPENATPSHFSLYADD
FT                   REDLRSFLAQRDVATTVYWPIPPMIGDISSYPGAEWIYNHICSIQIDQRYGAEDMRLLA
FT                   SCLNAYSRI"
FT   gene            complement(29771..31648)
FT                   /locus_tag="Spirs_0033"
FT   CDS_pept        complement(29771..31648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0033"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004090:IPR003660:IPR004089; KEGG: dde:Dde_0347
FT                   methyl-accepting chemotaxis sensory transducer; PFAM:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein; SMART: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SPTR:
FT                   Methyl-accepting chemotaxis sensory transducer; PFAM: HAMP
FT                   domain; Protein of unknown function (DUF3365);
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79193"
FT                   /db_xref="GOA:E1R6R1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R1"
FT                   /protein_id="ADK79193.1"
FT                   /translation="MTRFKDIPITAKILTITLLGIVTLSVIFSVVFTNAIGSQAEKAIL
FT                   EKSHAVVYTAEAARENMAHKINMGVIRNFDDLAAEGDRDKLLEAVPIITAISIAKENAE
FT                   KANYQFRVPKVSPRNPENEPTELEAKVLEELKAKGLEEKVIYEENQIRYFRPIKLTQEC
FT                   LLCHGSPAGTPDPIGGIKEGWQVGEIHGAFEIISSLEAAKATTTKAAIQITLLSLSIMF
FT                   LLGLFLWFSIKMITRPLKDYIQNFEAVSAGDLTVSSGVDSRDEIGQLSDYFNKFVSSLH
FT                   GMILDIGKVTRNTRSISEDLASSSTETAAAVEEIRANSDQMKNQMHHLDKEVHSSKSSA
FT                   DEVRVFIQRVNEQIQSQASAITESSASIEEMSASINSIAHSSAEKLKIAEELEHTSEQG
FT                   SSEMGITREVMKKVAESADVMMEMIEVIDAIASQTNLLAMNAAIEAAHAGEAGKGFGVV
FT                   ADEIRNLAESSSNSAKEISKSLKEVIENISVTDKSTERTGEMFDRMLQMIKEVSRSMNE
FT                   MQNATQELSIGSGQIVEALGSLVQITQDVQNSSGEMDQKVAAITSSLETLQNISAESTA
FT                   GMEEMALGILEIAQAAQNVSNAGDQNSGSVRELEELVARFQVREEKNEE"
FT   sig_peptide     complement(31544..31648)
FT                   /locus_tag="Spirs_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(31684..33150)
FT                   /locus_tag="Spirs_0034"
FT   CDS_pept        complement(31684..33150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0034"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /note="COGs: COG2195 Di- and tripeptidase; InterPro
FT                   IPR001160:IPR002933:IPR011650; KEGG: bfs:BF3079 putative
FT                   aminoacyl-histidine dipeptidase; PFAM: peptidase
FT                   dimerisation domain protein; peptidase M20; PRIAM: Xaa-His
FT                   dipeptidase; SPTR: Aminoacyl-histidine dipeptidase;
FT                   TIGRFAM: aminoacyl-histidine dipeptidase; PFAM: Peptidase
FT                   family M20/M25/M40; Peptidase dimerisation domain; TIGRFAM:
FT                   aminoacyl-histidine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79194"
FT                   /db_xref="GOA:E1R6R2"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R2"
FT                   /protein_id="ADK79194.1"
FT                   /translation="MNNNPLEGRKPASVWHYFQTISKIPRCSCNEAAVRDYVRQFAEEH
FT                   HMAWKIDAAGNIAVKKGASVGKEAHPGVVLQGHLDMVCEKNRTTKHDFTVDPIKLVVDG
FT                   DWLKADGTTLGADNGIAVAMALAVLASDEISHGPIEVLFTVDEETGLTGAMGLDPSIIE
FT                   GKILLNLDSEEPGVFYIGCAGGVNTEGMLPITSEAVPQGRVCYTLTIEGLQGGHSGGEI
FT                   HLGRGNAIDLVGRLLWELRKLGDFNLVSINGGGKHNAIPRECHARFTLSKEKVAEAEKL
FT                   AKTIGREIKAELGDNAPGFNLIFEKDTEADEQFDPSSTDRICYMLRIMPHGVAAMSRSI
FT                   EGLVETSTNFAAIETQKDCCSTTVKVLTSQRSSIMSALDDIAAKVNAAICVVGGQVRHY
FT                   SRYPAWTPNPNSKLLAECKRIYRDFTGEEAVHAAIHAGLECGVIGDKLEGMEMISFGPE
FT                   MLGVHTPEERLNIPSVEKLWGFLIKLLENV"
FT   gene            33396..34613
FT                   /locus_tag="Spirs_0035"
FT   CDS_pept        33396..34613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0035"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647; KEGG: reh:H16_B0715 TetR/AcrR
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   TetR; SPTR: Transcriptional regulator, TetR/AcrR-family;
FT                   PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79195"
FT                   /db_xref="GOA:E1R6R3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R3"
FT                   /protein_id="ADK79195.1"
FT                   /translation="MTDKQKRRREEIIETAFRVWSESSFKKTSLSAVATRMGISKTALY
FT                   RYFSGKEALLQAMEEYFLRLYNHLCDEVIRHRDERSVAEALEAYNRIFVGFFARNSHYL
FT                   RFAQIRFIRKPQVGDSFLAMTFRRNMDLFPAEPLAREFGWRMAQIPVIVRYILSVSNFL
FT                   LAVEHCGNEEIAGGAESLLEVNRRLIISGISLNRDRQIPDFQMIEERCILSEGDFPETD
FT                   RVTYAVSEVVAENGLWNTTVEKIAHRLGMSKSSLYFYFENRDEMLWKLIEQERQAFGAL
FT                   VIRDIEPMESFSDQLYAYFVLHARYLWGRPEFLATMNWYRFQDIAFHPPEDPISSVIRF
FT                   YRFVEEAVEAGVMSEKVPLLSFLRLLNFLLMQELSEHFRRGNDFNQLFPILRTLHQLLL
FT                   YGVQGA"
FT   gene            34617..36143
FT                   /locus_tag="Spirs_0036"
FT   CDS_pept        34617..36143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0036"
FT                   /product="outer membrane efflux protein"
FT                   /note="COGs: COG1538 Outer membrane protein; InterPro
FT                   IPR003423; KEGG: bga:BG0143 hypothetical protein; PFAM:
FT                   outer membrane efflux protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Outer membrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79196"
FT                   /db_xref="GOA:E1R6R4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R4"
FT                   /protein_id="ADK79196.1"
FT                   /translation="MKHAWFLLCAAMLFPAALFAGGSRESGTDTDFSSLDELKEFATPS
FT                   LDENAIERAVNSQAPADIADGAGEAALLSRERMRQKEELTVDVEKAVGLAREYNLSLKS
FT                   SQLGLVKKRRALSTVWNSFLPTLQVSTTLKRMNEAPTSFDFTTFSAYELSRWNQSFGVD
FT                   ANLYLNLALFDGITATRLNYESGLVDYEQARKQLERDVRKNFYNLLLMQQNRDLFVQQI
FT                   AAAKDRYDQARINYQNGLVPELTMLSARVAWENLKPTLESMDLSYDQALSGFKMTLGLS
FT                   QDTELHLDGEISADPIALEADPLIDQYLTGRLDIKSLLYNLKNLDVQRRATISQAFTPG
FT                   LTVGWSYDPTMNDPFGGDYFNSDSWDQQSGMFRITVAMNLEGFLPGSKTKVELAGIEDD
FT                   KRSLRLSLMQAIEGAEMEIDSLVKQLNHSKNSMDSLKLNIELADQAYRMAEEAYRAGSR
FT                   ELLEVQNAEIELNNAKYELLKEKYNYVTGLLDLEYALNTTLDKIKEGNDE"
FT   sig_peptide     34617..34676
FT                   /locus_tag="Spirs_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            36136..37101
FT                   /locus_tag="Spirs_0037"
FT   CDS_pept        36136..37101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0037"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="COGs: COG0845 Membrane-fusion protein; InterPro
FT                   IPR006143; KEGG: btu:BT0141 acriflavin resistance
FT                   periplasmic protein; PFAM: secretion protein HlyD family
FT                   protein; SPTR: Acriflavin resistance periplasmic protein;
FT                   TIGRFAM: efflux transporter, RND family, MFP subunit; PFAM:
FT                   Biotin-requiring enzyme; TIGRFAM: RND family efflux
FT                   transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79197"
FT                   /db_xref="GOA:E1R6R5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R5"
FT                   /protein_id="ADK79197.1"
FT                   /translation="MNRKTAGLLLMLFALLIFVTGCDKLPGRGNKENATEAGSEKDADE
FT                   NTETVFAVSVTEAVTGQIYNYLNVNGDVVSKTTVDTYPDVAGKVSRILVAVGDTVRKNQ
FT                   VVAEVDPSKPGMNYAASPVKAAITGTITSIPVEVGSMVSQQSPIVRISRMDELQIKTYV
FT                   AERFISRMKLGQQALVSLDAFPGKTFMAKVVELSPMVDASSRTMDLKLDFVGSTDGVRA
FT                   GMFAKIKIITEDKEGVVKIPSAAVIERFGEDYVFVIKDESSVERRKVTAGIEIDGKQEI
FT                   LEGLSGGETTVIRGQTLLEDGSLVKVVQKVEPLPVKDSID"
FT   sig_peptide     36136..36198
FT                   /locus_tag="Spirs_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            37116..40325
FT                   /locus_tag="Spirs_0038"
FT   CDS_pept        37116..40325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0038"
FT                   /product="acriflavin resistance protein"
FT                   /note="COGs: COG0841 Cation/multidrug efflux pump; InterPro
FT                   IPR001036; KEGG: bdu:BDU_143 acriflavine resistance
FT                   protein; PFAM: acriflavin resistance protein; SPTR:
FT                   Acriflavine resistance protein; PFAM: AcrB/AcrD/AcrF
FT                   family; TIGRFAM: heavy metal efflux pump
FT                   (cobalt-zinc-cadmium); The (Largely Gram-negative
FT                   Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79198"
FT                   /db_xref="GOA:E1R6R6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R6"
FT                   /protein_id="ADK79198.1"
FT                   /translation="MSVSKTVVGKPTTILIIFLLLIGLGIYSTSDLAIDLYPEIEPPVL
FT                   VVFTGYDGAGPEEIEKRITRTLEGSLSNVSNIESITSTSSEGSSMIMVEFTWGTDMAEA
FT                   ANSVRDNLEFVKGALPDEADSPMIFKFDPSMIPIMGLTLSGNRTPEELRQIAEDVVQPK
FT                   IEQIEGVALTSVSGGRERIIRVEIPQDRLEAYDLTLTQISSMLQGQNVQVTAGNIDEGN
FT                   INYLVTTSGEYDSIDQIKNTVISYKNEGMPGTSGDGSTQRTVRLRDIADVYDGYKDADS
FT                   LVYINGEPGIQIIIQKQSGTNSVQTADNIRNRLERINKQVPEGITVTEIFNTTDIIKSS
FT                   LNQVSSSAITGALLAIIVLFVFLRSLKSTFIIGLTIPVSLIVTLMLMYFFGLTLNIMTL
FT                   AGLALGVGMLVDNSIVILENIYRYREKGAKLTASAILGSQEMINAIVASTLTTICVFAP
FT                   VVLFKSQLDVVGELLASLAFTVVISLSASLVVAVTLIPVLSSHYLPLTSRRQRPLRGTL
FT                   KALDGVMERFFQGLENLYASILRGVLRHKIITIVVVLAVFLSSLTLIPKTGFEFMPSMQ
FT                   EDQVNLGVELPVGTKLEITETVIKQMEDIVRSEVKGYDDIITEVGEASFFGLGGSAIGY
FT                   KGSIRIMLPPYKERIDSSDDVKQKLRKHFNDFPSAVFSFDSSQGASFGGTTPIDILIKT
FT                   EDLTKAKDIAEKIRDILQNMPEVTEPQIDLKDGLPQVEIVMDRDKMYSLGLNVYSVGQE
FT                   IQANLDGITASQFREGGNEYDIVMFLADEDRNQILDLNKVFVNNQAGQRIPLASFARYQ
FT                   KGTGPITINRENQTRVVHVTAGTVPGTALNEVADRAQQLINQEIPADEDVLIEFSGDYE
FT                   DLQKYGMRFVAIILVSVFLVFGVMASQFESFVDPFIILFAIPLSMIGVILIYFLTGQIF
FT                   NILTAVGLVMLAGIIVNNGIVLVDYTNLLRKRGMNIHDACVEAGRNRLRPILMTTLTTV
FT                   LGLVPMAFFPGEGSELVQPIGKSVVGGLSVGSLFTLLLIPVIYAIVNRVGERRQEKREA
FT                   RKLARQKNRLEIEAQCKGDEA"
FT   sig_peptide     37116..37214
FT                   /locus_tag="Spirs_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            40322..40618
FT                   /locus_tag="Spirs_0039"
FT   CDS_pept        40322..40618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bre:BRE_141 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79199"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R7"
FT                   /protein_id="ADK79199.1"
FT                   /translation="MKLLRVEIIANRSIEEDMHDAFRKAGIVRHYTKFPVVHGVGTSGP
FT                   RRGDHVWPEENFVLTTYCEEEELDAIVDVVRELKDFFCDEGIKVFVSKAKEIL"
FT   gene            40681..41802
FT                   /locus_tag="Spirs_0040"
FT   CDS_pept        40681..41802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0040"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG3437 Response regulator containing a
FT                   CheY-like receiver domain and an HD-GYP domain; InterPro
FT                   IPR003018:IPR003607:IPR006674; KEGG: wsu:WS1630 response
FT                   regulator; PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; GAF domain protein; SMART: GAF domain protein;
FT                   metal-dependent phosphohydrolase HD region; SPTR: Metal
FT                   dependent phosphohydrolase; PFAM: HD domain; GAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79200"
FT                   /db_xref="GOA:E1R6R8"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R8"
FT                   /protein_id="ADK79200.1"
FT                   /translation="MKNTELRKEPSAQELLKIIFKYINLIANERDVGRLLVALADMGRD
FT                   LITADRCTVWLVNQQRGELWSKIAHGVDRIVIPLSKGVAGYVATTGKSMITNDAYADER
FT                   FDKQVDSETGYRTRNIIALPIRDSAGEVMGVYQAINKMSGEDGFTERDLEHLQLAASYT
FT                   GSELEAVALQEEIEQTQREMIVTLAEAGEMRSKETGGHVRRVAEYSYLIALAMGMDAEE
FT                   AELLKNASPMHDIGKIAIPDAILLKEGPLTDEEREVMKTHTTIGYDMLKYSTRDLLKTS
FT                   AIVAYQHHEKWDGSGYPQGLVGEDIHIYARITAIADVFDALSCDRVYKAAWPKEKIVAL
FT                   FKAERGHHFDPVLCDIMDGLWDQLYAIKRQYSH"
FT   gene            complement(41819..42910)
FT                   /locus_tag="Spirs_0041"
FT   CDS_pept        complement(41819..42910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0041"
FT                   /product="Patatin"
FT                   /note="COGs: COG3621 Patatin; InterPro IPR002641; KEGG:
FT                   cyc:PCC7424_4648 patatin; PFAM: Patatin; SPTR: Patatin
FT                   family protein; PFAM: Patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79201"
FT                   /db_xref="GOA:E1R6R9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R9"
FT                   /protein_id="ADK79201.1"
FT                   /translation="MNHINSLWYSRLVPGRTIRILSVDGGGIRGYLAALILEEIEKKRT
FT                   EIGRKKPFCRCFDMMAGTSTGSLISLGLAVPQSRKLPTDSPEESSKKTPLMPRLINILS
FT                   TNAHPKYNAAEIARLYREKGTEIFPRYIFKQLNTVRQAFVEKYDAGNFDRVLEDIFGDL
FT                   TLRDALGRVLITSYDTLSARPIIMKNLPGEENFYMKDAARGSSAAPSYFSPVEVTGLDS
FT                   NAPFCLVDGGVFANNPAMCAYVEARRLFPLARKFFILSLGSGQLEQRLSYKQVKSWGYV
FT                   EWVLPQNNVPLFGMMSTGQNKCVDYQLNHLPGVTYIRFNPLLNGCSEEMDDAGAKNMEC
FT                   LEAVAKRTIEGNRRLIDLIARFL"
FT   gene            complement(42907..44283)
FT                   /locus_tag="Spirs_0042"
FT   CDS_pept        complement(42907..44283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0042"
FT                   /product="MATE efflux family protein"
FT                   /note="COGs: COG0534 Na+-driven multidrug efflux pump;
FT                   InterPro IPR002528; KEGG: amt:Amet_4230 MATE efflux family
FT                   protein; PFAM: multi antimicrobial extrusion protein MatE;
FT                   SPTR: MATE efflux family protein; TIGRFAM: MATE efflux
FT                   family protein; PFAM: MatE; TIGRFAM: putative efflux
FT                   protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79202"
FT                   /db_xref="GOA:E1R6S0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S0"
FT                   /protein_id="ADK79202.1"
FT                   /translation="MHVTDQLFGDRSFRKELLRIAVPVALQNLLISSLSVVDTLMIGQL
FT                   GEVEIAAVGLANQLFFLSLLFFFGVSSGASVFIAQFWGKKDIPSIHRTVGFAFSFAGSA
FT                   AILFSLLSLTIPDQILRIFTTDEAVVTVGVEYLRVVGISYLFVAASVLSSVSLRSIEEA
FT                   ATPLRATTASIIANIILNYLLIFGKFGFPQMGVAGAALATTISRCLELIILYHAIFVKK
FT                   NILAAPVRTFFDFNSSFVRRFLKTATPVILNEMAWATGMVVYKIVFARMGTGVIAAMNI
FT                   VDTASNLLFIIFMGTSNACAVMIGKRVGMGKKEEAFTAGRHFIAIGFFFGAVVGLGALL
FT                   LARFIPGLFNVSDQVKLMTARVLRLFPIIFPLKALNIHTVIGIFRAGGDTAFSFFVDLS
FT                   GVWLVGVPLAFLGAFVWELPIHLLFLLLGMEEVCKTIMGLLRFRSRLWVRDITEGEVST
FT                   "
FT   gene            44427..45500
FT                   /locus_tag="Spirs_0043"
FT   CDS_pept        44427..45500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0043"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843; KEGG: bcl:ABC3473 hypothetical protein; SMART:
FT                   regulatory protein LacI; SPTR: Putative uncharacterized
FT                   protein; PFAM: Bacterial regulatory proteins, lacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79203"
FT                   /db_xref="GOA:E1R6S1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S1"
FT                   /protein_id="ADK79203.1"
FT                   /translation="MKKIVTQKDIAQALHIGQMTVYRALHNKGNISPELRERILAYADE
FT                   VGYQANRAAQTLVQKKVTRIVLFSTDTPRFFWDSVESGIGLAKEQVKHFNYSVEYYRIA
FT                   NKNSVEYLSALTAVIAEGVDAVGLVNNEEYDMTAIFRVLDDAQVPYILFNIDAKESHRL
FT                   CYIGPDYIGGGRLAAEFLGKCVAGTSKILVITDDHTKQNISAEVNHLRIDGFMSVMKER
FT                   YPSIINTIQGVDLEQGATDVGLELKTIINESEVCFDAIYLVPPINQLLMEVLAESKRPL
FT                   PKVLLHDTFPGYKEFFARDMITAIIFQNPIQQGFYAVKVLEEMVETGFIPRDDIHLVQE
FT                   VMLAENSDLDKNHLSFD"
FT   gene            45662..46897
FT                   /locus_tag="Spirs_0044"
FT   CDS_pept        45662..46897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0044"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   extracellular solute-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; SPTR: Extracellular
FT                   solute-binding protein family 1; PFAM: Bacterial
FT                   extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79204"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S2"
FT                   /protein_id="ADK79204.1"
FT                   /translation="MKKIGVMIVLLIFLSTFTYASGDQEAGKTELFFFCGHGDLEEGTK
FT                   EIIAAYEETHPNIKITTIFNSKDYATQFQSMMATDTLPDIVMVDQERLKEFVAADMLLD
FT                   LSDRPVASRLFDVAKEPNMIDGRLYSVPFHLQGYGMLYNPKLLAQAHINKVPSTLSELK
FT                   AAVDKLNAAGITPFTSMFNETWAADQYLLFGISPILNQDPSLVAGLYNGTVKFSDAKFS
FT                   EVFNYIDILKDNVPENPFSYSFGEGASYFGQGKAALAIHGDWILRTALAVDPNLDVHLA
FT                   ALPYSNVKENNKIVVGVANGLGIIKNSKHLQEAIDFFDYYSTLESAQILSKYNFSYVPQ
FT                   KGFDTKGLHAVYTDISEALDQGNVIPWEWLKVAPGGVKLEAGQSMQAYLSNQISQDQVM
FT                   ENVQAAFDDAVK"
FT   sig_peptide     45662..45721
FT                   /locus_tag="Spirs_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            46998..47873
FT                   /locus_tag="Spirs_0045"
FT   CDS_pept        46998..47873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0045"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG:
FT                   pjd:Pjdr2_0386 binding-protein-dependent transport systems
FT                   inner membrane component; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; SPTR:
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79205"
FT                   /db_xref="GOA:E1R6S3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S3"
FT                   /protein_id="ADK79205.1"
FT                   /translation="MKKHDYSADYFLFILPAFSLFFLFFLIPVFNGVRYSFFEWNGISA
FT                   TKTFVGLENFRNILNDKIFFEAFKNTLKFTVVHVLTVNLLALFLAVLLTKPSVVGRNFF
FT                   RGIFFLPNVLSLIVVGQIWKFFLGQASFELGKKIGVAVFQIGWLSDPQVALYSTIIASV
FT                   WQATGWYMLIYIAGITAIPRELYEAATIDGGRQVFVFRHITLPLLIPSLTICIFLSTIN
FT                   SLRVFDIVYAMTGGGPGHATETALLNIYNTTFNSFKYGYGTAKAIVLLIVIIVVSFTQI
FT                   ILLKRKEVDL"
FT   gene            47882..48712
FT                   /locus_tag="Spirs_0046"
FT   CDS_pept        47882..48712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0046"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG: bmq:BMQ_2796
FT                   putative ABC transporter, permease protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79206"
FT                   /db_xref="GOA:E1R6S4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S4"
FT                   /protein_id="ADK79206.1"
FT                   /translation="MSVEKLLKTILIYIILIIGVSIFIAPFYFVIINSLKTNSEYLVSK
FT                   LVLPSSFYVDNYVATIEMMKYGKTLLNSIVITAFSVFGILVIASMAAYKIARTKGILNT
FT                   ILFFLFLSVFVVPFQSVMIPIVVMARRLSLMNKLYGMVLVYLGLVSPTAIFLYRGFIQT
FT                   IPLSLEECAQIDGASVYQIFFRIVLPLLKPITSTIIILLGLQIWNDFLLPLLMLQTPKN
FT                   YTLPLATMRFFQTYNTAWGNILAATVLSSIPMIILFFSAQKQIVQGVTSGAIKG"
FT   gene            48721..50745
FT                   /locus_tag="Spirs_0047"
FT   CDS_pept        48721..50745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0047"
FT                   /product="glycoside hydrolase family 31"
FT                   /note="COGs: COG1501 Alpha-glucosidase family 31 of
FT                   glycosyl hydrolase; InterPro IPR000322; KEGG: sma:SAV_2570
FT                   glycosyl hydrolase; PFAM: glycoside hydrolase family 31;
FT                   SPTR: Putative uncharacterized protein; PFAM: Glycosyl
FT                   hydrolases family 31"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79207"
FT                   /db_xref="GOA:E1R6S5"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S5"
FT                   /protein_id="ADK79207.1"
FT                   /translation="MNKINTTPFSADKEGIVWKGGRETVMVQAVLPGVIRVQAWQAPSC
FT                   TEDYYTIEASHASINDNDLSIRIEKEKARLSSGDLQVAISSGGRLSFSNVQTGRLLFQE
FT                   ADWLPGNPTLFPKSRTYKRKNGAWSIRQLFLSHDEERFYGLGQHRNGLFNYKGAVIPLC
FT                   QQNGETSIPFLLSSKMYGFVWNNPSLGEVELVKNRTSWVAEEARKIDYYVITGGDYKTI
FT                   YSRYADVTGHSPQLPFWATGFWQSKLRYASQEEVLNVVDEYQKRGIPLSAIVIDYLHWT
FT                   RMGDFEWDERLWPSPETMVETLRQKDVTVVASIWPAINPKSKHAEELSNKGYLVDSVKG
FT                   MNLFFPFFDTNDIPPVFLQYYDATNPDARTYFWKKVKAMYYDKGIKNYWLDGCEPEIYP
FT                   FDMDNLLFSLGDGKAVANLYPLCHQRGIAEALYAEGERDFVLLCRSGWLGTQRFGSALW
FT                   SGDILSNWQTFADQIHVGLHVGMSGIPWWTSDIGGFMEGNIHDEGFQELLIRWFEYGIF
FT                   CPLCRLHGNRDPRPENPTESGADNEVWSFGDKAYGILQKMLRIRETLRPYIYREMERTS
FT                   QDGLPMMRPLFFDYPEDSACWDIGDEYLFGSQILVAPVHEKGAVGRSVYLPQNRQWMDA
FT                   WTGTLYEGGVHLQVSAPLDMIPVFLSPDCDEIVVKAFRE"
FT   gene            50804..51673
FT                   /locus_tag="Spirs_0048"
FT   CDS_pept        50804..51673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0048"
FT                   /product="metal-dependent hydrolase/oxidoreductase,
FT                   beta-lactamase family"
FT                   /note="COGs: COG1237 Metal-dependent hydrolase of the
FT                   beta-lactamase superfamily II; KEGG: tga:TGAM_1342
FT                   metal-dependent hydrolase/oxidoreductase, beta-lactamase
FT                   family; SPTR: Metallo-beta-lactamase domain protein,
FT                   putative; PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79208"
FT                   /db_xref="GOA:E1R6S6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S6"
FT                   /protein_id="ADK79208.1"
FT                   /translation="MKELDALTITVVAEDSVGYETPYLGQHGISLFLNAVRGETRVNIL
FT                   MDVGQNPKALLTNMELLNISPGSIDMIVLTHCHYDHTQGLVEIIKATGKRNLPVVAHPD
FT                   LFRVHVITDPFLRYIGVPGEDQNKVVEEAGGVLCLVSDPLELLPGLMTSGEIQMLTDYE
FT                   EVGMALKTIRNGNVSEDSVVDDLSLFAVVRDRGLVVMTGCGHRGIVNIVQQGVRNTGVR
FT                   KIASIIGGFHLIESSDEKIEKTAAGLKALDIDSVKAGHCTGFKAQVELYHAFNDNFSPM
FT                   HAGDIYRF"
FT   gene            complement(51724..53061)
FT                   /locus_tag="Spirs_0049"
FT   CDS_pept        complement(51724..53061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0049"
FT                   /product="amino acid permease-associated region"
FT                   /note="COGs: COG1113 Gamma-aminobutyrate permease and
FT                   related permease; InterPro IPR004841:IPR002293; KEGG:
FT                   mem:Memar_1826 amino acid permease-associated region; PFAM:
FT                   amino acid permease-associated region; SPTR: Amino acid
FT                   permease-associated region; PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79209"
FT                   /db_xref="GOA:E1R6S7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S7"
FT                   /protein_id="ADK79209.1"
FT                   /translation="MSQKGTGLHRELGILDVTAITSGIIIGAGVFIVTGIAAQFAGSLT
FT                   WLAYAIGAIPVILVGISTIFLNLMHPVEGGESYVYPTRIVSKPLGFLSGWGMWLAVIGP
FT                   IAITAQAFINYLNALPGTSVVFPATIGAVVVTILFSLINWVGLKTVKIVQNVLFLFMVA
FT                   GILIYIILALPHMKGTNITMGSPLGFAGVMKATSLLLFSYAGLTLAADLGEEAKNPAKT
FT                   ITWGIILGILIPTLLYVVSAFVSTAVLPWKDFAASEAPYAAVASTFMGPFGVVFIVIVA
FT                   WAAILSSHNGEQAVAARVFFGLSRDGILGGKTASVNRFGTPTFGLIATSVLAIILIISG
FT                   TIQLVAEIIVAMFLYNWIITHIAVLMARKKFPELVDKLPGIYRKKGFLCLPVLGLAVSV
FT                   YLLILQGWKALLYAAVWMIVGYLVYLVGISRNKKEILSRMDRWPES"
FT   gene            complement(53132..55048)
FT                   /locus_tag="Spirs_0050"
FT   CDS_pept        complement(53132..55048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0050"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1032 Fe-S oxidoreductase; InterPro
FT                   IPR006638:IPR013704:IPR007197; KEGG: cth:Cthe_1094
FT                   hypothetical protein; PFAM: Radical SAM domain protein;
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; SPTR: Radical SAM-like protein; PFAM: Domain
FT                   of unknown function (DUF3362); Radical SAM superfamily;
FT                   Radical SAM N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79210"
FT                   /db_xref="GOA:E1R6S8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S8"
FT                   /protein_id="ADK79210.1"
FT                   /translation="MTPVYSIGFLLYSSAMHKNHAEFLPLTKQEFEAQHGTASPDFIIV
FT                   SGDAYVDHPSFGTALIGRLLESRGYRVAIIAQPDWRNTEDFSRFGRPRLAFLVTSGNLD
FT                   SMVANYSASRHPRREDAYSPGGKAGLRPDRSLVVYTSRIRQAFKGVTVALGGLEASLRS
FT                   LSHYDYWSDTIRRSVLLDAKADYLLYGMSETTILALAAALETAVEKGSQPNVETIRGLV
FT                   RVVGKNNIAYDNIISSQYDDITGSKTVFLPSHEALIKDGTRYADHFALQMKHADPYSAA
FT                   TLIEPCGDRFIVHNPPPFPLTTEELDAVYELPFCRRAHPSYAKAGGIPALQEVRFSLVS
FT                   SRGCFGGCSFCALTFHQGRIITPRSKESLLREAQKLIADPDFKGYIHDVGGPTANFHTP
FT                   ACEGQKHRGACSNRQCLFPKPCPSLKVDHTAYLDVLKSLRKLPGVKKVFIRSGIRFDYL
FT                   LLDENRSFLKELVAYHISGQLKVAPEHAGSRTLEAMGKPPIEVYEQFSRLFYEETKRIG
FT                   KKQYLIPYLIAGHPGSTLDEAVELALFLKKSGFIPDQVQDFYPTPGTLSTCMWATGIDP
FT                   RTMKPIFVPRGEKERHLQRALLQFNRPKNYDRVRKALRQAGRSDLIGFGQTALVPPERN
FT                   RHP"
FT   sig_peptide     complement(54986..55048)
FT                   /locus_tag="Spirs_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(55045..55689)
FT                   /locus_tag="Spirs_0051"
FT   CDS_pept        complement(55045..55689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0051"
FT                   /product="deoxynucleoside kinase"
FT                   /note="COGs: COG1428 Deoxynucleoside kinase; InterPro
FT                   IPR002624; KEGG: dge:Dgeo_0101 deoxynucleoside kinase;
FT                   PFAM: deoxynucleoside kinase; SPTR: Deoxynucleoside kinase;
FT                   PFAM: Deoxynucleoside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79211"
FT                   /db_xref="GOA:E1R6S9"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S9"
FT                   /protein_id="ADK79211.1"
FT                   /translation="MKKYVVLAGNIGAGKSTLVRKLADRLGFRPYYEPVTENPYLKDFY
FT                   SDMRRWAFHSQTFFLTHRVRTHHLLAEDPFSVVQDRSMYEDAEVFARNLYEQQSMTKRD
FT                   WETYQELYHTLITMLPPPDLIVYLRASVTTLKKRIALRGRNFEASISDTYLQGLNRLYD
FT                   RWTNDFTLAPILIVPTDRLDFVEQNKDFEAIVKTIEQRLLDKQGILFPVGM"
FT   gene            complement(55750..56901)
FT                   /locus_tag="Spirs_0052"
FT   CDS_pept        complement(55750..56901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0052"
FT                   /product="transcriptional regulator, GntR family with LacI
FT                   sensor"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000524:IPR001761; KEGG: aca:ACP_0022 transcriptional
FT                   regulator, GntR family; PFAM: regulatory protein GntR HTH;
FT                   periplasmic binding protein/LacI transcriptional regulator;
FT                   SMART: regulatory protein GntR HTH; SPTR: Transcriptional
FT                   regulator, GntR family; PFAM: Bacterial regulatory
FT                   proteins, gntR family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79212"
FT                   /db_xref="GOA:E1R6T0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T0"
FT                   /protein_id="ADK79212.1"
FT                   /translation="MTNKVERMQFKYQYIYDKLRNLLENGRYHAGDRLPTEVELASRFN
FT                   VSRPTVTRALNALQEEGIIVRKTGSGSFVNNLHSYKNKFNNRIFGLLVPGLGKGEIFEP
FT                   ICTQIAANAEKNQCSLLWSGSEIRTTEAAKSLVDVTQRYIAHHIAGVFFEPLELSPSFD
FT                   QINRKIISMFQDAGIPIVLIDSDYLPFPERSNLDLVGIDNFRAAYMATRHYLRHGEKRI
FT                   DFLARPYSAYTISIRLRGYRTALIDYGIIPQAEWIHLVNPEELEYITSRFDHPEAPPFN
FT                   MICANDETASALLGACESVGISVPEHLRIVGFDDVHYAQMLRVPLTTIHQSVQQIGNLA
FT                   LETLLWRIEHPDAPARTINAETRMIIRESCGMTGKAEISPFYS"
FT   gene            57132..58085
FT                   /locus_tag="Spirs_0053"
FT   CDS_pept        57132..58085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0053"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="COGs: COG1879 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR001761; KEGG:
FT                   eok:G2583_4914 putative periplasmic ribose-binding protein
FT                   of ABC transport system; PFAM: periplasmic binding
FT                   protein/LacI transcriptional regulator; SPTR: Putative
FT                   carbohydrate binding protein; PFAM: family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79213"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T1"
FT                   /protein_id="ADK79213.1"
FT                   /translation="MRKVVLILLCGMLLGGTLFAGGQGEGEKVLQVAATFGDLGNPFFF
FT                   TMGKGVEDAAKAIDPNAKVTVQSSGYDLNTQTSQMENFIANGVDIIILNAADTAGIAPA
FT                   VRKAKEAGIIVVAADVNADGGVDATVTSNNYQAGTQAGEYIVKRLGGKGNIVIINGPPV
FT                   SAVIDRVNGAKEVLAKNPGIKILSDNQNAGGNREGGLRVMTDLLTAYDNIDAVFAINDP
FT                   TGIGADLAIKQAKRGDEMFVVGVDGAPDAVVALNDTNSSFVATPSQDPYTMATRAVQVA
FT                   YEVIQGNPPKEKLILIPTTLITRDNVSEYKGWTEPE"
FT   sig_peptide     57132..57191
FT                   /locus_tag="Spirs_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            58172..59704
FT                   /locus_tag="Spirs_0054"
FT   CDS_pept        58172..59704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0054"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1129 ABC-type sugar transport system ATPase
FT                   component; InterPro
FT                   IPR003593:IPR003439:IPR015861:IPR017871; KEGG: ava:Ava_2172
FT                   ABC transporter-like; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: Ribose import ATP-binding protein RbsA;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79214"
FT                   /db_xref="GOA:E1R6T2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T2"
FT                   /protein_id="ADK79214.1"
FT                   /translation="MDEQDRKEPILSVRNLSKRFPGVQALDGVSLDIYAGEVHVLMGEN
FT                   GAGKSTLMKILAGVYKADEGEIRIDGQLVAPENPLQAMALGVNLINQELGVATNLTVAE
FT                   NVFMGSEPHRFGVIDRHQMAIRTQEVLKKLGASFQPEVRASLLKVAEQQQVDIARALVH
FT                   NGRVLIMDEPTAALSEREIDRLFDLVRSLREQGLAIVYISHRLAEVSVIADRVSVLRDG
FT                   QYIGTVTKDNMDNETIVKMMVGRSLKDFYEHQTAEKKEDNYLVVKHVSDGKRVKDVSFQ
FT                   AAAGEILALSGLVGSGRTELARLIFGADKPLTGEVIVEGRKLTITSPKDAIHQGIGYVP
FT                   EDRKTEGLFLGMSSQENIVMNIMEQKARFGILNRKENGSITDHAIKQLNIKLSNPRNAA
FT                   LSLSGGNQQKLLLARWLQIKPRVLILDEPTRGVDVGAKSEIYKLIGEIAQNGVAVVFIS
FT                   SELPEVVGLAQRVLVMREGRITAELRGPEQINQEIIMAYATGIRKPDYTFSA"
FT   gene            59728..60696
FT                   /locus_tag="Spirs_0055"
FT   CDS_pept        59728..60696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0055"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG4158 ABC-type sugar transport system
FT                   permease component; InterPro IPR001851; KEGG:
FT                   npu:Npun_R5324 inner-membrane translocator; PFAM:
FT                   inner-membrane translocator; SPTR: Inner-membrane
FT                   translocator; PFAM: Branched-chain amino acid transport
FT                   system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79215"
FT                   /db_xref="GOA:E1R6T3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T3"
FT                   /protein_id="ADK79215.1"
FT                   /translation="MSSNNLATKLKQQNSAIWESLGILPILLVIVILFSLLSGNFLRPT
FT                   NLMNILRQASINIVLAAGMTLVILTGGIDLSVGSILASTAVVSLLVSLNPSLQAFTVIA
FT                   PLLTGLLFGVLNGILIAYVKLPFFIVVLGSMTALRGASYLLANGTTLINNDLNFAWIGN
FT                   AYLGPFPWLAIIALAVIAIMWFILRKTVLGVHIYAVGGNPTAARLTGINVSFVLVFVYA
FT                   MSGLLSGLGGIMTASRLYSASGLLGNGYELDAIASVILGGTSISGGSGSVVGTLVGALI
FT                   IAVLNNGLTLMNVSYFWQLVVRGIVIIVAVLIERFRHRKKV"
FT   gene            60711..62132
FT                   /locus_tag="Spirs_0056"
FT   CDS_pept        60711..62132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0056"
FT                   /product="Carbohydrate kinase, FGGY"
FT                   /note="COGs: COG1070 Sugar (pentulose and hexulose) kinase;
FT                   InterPro IPR018484:IPR018485; KEGG: rxy:Rxyl_2898
FT                   xylulokinase; PFAM: Carbohydrate kinase, FGGY-like; SPTR:
FT                   Xylulokinase; PFAM: FGGY family of carbohydrate kinases,
FT                   N-terminal domain; FGGY family of carbohydrate kinases,
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79216"
FT                   /db_xref="GOA:E1R6T4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T4"
FT                   /protein_id="ADK79216.1"
FT                   /translation="MYLGIDLGTGSVKLMLLGPDGAEHTVSRSYEVSSPHSGWAQIDTD
FT                   IWLAALSSCIRELPGVEGVKAIGLSGQMHGIVPCSGMSGTAPVALGSAITWADQRAAET
FT                   LPYYKTFSEQTLSKLGNPPSAGMAGPILLWLRDQMPGLFAKIDIACMPKDFIRATLTGD
FT                   RLTDYSDASGTLLYDFSIQGWHAELVRAIGLDMTQLPQIRAGNSIAGFVSDDAARRFGL
FT                   PPGIPVALGAGDTPAAFFGTDLHDPGTAQISIGTAAQIGVPMAERGIHTVMNLNLFEGV
FT                   RPGSRYRIAAMMNGGLALEWVRRQLGFSWQDLYRSLERRGLGTPSDLIFIPYLSGERTP
FT                   HMNPDARGAWIGLSLHHQREDLALAALLGVASTIRLGLDTLLSAGNSSISQLRLVGGSA
FT                   RFPFWRKVLAAMLERDLLVSQQTDSSARGAALMAAEAIGERLSPSFGFDCEHAESYSWM
FT                   KEYFQKQQDLYYKIF"
FT   gene            62189..63106
FT                   /locus_tag="Spirs_0057"
FT   CDS_pept        62189..63106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0057"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterPro IPR003594:IPR011495:IPR005467; KEGG: lbf:LBF_2370
FT                   signal transduction histidine kinase; PFAM: histidine
FT                   kinase dimerisation/phosphoacceptor; ATP-binding region
FT                   ATPase domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; SPTR: Putative two-component response
FT                   regulator; PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79217"
FT                   /db_xref="GOA:E1R6T5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T5"
FT                   /protein_id="ADK79217.1"
FT                   /translation="MADNTVVILWFSIVFQLMAAAYALFLIRVTGLRYSWICISLALIL
FT                   MSVRRIVSLSSGLLGAATMGEPLYEAIGLLLSMLVFVGIVGIRSILVEWRKNQTKVEAL
FT                   LQEKEMILREVHHRIKNNMSTILSFLSLQAETLGSSPARTSIEEAENRVRSMMILYDKL
FT                   YRGENVDACPIDQYLPLLIDQILATFPNSDSVEVEKSIGNFELDAKRLSLVGIIVNELL
FT                   TNSMKYAFSDATRGHIRVHAELESGQVLIRFEDNGTGIPAHVDFEGTSDLGLRMIKALT
FT                   TQLDGTVQLEREEGTCISISFPFQ"
FT   sig_peptide     62189..62245
FT                   /locus_tag="Spirs_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(63113..64912)
FT                   /locus_tag="Spirs_0058"
FT   CDS_pept        complement(63113..64912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0058"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089:IPR003660; KEGG: cbt:CLH_1795
FT                   methyl-accepting chemotaxis protein; PFAM: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; SMART: chemotaxis sensory transducer; SPTR:
FT                   Methyl-accepting chemotaxis protein; PFAM: HAMP domain;
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79218"
FT                   /db_xref="GOA:E1R6T6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T6"
FT                   /protein_id="ADK79218.1"
FT                   /translation="MNSSIQSIKWKLLGSFLLLILMFASIEIITFRGNQMNSQKIHDLK
FT                   NELLPETLSFLTIEKDVIQIQQWLTDISATRAAPGYDDGFNEAESYYNDAQERVDTFIQ
FT                   VYASKEENTAVDTLRTFKQDLDAFYDTGKAMAEAYINGGPSKGNPMMGEFDPVAERLSR
FT                   TMRDLVDSHTAGLNQAVVAIEANNGFVNRLTLLLMAAIILISALVAFLSIRTIHVGLLQ
FT                   VMQYAQNLSIGSFTLETEFHRKDEFGQLIRHFNEGFATVRSLIVSVKESADASSAVNTT
FT                   LRTSTDEVSASVTEIRANTESIGHHIERQTGLVSESSSAVEQIRTNIQDMTNQVEQQAG
FT                   AVIQSSAAVEEMAASIANVARISQNRQQEIPELISVIEQTDSNIESTGMVIDNVAALST
FT                   QMLEVIGVINNISTQTNLLAMNAAIEAAHAGEAGKGFSVVADEIRKLAEETSSNSKQIA
FT                   ETLGKVNAIIQEAQESAQENKTSFARLRLGVTNLANSFQEVSSTMGEINTGADEINIAI
FT                   NELTEITESIKSASSEINNGAGEIAESMDGLQGVSSEILLGIREISAGVQEVTGSMVTL
FT                   QELFSESVEAVDRIEDNLKRFSI"
FT   sig_peptide     complement(64832..64912)
FT                   /locus_tag="Spirs_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            65000..66766
FT                   /locus_tag="Spirs_0059"
FT   CDS_pept        65000..66766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0059"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="COGs: COG0469 Pyruvate kinase; InterPro
FT                   IPR015793:IPR001697:IPR015794:IPR018209; KEGG: pth:PTH_2214
FT                   pyruvate kinase; PFAM: Pyruvate kinase barrel; Pyruvate
FT                   kinase alpha/beta; PRIAM: Pyruvate kinase; SPTR: Pyruvate
FT                   kinase; TIGRFAM: pyruvate kinase; PFAM: Pyruvate kinase,
FT                   barrel domain; Pyruvate kinase, alpha/beta domain; TIGRFAM:
FT                   pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79219"
FT                   /db_xref="GOA:E1R6T7"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T7"
FT                   /protein_id="ADK79219.1"
FT                   /translation="MKYLRKTRIVATIGPACDDLAIQKELLKAGVNVARFNFSHGNHEE
FT                   QAKRIASMRRASEETSVPVALMMDTKGPEIRTGNVKGEAELALHSGFEIVLTSRHVEGT
FT                   REELSVSYQNLPSEVEAGDHIFIADGVIDLEVLAVSGPDIRCLIRNGGMLGSKKNVNVP
FT                   GVKVGLPAITEKDREDIRFAVEHQMDYIAASFIRRPEDVEEIREILKQYHSSIRIIAKI
FT                   ENQEGLDNIDDIIRISDGVMVARGDLGVQLSTEQIPLAQKRIIGKCMRQGKPVITATQM
FT                   LDSMIHNPSPTRAELTDVANAIFDGTDAVMLSGETAGGAFPVRSVETMGRIAEAVETSE
FT                   EYRRRCTQWFETVQRPKDIGHTIARAAYVVASDIDASAIVAPTLRGNTPRILSNYRPNQ
FT                   LIIAVTTSEESYRQLLLHWGIFPILSAPVKDSDMMIQNALRLAREHGYVAPPDRVVTTA
FT                   GIPLNSPQPLNTIKIHFLGTILNRGHAGMGDRCSGALVKAENFELAQHRLRWDGTEILL
FT                   TGSIGKELFPRLSSLRGIVIEGELSLSPEEVRKIASKIVIIADVPNAMDNFEDGQLVTL
FT                   DGKEKIIYEGFM"
FT   gene            66913..67215
FT                   /locus_tag="Spirs_0060"
FT   CDS_pept        66913..67215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0060"
FT                   /product="protein of unknown function DUF59"
FT                   /note="COGs: COG2151 metal-sulfur cluster biosynthetic
FT                   protein; InterPro IPR002744:IPR002052; KEGG: sti:Sthe_0635
FT                   protein of unknown function DUF59; PFAM: protein of unknown
FT                   function DUF59; SPTR: Putative uncharacterized protein;
FT                   PFAM: Domain of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79220"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T8"
FT                   /protein_id="ADK79220.1"
FT                   /translation="MINTETVLKALEDVVDPELGYSVVELGLIYRVKVEGKRVEIDFTL
FT                   TSFGCPLADLLTADIEAAVRSLHPAAEPVTTLVWDPPWGPERMNEEARLDLGYPV"
FT   gene            67234..68040
FT                   /locus_tag="Spirs_0061"
FT   CDS_pept        67234..68040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0061"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="COGs: COG0396 ABC-type transport system involved in
FT                   Fe-S cluster assembly ATPase component; InterPro
FT                   IPR010230:IPR003593:IPR003439:IPR017871; KEGG:
FT                   gtn:GTNG_2946 ABC transporter ATP-binding protein; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter ATP-binding protein; TIGRFAM: FeS assembly
FT                   ATPase SufC; PFAM: ABC transporter; TIGRFAM: FeS assembly
FT                   ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79221"
FT                   /db_xref="GOA:E1R6T9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T9"
FT                   /protein_id="ADK79221.1"
FT                   /translation="MSVLTIKGLRASIDGKPILNGVDLILKSGEVHALMGPNGSGKSTL
FT                   ANVIMGNPRYEVTGGTIDLDGTDILALPVHERARLGLFLAFQYPVEIPGLSMAKFLRRA
FT                   AETRLSQGQNLRVSSFLKGVRADMDRLSFDKAFLNRSLNDGFSGGEKKRAEILQLLTLK
FT                   PKLAIFDETDSGLDIDAIKSVAAGIDHMRGPDFGALIITHYRRILDYLAPEFVHVLFQG
FT                   RVVLSGGNEIVRELEERGYDWVKEGYGEAGGTPLVPETKASQAAHV"
FT   gene            68033..69451
FT                   /locus_tag="Spirs_0062"
FT   CDS_pept        68033..69451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0062"
FT                   /product="FeS assembly protein SufB"
FT                   /note="COGs: COG0719 ABC-type transport system involved in
FT                   Fe-S cluster assembly permease component; InterPro
FT                   IPR010231:IPR000825; KEGG: ttr:Tter_1698 FeS assembly
FT                   protein SufB; PFAM: SufBD protein; SPTR: FeS assembly
FT                   protein SufB; TIGRFAM: FeS assembly protein SufB; PFAM:
FT                   Uncharacterized protein family (UPF0051); TIGRFAM: FeS
FT                   assembly protein SufB"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79222"
FT                   /db_xref="GOA:E1R6U0"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U0"
FT                   /protein_id="ADK79222.1"
FT                   /translation="MSETNTMEAVAGIGDDAYKLGFHYPEHSIIKTKKGLSEEVVREIS
FT                   AAKGEAAWMLEFRLAALETFRKMPMPGWGSDLSGIDFDDYYYYAKPVNEQSGSWEELPQ
FT                   DIRDTYERLGIPEAERRFLGGVGAQYDSEMVYHKIRKDFESKGILFMDTETGEREHEEL
FT                   FRKYFASVVPSTDNKFAALNAAVWSGGSFVYVPKGVKVDIPLQAYFRINTKSLAQFERT
FT                   LIVVDEGAFVHYIEGCTAPIYAKDSLHTGVVEIVALPGARVRYSTIQNWSTNVYNLVTQ
FT                   RAKAHAGASVEWVDGNIGSKSTMKYPCVVLAGEGAHGEVLSIAFAGRGQEQDAGGKMIH
FT                   LANNTSSVITSKSISKDGGISSYRGLVKVAPHLRGVKSKVECDALILDEKSTSNTYPTM
FT                   DIQTDDVRMEHEAKVSKISEEELFYLQSRGIDEEEAAKMIVAGFIDPLVRELPMEYAVE
FT                   LNRLIDLEMEGAVG"
FT   gene            69451..70740
FT                   /locus_tag="Spirs_0063"
FT   CDS_pept        69451..70740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0063"
FT                   /product="SufBD protein"
FT                   /note="COGs: COG0719 ABC-type transport system involved in
FT                   Fe-S cluster assembly permease component; InterPro
FT                   IPR000825; KEGG: acr:Acry_2270 FeS assembly protein SufD;
FT                   PFAM: SufBD protein; SPTR: FeS assembly protein SufD; PFAM:
FT                   Uncharacterized protein family (UPF0051)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79223"
FT                   /db_xref="GOA:E1R6U1"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U1"
FT                   /protein_id="ADK79223.1"
FT                   /translation="MNERTMEATRLSWLSEHKNKADAAWKQLPWPGRKNPQWKNSPVSL
FT                   FEAETFTAEQDWEEHAWDTADTSSGPQVTASGAIDDDRYAAVLRFVDGKPDFDKQTIES
FT                   RGIELSFGAAPEWGARFLEAADLSDKLHARLFAEAAPVMSLSIAPGVNLAGPILLDWVD
FT                   GRPDFYAAPLFFLKIGEAAQLRLTLCWRTPDGRKTRLFLSPALFVDLERNARLDLFELE
FT                   HLSHRARFLDYPVAILEEKAELRWSRGIFGVGVSKSTILARLEGRASRFDFAAAYASPD
FT                   KSHVDISVTQRHIAPFTWSRSRLDAVADGSGKAISHGLIEVKESGIGTDAYLSTKTLSL
FT                   SPHAKAVSLPELAIDTNDLTASHGSTVGTISPEELFYLASRGIEIGEAKALIAEGVLGL
FT                   ILERTPSELTDTLESLIEDALETESEVARG"
FT   gene            70733..72022
FT                   /locus_tag="Spirs_0064"
FT   CDS_pept        70733..72022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0064"
FT                   /product="cysteine desulfurase, SufS subfamily"
FT                   /EC_number="4.4.1.16"
FT                   /note="COGs: COG0520 Selenocysteine lyase; InterPro
FT                   IPR010970:IPR000192; KEGG: ade:Adeh_0846 SufS subfamily
FT                   cysteine desulfurase; PFAM: aminotransferase class V; SPTR:
FT                   Cysteine desulfurase, SufS subfamily; TIGRFAM: cysteine
FT                   desulfurase, SufS subfamily; PFAM: Aminotransferase
FT                   class-V; TIGRFAM: cysteine desulfurases, SufS subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79224"
FT                   /db_xref="GOA:E1R6U2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U2"
FT                   /protein_id="ADK79224.1"
FT                   /translation="MANMIQTGARGFLKGAAFDAADAKAQGIREDFPILTAGPTKQGAP
FT                   LVYLDSAATSQKPRVVIDAIVDYYENTNANVHRSIHRLGEEATAALESGRAAVADYIGA
FT                   ASSREIIFTRGTTESFNLLASSLCRRLEAGDEIILSEMEHHANIVPWHMAAQNYGVVLK
FT                   FLPLNEAGDLELSDLDRLLSPRTKLVSLTHISNLLGTINPIGQIAPMVHARGALLAVDA
FT                   AQSLPHMPIDVKALGADFLAFSGHKAFAPMGIGCLYGRQELLESLPPWQGGGEMISAVG
FT                   LHGFSVNELPWKFEAGTPHVEGVVGLEAALDYMQRLDPAWIDTWTASLAAYTIERLEAI
FT                   PGVTVHGAPRLRAGLFPFTLDGVHAHDLAAFLDRGGIAVRAGKHCAHPLSDKLGLLSSC
FT                   RVSFHAYSTRADADALIKRLTDAARRGAIV"
FT   gene            72019..72483
FT                   /locus_tag="Spirs_0065"
FT   CDS_pept        72019..72483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0065"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="COGs: COG0822 NifU homolog involved in Fe-S cluster
FT                   formation; InterPro IPR011341:IPR002871; KEGG: sha:SH2036
FT                   hypothetical protein; PFAM: nitrogen-fixing NifU domain
FT                   protein; SPTR: SUF system FeS assembly protein, NifU
FT                   family; TIGRFAM: SUF system FeS assembly protein, NifU
FT                   family; PFAM: NifU-like N terminal domain; TIGRFAM: SUF
FT                   system FeS assembly protein, NifU family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79225"
FT                   /db_xref="GOA:E1R6U3"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U3"
FT                   /protein_id="ADK79225.1"
FT                   /translation="MSTIEREVDREIIYDHYTRPRHFGALGPDAVMLENPSCGDTVRLS
FT                   IRGGISSDGSEPLEFRFEGKGCSISQSSTSMMVELLSGKSRGEAIRIAERVLSVFRGER
FT                   DPHVLEDLGDISALAGIARLPVRVKCAALAWQGALKLLRQQERAYSEVDR"
FT   gene            complement(72493..73500)
FT                   /locus_tag="Spirs_0066"
FT   CDS_pept        complement(72493..73500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0066"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843:IPR001761; KEGG: oan:Oant_4373 regulatory protein
FT                   LacI; PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; SPTR: Regulatory protein LacI; PFAM:
FT                   Bacterial regulatory proteins, lacI family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79226"
FT                   /db_xref="GOA:E1R6U4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U4"
FT                   /protein_id="ADK79226.1"
FT                   /translation="MKVTLKDIANYAEVSSATVSLVLNNKGNISPETRDRVLKAIRHFD
FT                   YNKSHGPASQQRTIKFLKIAKHGQVINRDHDVFIADYLDGLTSGAQELDYKLEVVSFAH
FT                   TSVADIIASALQEPSISGAIVLATELNRDDMLLFSTTTIPIVFIDTYNEYLPFDFVDMD
FT                   NKSSIYKAFIYLKELGFPEIGFVASYSDISNFRIRENAYKESISYYPDMNPDIISVEST
FT                   FHGAYRDMNAYLEEHKKLTHKAYICSNDIMALGTIKALKEHGFRIPEDVSLLGFDNLPQ
FT                   SAQADPPLSTIEVSKRDIASIAVKQLHNRIEAPGSPTVRSLVGGALILRESIRR"
FT   gene            73752..74654
FT                   /locus_tag="Spirs_0067"
FT   CDS_pept        73752..74654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0067"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="COGs: COG0329 Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase; InterPro
FT                   IPR002220:IPR020625; KEGG: bcl:ABC3607 dihydrodipicolinate
FT                   synthase; PFAM: dihydrodipicolinate synthetase; SPTR:
FT                   Dihydrodipicolinate synthetase; PFAM: Dihydrodipicolinate
FT                   synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79227"
FT                   /db_xref="GOA:E1R6U5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U5"
FT                   /protein_id="ADK79227.1"
FT                   /translation="MKKLYGLTTAMITPYDNKGKLNLDMVGEMTRFQIERGTHCLYPGG
FT                   TTGEMYLLSEEERKALAKATVDAGKGKANIFIHVGAMTQDETIRLAQHASEIGADGIGV
FT                   VTPSYFKVTDGMMVNYFTTIANSVPNDFPIYLYNIPQCSGNDLKPDTIRQIIDRAPNVV
FT                   GIKYSFADFVRTIEYVGIAEDFSVVIGADILFHSGLAMGCTGTVSGVASVYPEPFVAIY
FT                   DAFLKGDQEKARRIQKKAVEIANLLKNGSNMSYFKIALKHRGYDVGGMRAPLMDLSDEE
FT                   QQRLVEQLNVWEDSALGEF"
FT   gene            74694..75659
FT                   /locus_tag="Spirs_0068"
FT   CDS_pept        74694..75659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3181 conserved hypothetical protein;
FT                   InterPro IPR005064; KEGG: bcl:ABC3606 hypothetical protein;
FT                   PFAM: conserved hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Tripartite tricarboxylate
FT                   transporter family receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79228"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U6"
FT                   /protein_id="ADK79228.1"
FT                   /translation="MKKKITMVLIALLAVGTLCFANGQSEGQPFPAKEVTIVVPYSPGG
FT                   ASDTVTRIIAKNTESALGVPVIVTNKTGASGSIGMDYVRKSTPDGYTISYMPVESTMVS
FT                   ALGYTDLAPADFDFVAGAMTLSAALTVRADAPWDSVEEFLAYAKANPGKLNIGNSGTGS
FT                   IWHIAAASIEESQGVQFNHVPFEGAAPAIAALLGGHIDAITVSDAEVLPNVKNGDFKVL
FT                   AVMGNERSATLPEVPTLKDLGIDVAVFGWGGFAVPKGTPDDVKAILGAAFKVGIGSADF
FT                   AQLCKERGFTQKYMTGKEIQEFAQEQYEYYSKLIPKLGIH"
FT   sig_peptide     74694..74756
FT                   /locus_tag="Spirs_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            75729..76175
FT                   /locus_tag="Spirs_0069"
FT   CDS_pept        75729..76175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tle:Tlet_0634 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Tripartite
FT                   tricarboxylate transporter TctB family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79229"
FT                   /db_xref="GOA:E1R6U7"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U7"
FT                   /protein_id="ADK79229.1"
FT                   /translation="MLYGDLVFGAVSLGLSVWFFIMSLGFPSGSSSNGVPGAGFFPGVI
FT                   SILIALVSIVLMVQGFRQKRHYFQPVKSIKEMPTNTRNLFLTIVSLMIFMLLWKFVHFF
FT                   VAIGAFIFFLNVLFRQKLLVNIIYTVVSIAFIYLTFGKIFHVMF"
FT   sig_peptide     75729..75824
FT                   /locus_tag="Spirs_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            76198..77709
FT                   /locus_tag="Spirs_0070"
FT   CDS_pept        76198..77709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0070"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="COGs: COG3333 conserved hypothetical protein;
FT                   InterPro IPR002823; KEGG: bcl:ABC3604 hypothetical protein;
FT                   PFAM: protein of unknown function DUF112 transmembrane;
FT                   SPTR: Putative uncharacterized protein; PFAM: Tripartite
FT                   tricarboxylate transporter TctA family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79230"
FT                   /db_xref="GOA:E1R6U8"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U8"
FT                   /protein_id="ADK79230.1"
FT                   /translation="MGIWLHVLQSLLNPGVLLYLLFGVVIGSFLGGLPGLTATMGIAIL
FT                   TPITFWFSPEKGFAMLIGVWNSAIWAGGLTAILVNTPGTPASIATTFDGFALTKLGKAK
FT                   LALQINTVFSVFGGLFSTLILIVAAFPLAKLAIKFGPAEYFMLGLFGLTMMISVSGNSL
FT                   TKGALMGFAGLLVSTIGLDPILAAKRFTFGITDLLMGVSFIPVMIGMFGVGEVLYQISV
FT                   SKSDDFIERDENASDKPIDLGKDHLTLKMIWEMGPLAFLMAAVATVVGAIPAAGGDIAS
FT                   IICWGQAKRLSRHPEKYGKGSEEGLATSCIANNGVLGGALTTMLTLGIPGDAATAIMIG
FT                   SLMMYGMQPGPRMFVENKEFVITIMLLMIFANIIILLYGLLTTKASIKLLSVKKQFIWV
FT                   TVLILCIVGSFALNNSMFDVVVMLIAGFLGFFMKRMDYAPGPFILGLLLGKIIESNLRR
FT                   ALSLTQGSYSFLLTHPIVIVLEVLIILALIGPLVKKLRNGRKAVA"
FT   gene            77737..78747
FT                   /locus_tag="Spirs_0071"
FT   CDS_pept        77737..78747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0071"
FT                   /product="Glycerone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /note="COGs: COG2376 Dihydroxyacetone kinase; InterPro
FT                   IPR004006; KEGG: oan:Oant_4368 glycerone kinase; PFAM: Dak
FT                   kinase; PRIAM: Glycerone kinase; SPTR: Glycerone kinase;
FT                   PFAM: Dak1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79231"
FT                   /db_xref="GOA:E1R6U9"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U9"
FT                   /protein_id="ADK79231.1"
FT                   /translation="MKKFLNAPEAFVDEMLEGIMAAHPDQMSYVNDDIRCVVRKDLSKK
FT                   KVALASGGGSGHLPTFMGYVGEGMLDGCPVGGVFQSPSSDQMYEVTKAIDRGAGVLYIY
FT                   GNYSGDIINFDMAAELADFDDIRVETVVAADDVASAPKSETEKRRGVAGIFYLFKIAGA
FT                   AAEAGMDMDEVKRVAEKVNGRVATMGVALSPCIIPDVGKPSFTIGEDEMEIGMGIHGEP
FT                   GIRRGKLRSADEVVNEILPKLIDDLSPESGSEVSILVNGLGATPKEELYIIYRRIAQVL
FT                   KERGLKPVKIYCGEFATSMEMAGFSISMICLDDELKKFLAAPACTPFFEQGELEL"
FT   gene            78750..79388
FT                   /locus_tag="Spirs_0072"
FT   CDS_pept        78750..79388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0072"
FT                   /product="Dak phosphatase"
FT                   /note="COGs: COG2376 Dihydroxyacetone kinase; InterPro
FT                   IPR004007; KEGG: oan:Oant_4367 Dak phosphatase; PFAM: Dak
FT                   phosphatase; SPTR: Dak phosphatase; PFAM: DAK2 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79232"
FT                   /db_xref="GOA:E1R6V0"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6V0"
FT                   /protein_id="ADK79232.1"
FT                   /translation="MAERTKERAAVDAVLASISGIMSENREFLIKIDGVIGDGDLGITM
FT                   DKAFSAAAEGVVSLDEPQVPKALIEAGKIMAKNAPSTMGTLMATGFMYGGKALGEEEML
FT                   SAGGLYAFFKGFLEGVEKRGKAKPGEKTLLDVLDPVVRALEAKQEADLSDALEAAMKAA
FT                   EEGLKATEKMVSQHGKAAVYREQTLGKQDPGATAMLFVVKGFREALTTL"
FT   gene            79576..80136
FT                   /locus_tag="Spirs_0073"
FT   CDS_pept        79576..80136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0073"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="COGs: COG0655 Multimeric flavodoxin WrbA; InterPro
FT                   IPR005025; KEGG: dsa:Desal_2222 NADPH-dependent FMN
FT                   reductase; PFAM: NADPH-dependent FMN reductase; SPTR:
FT                   NADPH-dependent FMN reductase; PFAM: NADPH-dependent FMN
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79233"
FT                   /db_xref="GOA:E1R6V1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6V1"
FT                   /protein_id="ADK79233.1"
FT                   /translation="MKILTILGSPKKNGKTAFVLNFFEEKIKEKGIAAKRINIIDYNVG
FT                   GCKGCMACVQKKNEPGCVQKDDVPALFKELIRADMIVYASPLYGWDVSSQMKTFFDRHF
FT                   CLVKDYKTPEHFSLLENKDIFTLTTCMGEKVGNTDLLSIFYDRFAGMLGCRSLKQFVVT
FT                   QSFSPDFSERAEEVAQRMANEII"
FT   gene            80123..80977
FT                   /locus_tag="Spirs_0074"
FT   CDS_pept        80123..80977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0074"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog; InterPro
FT                   IPR014284:IPR007627; KEGG: psl:Psta_4074 RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily; PFAM: sigma-70 region 2
FT                   domain protein; SPTR: RNA polymerase sigma factor; TIGRFAM:
FT                   RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 2; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79234"
FT                   /db_xref="GOA:E1R6V2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6V2"
FT                   /protein_id="ADK79234.1"
FT                   /translation="MKLSECITAAKAGRYSALEALIKHNQDYLYNLVVRFLGNPLDAED
FT                   AVQEILIKMITRLSSFRGESSFRTWLYRITVNHVLNMKRSKHEEVFTSFEDHKLFIENL
FT                   PDNSLNGLLAYSEEKQQRMAEETKIQCQMGMLLCLERENRIIFILGAVMGIDSLTGSAV
FT                   MDITPETFRKRLSRSRKRLSNYMNGNCSLINTNGVCSCRKKTDILIQKGYVNPENRMFY
FT                   TTHLEKVMEHVKNYSQYADDMLEKRVDDSFREHPWLSLPASIVPLKDIIQSMEVSWDKS
FT                   KLL"
FT   gene            complement(81057..82031)
FT                   /locus_tag="Spirs_0075"
FT   CDS_pept        complement(81057..82031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0075"
FT                   /product="amidohydrolase 2"
FT                   /note="InterPro IPR006992; KEGG: bxe:Bxe_A2721
FT                   metal-dependent hydrolase; PFAM: amidohydrolase 2; SPTR:
FT                   Predicted metal-dependent hydrolase; PFAM: Amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79235"
FT                   /db_xref="GOA:E1R891"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1R891"
FT                   /protein_id="ADK79235.1"
FT                   /translation="MKTISKIDIHHHFFPKIYKAELKKSGQDQLINPSWKEEDSLRLMD
FT                   EGNISKAYLSLPFAPTYHTSIIEKGIVRECNESAAAIIRAYPDRFGAFASIPYMNIDNC
FT                   LKEIAYSLDVLNLDGIILYSNTEGEIPYPSDLDDLYSELDKRKAVVFVHPNTSAKKPLL
FT                   DAPAYKGDIEYYFDIARFIVAQLFNGTLEKYPNIRYILANGGGIVPFYAQRISKPYYLN
FT                   GKRLRWGRIIKDMSRRKNSGEELLSNLYYETATVLERDFISALKNMVDSEHILFGSNYG
FT                   ENQRNDLNISIDQLILDGILNEPEAYAVFSLNAKRLLEEKPHR"
FT   gene            complement(82046..82996)
FT                   /locus_tag="Spirs_0076"
FT   CDS_pept        complement(82046..82996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0076"
FT                   /product="amidohydrolase 2"
FT                   /note="InterPro IPR006992; KEGG: bur:Bcep18194_B2954
FT                   amidohydrolase 2; PFAM: amidohydrolase 2; SPTR:
FT                   Amidohydrolase 2; PFAM: Amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79236"
FT                   /db_xref="GOA:E1R892"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1R892"
FT                   /protein_id="ADK79236.1"
FT                   /translation="MRKHEEKHRKIDVHAHMIPEFYVKKMKKRGINGPLWNNFPRWSPE
FT                   KDMKVMRHNGIAKRILSLSIPGVWVEEKGGDIVFAKELARECNEYASQIKKSFPDYYGA
FT                   FATIPFPNTSGTIEEIEYALDVLKLDGITLFTNTGGRYPGEDEFQAIFSELDARKAIVF
FT                   IHPEDIPLEYGEYSILAPLIDRLLDTGRSMAHLLTQDVLSSYPNVRYILSHGGGSFPLI
FT                   IKWMEYYNQIHQEDYQKIKSRLFFDTAQQGNFLYRYLKGFCGTSQIVFGTDGGWQSPVQ
FT                   VAQTVKAFDTSRHFNSADFEAIEWKNVQRLFPNND"
FT   gene            83108..83692
FT                   /locus_tag="Spirs_0077"
FT   CDS_pept        83108..83692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0077"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="COGs: COG1309 Transcriptional regulator; InterPro
FT                   IPR001647; KEGG: bpf:BpOF4_12170 TetR family
FT                   transcriptional regulator; PFAM: regulatory protein TetR;
FT                   SPTR: Transcriptional regulator (TetR family); PFAM:
FT                   Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79237"
FT                   /db_xref="GOA:E1R893"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E1R893"
FT                   /protein_id="ADK79237.1"
FT                   /translation="MTGHEKRTLKKKENIKNASIELFSLYGIKKVSMNEIAEKAQVSKV
FT                   SIYKYFNSKDDLIRYVIKAVSSEILSDINNIIESENPFPEKVKMIIMNKNQGLKFLRGD
FT                   FFTELLSLDEVLNNYYEHEFKEKANSLMSKFIELGKTSGFIDKKVKTATILTYIHIFQK
FT                   GVESNIGTLSGRDDISELIQLFFFGILSKQK"
FT   gene            complement(83815..83964)
FT                   /locus_tag="Spirs_0078"
FT   CDS_pept        complement(83815..83964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0078"
FT                   /product="sensor histidine kinase"
FT                   /note="KEGG: ccv:CCV52592_0501 sensor histidine kinase;
FT                   SPTR: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79238"
FT                   /db_xref="GOA:E1R894"
FT                   /db_xref="UniProtKB/TrEMBL:E1R894"
FT                   /protein_id="ADK79238.1"
FT                   /translation="MNLLINAGILTYINLISIHEMSITTYTYTKDLDLYALKPQWLNSD
FT                   RSLL"
FT   gene            84057..84623
FT                   /locus_tag="Spirs_0079"
FT   CDS_pept        84057..84623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0079"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="COGs: COG1309 Transcriptional regulator; InterPro
FT                   IPR001647; KEGG: rpe:RPE_3675 TetR family transcriptional
FT                   regulator; PFAM: regulatory protein TetR; SPTR:
FT                   Transcriptional regulator, TetR family; PFAM: Bacterial
FT                   regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79239"
FT                   /db_xref="GOA:E1R895"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E1R895"
FT                   /protein_id="ADK79239.1"
FT                   /translation="MSSRPLISACALKLFAERGYDAVGVQEIVDAAGITKPSLYHHFGS
FT                   KKGLLEQLIAPLFQEVNEALARAASYHHDLPRNLDQAAACFFSFAEKQPLFSRLMLSMI
FT                   HAPLKSEARLVVQPWLEEQYHTFENLFRLASGDHGNMKGRSKPFAATFLGMLHTYVSLF
FT                   LDGNTDFDERVRHEAVRQFSYGIYS"
FT   gene            84638..85978
FT                   /locus_tag="Spirs_0080"
FT   CDS_pept        84638..85978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0080"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase; InterPro
FT                   IPR006589:IPR006047; KEGG: hau:Haur_2435 alpha amylase
FT                   catalytic region; PFAM: alpha amylase catalytic region;
FT                   SMART: alpha amylase catalytic sub domain; SPTR: Putative
FT                   uncharacterized protein; PFAM: Alpha amylase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79240"
FT                   /db_xref="GOA:E1R896"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:E1R896"
FT                   /protein_id="ADK79240.1"
FT                   /translation="MSSWWNDARIYHIFPMGFCGAPHTNDFSSPAEHRILKIIDWLDPI
FT                   RRMGFDTILLGPVFESTSHGYDTVDFYHIDRRLGNNESFAGFAEEVHRRGMRLMLDGVF
FT                   NHVGRDFWAFYDLRQKGAASDYVSWFDGVSFSSPGFGDDGFSYTGWEGHQELVQLALSN
FT                   TEVKDHLFGAIRAMRERFGVDGLRLDVAYNLDEGFLRKLAGFCRSLDPDFTLLGEVIHG
FT                   DYGRYLHSNGLDSVTNYECYKGIYSSHNDGNFFEIAWSLNRLFGEEGLCHGLPLFNFVD
FT                   NHDVSRIASILKDRADLPTVYALLCTIPGVPSLYYGSEWESPGVKESGSDWNLRPPAEQ
FT                   IERSGSRLPELIRGLLSLRNGHPALCRGDYRQVHVASRQLAFVRNYGDDWVLILLNSAD
FT                   RSVPIPLKEVPLRELRDTLTGEIAGAQPELGPKSFRIFSTQGPEERV"
FT   gene            complement(85975..86556)
FT                   /locus_tag="Spirs_0081"
FT   CDS_pept        complement(85975..86556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0081"
FT                   /product="pentapeptide repeat protein"
FT                   /note="InterPro IPR001646; KEGG: cli:Clim_1473 pentapeptide
FT                   repeat protein; SPTR: Putative uncharacterized protein;
FT                   PFAM: Pentapeptide repeats (8 copies)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79241"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:E1R897"
FT                   /protein_id="ADK79241.1"
FT                   /translation="MISEKQYHCDAQFTQNDMVDMDFTDHTFENCSFSNCRFSELRMAG
FT                   TAFISCVFETCEFVVTEIQNVSFNDTLFDACKLLGINFTNCNDFGFSPRFKACLMKTVV
FT                   FNNKNLKSMPFESCEIVDCDFTESDLRDADFSNSFFKGTRFHQCDLRKADFRTARGYEI
FT                   NPITNKIVQARFTLPEAQSFLLFLGIDLGP"
FT   gene            86655..87179
FT                   /locus_tag="Spirs_0082"
FT   CDS_pept        86655..87179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0082"
FT                   /product="protein of unknown function DUF107"
FT                   /note="COGs: COG1585 Membrane protein implicated in
FT                   regulation of membrane protease activity; InterPro
FT                   IPR002810; KEGG: tde:TDE1505 hypothetical protein; PFAM:
FT                   protein of unknown function DUF107; SPTR: Membrane protein,
FT                   putative; PFAM: NfeD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79242"
FT                   /db_xref="GOA:E1R898"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:E1R898"
FT                   /protein_id="ADK79242.1"
FT                   /translation="MMFFSPPFVWGLIGVLLIAFEMVIPGFTIFFFGAGALLTALVSAV
FT                   VPPVASNIGSQLLLWAVSSVLSFAFLRRHFAKIFRGTVLNRSISNEGLGEVVTVLETIS
FT                   PDKPGRVRYRGTSWKAVSLTETFEPGNKAEIIEISGLTLTVTAPFEGIGRDEFLDRLED
FT                   PSSPKSGETTL"
FT   gene            87220..88134
FT                   /locus_tag="Spirs_0083"
FT   CDS_pept        87220..88134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0083"
FT                   /product="band 7 protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR001972:IPR001107;
FT                   KEGG: tde:TDE0705 SPFH domain-containing protein/band 7
FT                   family protein; PFAM: band 7 protein; SMART: band 7
FT                   protein; SPTR: SPFH domain/Band 7 family protein; PFAM:
FT                   SPFH domain / Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79243"
FT                   /db_xref="GOA:E1R899"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E1R899"
FT                   /protein_id="ADK79243.1"
FT                   /translation="MNVILAYLLAFVVIVIFFKLIRIVPEQEVYIIERFGKYEKSLGSG
FT                   LHLVIPFVQRVAYKHTLKEEVIDVDPQVCITADNVQVTVDGLLYLRVMDAEKASYGIDN
FT                   YRYATAQLAKTTMRSEIGKLDLDRSFSERDEINDAIVRAVDEASDPWGIKVTRYEIKDI
FT                   RPTDTIEQAMEQQMRAEREKRAEILASEGEKMSRINISQGDREAAINLSKGERQRRINE
FT                   AEGRSKAIEVTSVATAEGLQMIAEALQLPKGKAAMGLRLAEQYLTKFGSILDTAETTVL
FT                   PDDLARLKSLIDTVAPGIAGGKV"
FT   gene            88131..89051
FT                   /locus_tag="Spirs_0084"
FT   CDS_pept        88131..89051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0084"
FT                   /product="band 7 protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR001972:IPR001107;
FT                   KEGG: tde:TDE0704 SPFH domain-containing protein/band 7
FT                   family protein; PFAM: band 7 protein; SMART: band 7
FT                   protein; SPTR: SPFH domain/Band 7 family protein; PFAM:
FT                   SPFH domain / Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79244"
FT                   /db_xref="GOA:E1R8A0"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A0"
FT                   /protein_id="ADK79244.1"
FT                   /translation="MNPFLPLMVLIFLFGVVILVSLIRSVRIVPGKVALVVERLGKYSR
FT                   TLEAGFHVLVPFIERVKYRHGLKEVAVDVPAQDCFTQDNVKVRVDGVLYMKVVDARRAS
FT                   YGITNYQYATIQLAQTTMRSVIGRLELDKTFEERDAINAEVVKAVDEAADAWGVKVSRY
FT                   EIQNINVPSGILEAMEVQMRAEREKRAAIARSLGEKESKINYSQAEMEEAVNRSEGVKE
FT                   KMINEAEGKAQEILSLARATADGIKMVARSVANQGGEDALALRVAEGYIEELSKLAKQQ
FT                   TRVVVPMDVTDMAAMMTKVERMVKE"
FT   gene            89242..90681
FT                   /locus_tag="Spirs_0085"
FT   CDS_pept        89242..90681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1626 Neutral trehalase; InterPro IPR019775;
FT                   KEGG: tde:TDE0996 hypothetical protein; SPTR: Trehalase;
FT                   PFAM: Trehalase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79245"
FT                   /db_xref="GOA:E1R8A1"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A1"
FT                   /protein_id="ADK79245.1"
FT                   /translation="MHNSLISKKGFPIVHFYDQDFVDIYEKSWAWIEEAWYRNGEKNGL
FT                   QEQFFRYPGGDTINQAEACMSTFFLVYSNRLFSAFHNLDNFYGKQESDGAIRCTYRIDD
FT                   GNPVLTEENPLGVGPPLFALAEYNLFHKVGNKKRLKEIMPYLEAYYAWLELNFKDDTGL
FT                   YVVPAEASMMENAPRDRAVYLLDFNAQQAVNALYMSAIGDVLNDKEISFRYKRNYFSLK
FT                   TRINSQMWDEESGFYYDLDKEGKRLNEKMIGAYWTLLAEIPNEDKSNALIAHLKNPETF
FT                   GTEHPFPSLAVDSPHFTENGYGCRGSVYPSLNFVVIKGLEKYARYELAREASIRHLYFM
FT                   LDTLHPEGDKKGNLWEAYLPHKEGPALWPDSEDFPRPLYLPGIALSTITLMIENVLGLT
FT                   ISLPRKTVDWIVPTLEIMGIENLSLKRNMITILSNKSSRGWEIRLESEKLYYFTITVLD
FT                   EKKKKTLPIPSGKCSMLIDKL"
FT   gene            complement(90683..91270)
FT                   /locus_tag="Spirs_0086"
FT   CDS_pept        complement(90683..91270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0086"
FT                   /product="recombination protein RecR"
FT                   /note="COGs: COG0353 Recombinational DNA repair protein
FT                   (RecF pathway); InterPro
FT                   IPR000093:IPR006154:IPR015967:IPR006171; KEGG: tde:TDE1549
FT                   recombination protein RecR; PFAM: TOPRIM domain protein;
FT                   Zinc finger C4-type, RecR; SMART: Toprim sub domain
FT                   protein; SPTR: Recombination protein RecR; TIGRFAM:
FT                   recombination protein RecR; PFAM: Toprim domain; RecR
FT                   protein; TIGRFAM: recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79246"
FT                   /db_xref="GOA:E1R8A2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A2"
FT                   /protein_id="ADK79246.1"
FT                   /translation="MNQLERLIRSLSRLPGVGRKSAARIAHYLLKADSAFVTRLAEEIG
FT                   TLKERIHPCPVCGNFTEDELCSVCSDPRRDGTQICVVEEPQDVATIESTGEYNGLFHVL
FT                   GGAINPMNGVGPSDLSIDKLVKRASEGTVKEIIIATNPTVEGDTTALYLQNILKERPIE
FT                   VSRLASGLPVGGDLEYADKLTLARSFRGRTKL"
FT   gene            complement(91272..91604)
FT                   /locus_tag="Spirs_0087"
FT   CDS_pept        complement(91272..91604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG0718 conserved hypothetical protein;
FT                   InterPro IPR004401; KEGG: ddf:DEFDS_0142 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   BCR, YbaB family COG0718; TIGRFAM: conserved hypothetical
FT                   protein TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79247"
FT                   /db_xref="GOA:E1R8A3"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A3"
FT                   /protein_id="ADK79247.1"
FT                   /translation="MNPMDLFKNMQNLQSGMKDMQEQLKDIVVIGTAGGGMVVIEMNGQ
FT                   MQIIGVRIEREVVDPEDIGMLEDLVRAAFNDAFAKVREEMQNKLSGGLGNLNLPPDLLN
FT                   NLGNPG"
FT   gene            complement(91601..93346)
FT                   /locus_tag="Spirs_0088"
FT   CDS_pept        complement(91601..93346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0088"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /note="COGs: COG2812 DNA polymerase III gamma/tau subunits;
FT                   InterPro IPR001270:IPR012763:IPR003593:IPR003959; KEGG:
FT                   tde:TDE2586 DNA polymerase III subunits gamma and tau;
FT                   PFAM: AAA ATPase central domain protein; SMART: AAA ATPase;
FT                   SPTR: DNA polymerase III, gamma and tau subunits, putative;
FT                   TIGRFAM: DNA polymerase III, subunits gamma and tau; PFAM:
FT                   ATPase family associated with various cellular activities
FT                   (AAA); DNA polymerase III subunits gamma and tau domain
FT                   III; TIGRFAM: DNA polymerase III, delta' subunit; DNA
FT                   polymerase III, subunits gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79248"
FT                   /db_xref="GOA:E1R8A4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A4"
FT                   /protein_id="ADK79248.1"
FT                   /translation="MSYEVTATRKRPQGFETLVGQDFVVSTLSSAVSSGRIAHAYLFSG
FT                   PRGVGKTSAARLLAKALNCEKGPTPAPCGECSSCQEISRGNSLDVIEIDGASNTSVNDV
FT                   REIKDEVLFAPNSGRYKVYIIDEVHMLSNSAFNALLKTIEEPPPYIVFIFATTEIHKVP
FT                   ATIRSRCQQFNFRLIQPETIKNKLAEAAAELQIEAEDEALFWIAKEATGSLRDAYTLFD
FT                   QVASFSDKGITLEEIRQKLGLVGLERINGVAEALAEEDAGKAIELTESVLADGVAVEQF
FT                   IIDLTEYFRNLLFIRHGIKKEAVLGYSPERFSSKARDAWSVSQMETAIELLFTLYREIR
FT                   YSLNQRFELELVMSRLAGMRSYLSPKEVLHQIGKLRSELVEGKLPLGQQQVAGSDNDVP
FT                   ETEPPRSPQIREHAPPQEQVSQAADQSVSQKASNPVHEKSHSDSLSSEEGEEAPPKNSH
FT                   AVVGQTEQAEGPRNLSQEEIQQTIDSLRKTKPALVSALEKAGTWHLEGETLSIDFENGF
FT                   TVNFVRGEIPILADALLPVIGFRPAVKLNAISKEQQQEENDDTEVRLVTEVFRGEVIGP
FT                   KGEKK"
FT   gene            complement(93376..93485)
FT                   /locus_tag="Spirs_R0001"
FT   ncRNA           complement(93376..93485)
FT                   /locus_tag="Spirs_R0001"
FT                   /product="RNA component of signal recognition particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            complement(93503..93590)
FT                   /locus_tag="Spirs_R0002"
FT   tRNA            complement(93503..93590)
FT                   /locus_tag="Spirs_R0002"
FT                   /product="tRNA-Ser"
FT   gene            complement(93616..93702)
FT                   /locus_tag="Spirs_R0003"
FT   tRNA            complement(93616..93702)
FT                   /locus_tag="Spirs_R0003"
FT                   /product="tRNA-Ser"
FT   gene            complement(93714..93787)
FT                   /locus_tag="Spirs_R0004"
FT   tRNA            complement(93714..93787)
FT                   /locus_tag="Spirs_R0004"
FT                   /product="tRNA-Arg"
FT   gene            complement(93796..93883)
FT                   /locus_tag="Spirs_R0005"
FT   tRNA            complement(93796..93883)
FT                   /locus_tag="Spirs_R0005"
FT                   /product="tRNA-Ser"
FT   gene            complement(93901..93985)
FT                   /locus_tag="Spirs_R0006"
FT   tRNA            complement(93901..93985)
FT                   /locus_tag="Spirs_R0006"
FT                   /product="tRNA-Ser"
FT   gene            complement(94079..94924)
FT                   /locus_tag="Spirs_0089"
FT   CDS_pept        complement(94079..94924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0089"
FT                   /product="apurinic endonuclease Apn1"
FT                   /EC_number="3.1.21.2"
FT                   /note="COGs: COG0648 Endonuclease IV; InterPro
FT                   IPR001719:IPR012307:IPR018246; KEGG: nis:NIS_0286
FT                   endonuclease IV; PFAM: Xylose isomerase domain protein TIM
FT                   barrel; PRIAM: Deoxyribonuclease IV (phage-T(4)-induced);
FT                   SMART: AP endonuclease family 2; SPTR: Probable
FT                   endonuclease 4; TIGRFAM: apurinic endonuclease Apn1; PFAM:
FT                   Xylose isomerase-like TIM barrel; TIGRFAM: apurinic
FT                   endonuclease (APN1)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79249"
FT                   /db_xref="GOA:E1R8A5"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A5"
FT                   /protein_id="ADK79249.1"
FT                   /translation="MKYIGAHVSAAGGVEKAPLHAAEIGAGAFALFTKNQRQWKTKPLE
FT                   EHSIKAFSDHLSQVGISPDHVLPHDSYLINLGSPEEEKWQRAFDAFLDEVRRAEQLGLK
FT                   LLNFHPGSHLKKISEEECIGRIAKAMNRAIAETDSLVLVIENTAGQGSNIGYSFEQLGR
FT                   LVELTENKKRVGVCIDTCHAFAAGYDMRSREAYGHTMAHFDEVVGYSYLRGMHLNDAKS
FT                   EFGSRVDRHAPLGDGNIGIEAFRFLMEDSRLDDIPLILETPEPDRWAQEIKTLYDFAGT
FT                   "
FT   gene            complement(94928..95251)
FT                   /locus_tag="Spirs_0090"
FT   CDS_pept        complement(94928..95251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00046720 TBC domain containing
FT                   protein; SPTR: TBC domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79250"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A6"
FT                   /protein_id="ADK79250.1"
FT                   /translation="MDTINSLHDTFVQKLPDTIPADLLFKACSQSFLGKELETICGELV
FT                   DTLNADCSKKDYHLWDYDHLEFIIEQARRFHLFLPKNFVNGLPQQFVLRIEADHLYTPE
FT                   CRN"
FT   gene            95322..96872
FT                   /locus_tag="Spirs_0091"
FT   CDS_pept        95322..96872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0091"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG2509 Uncharacterized FAD-dependent
FT                   dehydrogenase; InterPro IPR006076; KEGG: shi:Shel_15100
FT                   FAD-dependent dehydrogenase; PFAM: FAD dependent
FT                   oxidoreductase; SPTR: FAD-dependent dehydrogenase; PFAM:
FT                   FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79251"
FT                   /db_xref="GOA:E1R8A7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A7"
FT                   /protein_id="ADK79251.1"
FT                   /translation="MGYKRYQLSLPTDYGEEDLLGLLRKKSGLTEFRYVIEKKSLDARQ
FT                   KREIHWLLSIVLISDQLSGEPWAAPAPLNVPKKRSPCHVVVVGSGPAGIFSALVLAEAG
FT                   CSVTVIERGSRIEKRKRDIDVFEADSTFPLCNNYAFGEGGAGAFSDGKLTSRSKHIGPE
FT                   RAFIHKAFIEAGAPEEIAWLAHPHLGSDNLFRITRALRAKVGTLGGSFAFDTFLEGFTR
FT                   LSGGGFRLSCKKSIGGEGSEIDGIECDYLIIACGHSADDTIAMMIHSGIPYRTKNFALG
FT                   FRVEHEQRVINHAQWGSSSLPGVKAAEYRLTAADNVYTFCMCPGGRVVPAAAFSDRNIV
FT                   NGMSNYYRDGRFANAAVVAGLHPDQLAGRPVSPPEALELLANLERRFVQTGNGYAAPAA
FT                   SISAFLAGKAPGMLPQESSYPFPLIPADPEALYPKFLLPRLRRGLAQFCSKIRGFDTGT
FT                   ILGLESRTSSSVQVLREQDGSIPQFPGLFVVGEASGWAGGIVSSAADGIRAAMTVVGS"
FT   gene            complement(96869..97747)
FT                   /locus_tag="Spirs_0092"
FT   CDS_pept        complement(96869..97747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0092"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="COGs: COG0776 Bacterial nucleoid DNA-binding
FT                   protein; InterPro IPR000119; KEGG: cbc:CbuK_1387 bacterial
FT                   DNA-binding protein; PFAM: histone family protein
FT                   DNA-binding protein; SMART: histone family protein
FT                   DNA-binding protein; SPTR: Bacterial DNA-binding protein;
FT                   PFAM: Bacterial DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79252"
FT                   /db_xref="GOA:E1R8A8"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A8"
FT                   /protein_id="ADK79252.1"
FT                   /translation="MNNDKQVVETMPKVIEQHLKGLAATLDFVDAEEGFSRLKQAWSEK
FT                   ERLFTGQTRLLEMAEIKELAEDDSRGCILLTNSGSLLSLFPHTGEGRAMEYASIPIRSD
FT                   VPDIIREQDVTYAPSLSVGNPAILHGAPIKKTSPVYRIAVCEEGVSPAEQAKRIREATI
FT                   FLTNGFARINRTIETPMAGKIEHFTKDRMAAYIAGRNDLTQLQVRRILDDFFSVVESGI
FT                   MLGERVSLGSLGKIGYRVRPPSKARIITVPATGEEMTIPAKPSRAVVKFSPSGRLKERA
FT                   EAIPIEEETDD"
FT   gene            97861..98385
FT                   /locus_tag="Spirs_0093"
FT   CDS_pept        97861..98385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctp:CTRG_05554 hypothetical protein; SPTR:
FT                   Whole genome shotgun sequence assembly, scaffold_14"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79253"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A9"
FT                   /protein_id="ADK79253.1"
FT                   /translation="MTDGNGIEGKIRDHLKLLVKTAGLPGNEDSLKQLENAWMEKMEAF
FT                   DSEVESRGMEVVDSFFADDERGALLMTYSGSLITLGPMVGAARSAAYRSIGIRNDVPES
FT                   IDSDAASLSGDVEVDSVVSFIDGPIEKSSPIFKIAVVSSDMAEEEQEELLAEATRILTE
FT                   SFVDVNKTIIQ"
FT   gene            98389..99417
FT                   /locus_tag="Spirs_0094"
FT   CDS_pept        98389..99417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0094"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR006186; KEGG: app:CAP2UW1_3783
FT                   metallophosphoesterase; SPTR: Metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79254"
FT                   /db_xref="GOA:E1R8B0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B0"
FT                   /protein_id="ADK79254.1"
FT                   /translation="MFFLPSIVTRRTLPPREAYLHIVKAATDKLKGEDQLVRPRDEHNR
FT                   PGGLIRLQEGITMIVPDLHARIPFLLHALVFPVEGRPFIDLMKEGSGTMVCVGDGLHSE
FT                   ARGYQRWQVALQELLEGFFRHEAMDEEMLEGLGQMELVMRLKLAFPDRFHFLKGNHENI
FT                   LNREGNGDHPFRKFVLEGEMVRVYLQKFYGDDFLKSYADFERALPLVAADGNFMVSHAE
FT                   PARSFSREEVIRYRSLDDVVEGLTWTPNDGSEEGSVQTMIESFCASPDQAVYFGGHRTI
FT                   EGRYSLRASGRFIQLHNPVSFQVALADSGRPFDPERDIVDVSGDPAALLERSELEISEE
FT                   TP"
FT   gene            99414..101030
FT                   /locus_tag="Spirs_0095"
FT   CDS_pept        99414..101030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0095"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR020635:IPR002290:IPR017442:IPR000719:IPR 008271;
FT                   KEGG: mxa:MXAN_6317 serine/threonine protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   subgroup, catalytic domain; SPTR: Serine/threonine protein
FT                   kinase PksC; PFAM: Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79255"
FT                   /db_xref="GOA:E1R8B1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B1"
FT                   /protein_id="ADK79255.1"
FT                   /translation="MNRPPEMIGKYKIIDLIATGGMGAVYKGVHPTLDCYVIIKKLTLR
FT                   GNPDFAERFRREAKILMDFRNDNIVDIYDHFKEGRSHYIVLEYIDGLSLEQLIRRERYL
FT                   SNDMALYIFREVCKALDYAHKRRVVHRDIKPANILISKKGEVKLVDFGIASSKEEDGEA
FT                   GLTRDGMTLGSPSYMAPEQFENSRNVDQRADIYSLGVMLYESVTGKKPYPGGYTADLIA
FT                   AITKGKHPAPRRLNPKVNRFVSSIVKKTMHPKPRRRYQNLTSLLRRLDRYFHRKPVEAL
FT                   KEQLKKAISGGTLESTPRKKLGKLRRFFSIALPVFFLLFLLLGSAYRSGWYQRLFLADS
FT                   YGELRIALHLDHSYKEPKDLYLRGWLFADTGEDGTALDIDPIHFRLLPSEEREGDLNFV
FT                   SRRVFLPSGDYRLKVQIENNLFWNTFRLHTIKEQHNLYQGEQGRTITLCTSSHTLPLSV
FT                   DFFVQDCDTWVDITPISLIELKTGGRWTPWSDELAEGLTTGSVYRFRISAPGYTEKEFS
FT                   LLIREDQSTLYLNPRLEKSKL"
FT   gene            101044..101919
FT                   /locus_tag="Spirs_0096"
FT   CDS_pept        101044..101919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0096"
FT                   /product="FHA domain containing protein"
FT                   /note="InterPro IPR000253; KEGG: rrs:RoseRS_3946
FT                   hypothetical protein; PFAM: Forkhead-associated protein;
FT                   SPTR: Putative uncharacterized protein; PFAM: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79256"
FT                   /db_xref="GOA:E1R8B2"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B2"
FT                   /protein_id="ADK79256.1"
FT                   /translation="MSIGLKRIIIIALGILAGAAAWPLMELVLSFQSLFPGYFIFSIVQ
FT                   GALFGLVLGLFFGSGEGLTSRNGKKLGHGLASGAAVGVIGGVVGFLFGQGVLFFILDKT
FT                   SNYLAVPVARGIGWALLGLFVGAVDGIRVRSLRKTAIGALGGIIGGAAGGAAIELIRLH
FT                   FSELLMIRAVGFILFGLLVGIGYAVAERSFSFGILHVLNGPQRGREYSLSQSSFFVGTS
FT                   SSNDISAEGYHDIEPRHIRFYSKRKELYIKDISGKAGTKVNEEPLRGERLLKYEDVIQV
FT                   GSLKICYLTE"
FT   sig_peptide     101044..101106
FT                   /locus_tag="Spirs_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            101939..103363
FT                   /locus_tag="Spirs_0097"
FT   CDS_pept        101939..103363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0097"
FT                   /product="von Willebrand factor type A"
FT                   /note="InterPro IPR002035; KEGG: amt:Amet_1755 von
FT                   Willebrand factor, type A; PFAM: von Willebrand factor type
FT                   A; SMART: von Willebrand factor type A; SPTR: von
FT                   Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79257"
FT                   /db_xref="GOA:E1R8B3"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B3"
FT                   /protein_id="ADK79257.1"
FT                   /translation="MNRFAAVVCITVFLAPAFTLSAETLQITQIDSSSLLLSQSVDLYV
FT                   SLTDDTGTPLKGISGDSFQLFESDDPDTFSEPMLIRSLAPNPHESQGLSILLLMDNSGS
FT                   MYDTLSGDPTGDPALMRTTYARNALRTFVGSSFHAGDSVSFATFNTNVVLHADEAGDPV
FT                   VMDMLLSGIRRPGTDESYTELYHALADMALPVGERSGRRAVIVLSDGEDYSYATHSGNP
FT                   HPIYGNQQLSPDEVVEEYIRNGVTLYAIHFGLEKDQYLGEMALKTGGAVYDAKDQEELT
FT                   GIYHDIRQKIDGEYLIRYRAGMFPADKTYVKLIHKSPEGNSEAVRYYYTSTMFGRPVVP
FT                   FPWKIFLILPAVLLIWLLLLLIRNRTFHSDAALRILRAGYGTKISSATIAIQQEKTVIG
FT                   GGEQADLTLSGRGVPHDRDVTIVFDKQQKNYTIVGGAGVSVNNQPLKGERRLSGGDVLN
FT                   IEGTTIVFEEPDEGKN"
FT   sig_peptide     101939..102004
FT                   /locus_tag="Spirs_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(103360..104226)
FT                   /locus_tag="Spirs_0098"
FT   CDS_pept        complement(103360..104226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0098"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: gau:GAU_0613 hypothetical
FT                   membrane protein; PFAM: protein of unknown function DUF6
FT                   transmembrane; SPTR: Hypothetical membrane protein; PFAM:
FT                   EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79258"
FT                   /db_xref="GOA:E1R8B4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B4"
FT                   /protein_id="ADK79258.1"
FT                   /translation="MTHLMLIAAAFIWGINPMIMKIGLATIDPLRYNTLRLLLAFLVSL
FT                   IFVLLGRRWKPVAKEDRKRFIAVGLGGFFIFQGGYTFGVHDTAASISAIILALLPVFVA
FT                   VISIVTRQEKITVKKALGIALSVLGVLAITAGGEAVSVKGTYLRGVLLLVIAEFAYAVY
FT                   TVYVRPLTKRYSIEQIVCIVIFIVLLPFLLISLPVFLRSGLFFPTLAESFSIGYAGTFG
FT                   ILIGNVLWSHGVKRIGSTGTSMYSNLSPIFGVIAGFLVLAERLAPLQIAGGAAVLLGVW
FT                   VVNRKKA"
FT   gene            complement(104240..105202)
FT                   /locus_tag="Spirs_0099"
FT   CDS_pept        complement(104240..105202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0099"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR000086:IPR020084; KEGG: dat:HRM2_01950
FT                   MutT family protein, putative 78-dihydro-8-oxoguanine
FT                   triphosphatase (8-oxo-dGTPase); PFAM: NUDIX hydrolase;
FT                   SPTR: MutT family protein, putative 78-dihydro-8-oxoguanine
FT                   triphosphatase (8-oxo-dGTPase); PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79259"
FT                   /db_xref="GOA:E1R8B5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B5"
FT                   /protein_id="ADK79259.1"
FT                   /translation="MLAEKLSTPIYYLMLSIMILNLFQRKHMATGEKKRFATLWLAGTL
FT                   LILQIEIGLLAANKQPDWMLIPAFALYAVILFLLRKKIFVFRRTCASCGAPLASREFIG
FT                   RDDNLCANCAPTPEGEEKPEEEKEEKPQPITIAPPEIDEENRHTLGKGTPREEIPRDTD
FT                   GIDWDAWEFAEKAVLCYLFRGDEVLLIHKKTGLGRGLVNAPGGRIEAAEMPMDAAIREM
FT                   QEETGITPKELKEVASLHFIFTDGYSLKGTVFFAYDHEGEARATDEADPFWTPVGEIPF
FT                   DKMWEDDALWLPKVLEGKRVSGYFIFEDEAMVSQKIIES"
FT   gene            105282..106430
FT                   /locus_tag="Spirs_0100"
FT   CDS_pept        105282..106430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0100"
FT                   /product="thymidine kinase"
FT                   /note="COGs: COG1435 Thymidine kinase; KEGG: bdu:BDU_798
FT                   thymidine kinase; SPTR: Thymidine kinase; PFAM: Thymidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79260"
FT                   /db_xref="GOA:E1R8B6"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B6"
FT                   /protein_id="ADK79260.1"
FT                   /translation="MNEVKNNPETISFLKSLGFPSVRVHHSFNHFDFSRPDRRILVIGP
FT                   MGSGKTEYSARVWRDAQVALTKSETIARETSTDGADRRKVFFIRSLLDTQRFPDYPEDA
FT                   LAYRGGYERCGDYIARISDSFALEKLVHDMPEIGTWIVDEASFYDERLVYVVRNECQRR
FT                   GLIFIFPALILNFRRDIFNPTARLMLETATDVFPLTAYCEHPDCLEDSFYTYRYYQIDG
FT                   EECPALYFDPLIVIGGDRKKEDAVEPNYCTRCDRHHYLPGKEYTFFTLKPLGQQASGGN
FT                   SDPLKRELAALQERKGNSLLARHLRDKFGHDEEQRVNLNALKVARIAERALIYLYAEQN
FT                   LIPEELLLKLVNELGLDRVYMKKTLSENGRLVNLDQQILDGF"
FT   gene            complement(106440..106844)
FT                   /locus_tag="Spirs_0101"
FT   CDS_pept        complement(106440..106844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0101"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="COGs: COG2703 Hemerythrin; InterPro
FT                   IPR012827:IPR012312:IPR016131; KEGG: dsa:Desal_0057
FT                   hemerythrin-like metal-binding protein; PFAM: Hemerythrin
FT                   HHE cation binding domain protein; SPTR: Hemerythrin-like
FT                   metal-binding protein; TIGRFAM: hemerythrin-like
FT                   metal-binding protein; PFAM: Hemerythrin HHE cation binding
FT                   domain; TIGRFAM: hemerythrin-like metal-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79261"
FT                   /db_xref="GOA:E1R8B7"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B7"
FT                   /protein_id="ADK79261.1"
FT                   /translation="MSLITWNSDYELGIPGIDAQHKKFVEILNTFYDQLAASDIESKTK
FT                   TLLDEVLDYTLYHFIEEERFMTKMGYEKLEEHKRLHEEIRGKIQAFRTSMDEGKLVMSM
FT                   KITSELKDWIKNHILIEDKKYAEKYLQTQQ"
FT   gene            complement(106846..107262)
FT                   /locus_tag="Spirs_0102"
FT   CDS_pept        complement(106846..107262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0102"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="COGs: COG2703 Hemerythrin; InterPro
FT                   IPR012827:IPR012312; KEGG: gem:GM21_3958 hemerythrin-like
FT                   metal-binding protein; PFAM: Hemerythrin HHE cation binding
FT                   domain protein; SPTR: Hemerythrin-like metal-binding
FT                   protein; TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain; TIGRFAM:
FT                   hemerythrin-like metal-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79262"
FT                   /db_xref="GOA:E1R8B8"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B8"
FT                   /protein_id="ADK79262.1"
FT                   /translation="MGFMAWSSKFELGIPEMDEQHKKWLEILNSFYDHLSDKDLTTQMK
FT                   GLIQDVIDYTQYHFSEEEKLMASIGYHELNQQKQMHKEITDKIIRFKQRLDAGNLVIST
FT                   AVTSELKSWFKEHIMVEDKKYAEKYFQVTQKGGI"
FT   gene            107373..108086
FT                   /locus_tag="Spirs_0103"
FT   CDS_pept        107373..108086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0103"
FT                   /product="DNA alkylation repair enzyme"
FT                   /note="COGs: COG4912 DNA alkylation repair protein;
FT                   InterPro IPR014825; KEGG: mma:MM_0566 hypothetical protein;
FT                   PFAM: DNA alkylation repair enzyme; SPTR: Putative
FT                   uncharacterized protein; PFAM: DNA alkylation repair
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79263"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B9"
FT                   /protein_id="ADK79263.1"
FT                   /translation="MEGNVVEFVRNELALHGDDSVRESGKRFFKEETKSYGVKTSVVTK
FT                   IAKSGFRELKGLDKNTILALCEELWKSGYMEESFIACHWAYALRETFIPDDFVIFEGWV
FT                   EHYVSNWASCDTLCNHTVGAFVEMYPEYIENLKRWAKSEGRWMRRAAAVSLIIPARSGL
FT                   FLEDIFEIADTLLLDQDDLVQKGYGWMLKAASQAHQREVYDYVMSKKAMMPRTSLRYAI
FT                   EKMPKELRVKAMAKQ"
FT   gene            complement(108090..108626)
FT                   /locus_tag="Spirs_0104"
FT   CDS_pept        complement(108090..108626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0104"
FT                   /product="protein of unknown function DUF1697"
FT                   /note="COGs: COG3797 conserved hypothetical protein;
FT                   InterPro IPR012545; KEGG: sna:Snas_5447 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1697; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1697)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79264"
FT                   /db_xref="InterPro:IPR012545"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C0"
FT                   /protein_id="ADK79264.1"
FT                   /translation="MNQYAAFLKGVNVGGKNRLSMAELREAMERHGFSAPKTYINSGNI
FT                   LFFHNAEKSEVKKELQDMIEQAFGLTIEVVVKTKEEINDTLQSDPFDTTTETEPAKKMV
FT                   MMLTSKVDPERFASIEADDKIIEKTYERGDLLYIYYRNGAGRSKLTIDYVEKVLGTSCT
FT                   ARNWNTLLKMKEILE"
FT   gene            complement(108623..108964)
FT                   /locus_tag="Spirs_0105"
FT   CDS_pept        complement(108623..108964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0105"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="InterPro IPR001450:IPR017896; KEGG: dhd:Dhaf_2058
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79265"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C1"
FT                   /protein_id="ADK79265.1"
FT                   /translation="MNSPRMLPNPPTPNEPIQFASDICNGCNLCVNICRSDVLMPHPEK
FT                   GKPPIVLYPDECWYCGTCVLECNRKGAIKLVHPMNQSVTVIWKRKATGENFRLGMKHPP
FT                   APNTRKPCS"
FT   gene            complement(108961..110961)
FT                   /locus_tag="Spirs_0106"
FT   CDS_pept        complement(108961..110961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0106"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit; InterPro IPR006076; KEGG:
FT                   pen:PSEEN0175 putative oxidoreductase; PFAM: FAD dependent
FT                   oxidoreductase; SPTR: Predicted protein; PFAM: domain; FAD
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79266"
FT                   /db_xref="GOA:E1R8C2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C2"
FT                   /protein_id="ADK79266.1"
FT                   /translation="MSTWHEYLNEGNPVPLWPYPVNYGRENRLSTDVLIFGGGIAGSHA
FT                   AIGARKAGARVLVVEKEATKWSGNGGAGVDHWLSACTNPCSKITPEEYTKRVLIDCGGY
FT                   DCGPLRYISSRESWEALLDCESMGVKIRDTDEEFKGAAFRDEETGLLFAYDYENRCEIR
FT                   VWGHNIKPSLYKGMRKLGVEILDRVMITAFLVEGEGASRRVCGAMGIHTRTGEFYIIEA
FT                   KAVVLATGLPGRIWNFSTEYRSTFRDPNCTGEGVSAAWRAGAEFTRLEESFPDSGTLAY
FT                   ISYAVGNAHNTWHGCPIVDANGKEIPWVDRDDKELSSIEERFRPAQGQRFMLGDGLRVP
FT                   PSYENQNKKLAPDLPDRIRSGEFVLPLYADLSRMPEKERRAIFGLMVGNEGRTRIPVYE
FT                   TLTKAGFDPDKDMLAVPVMDPSAYCHSNFWAGVGAPQWRMWGCGGVVVDWDLRTNLEGL
FT                   YAAGGAVFGAGAHSGAAASGRFAGRRAADFASSAEEVPVDDEQIKREKKRVYAPLNPEG
FT                   HPIGWKELNAGIGRVMQDYCGQFKSEGGLSEGLRLIGEIRESEAASVSAANPHELIHAV
FT                   ECLAMLDVCEAVIHASLARKASSDYLCFNRIDYPRMDPPEWRKLIALRKGKEGAEIRDL
FT                   PFDYFLKDSNAPSLEENYLAHGGLSGKEAHK"
FT   gene            111240..111551
FT                   /pseudo
FT                   /locus_tag="Spirs_0107"
FT   gene            complement(111582..112223)
FT                   /locus_tag="Spirs_0108"
FT   CDS_pept        complement(111582..112223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: neu:NE2494 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79267"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C3"
FT                   /protein_id="ADK79267.1"
FT                   /translation="MYRFEPIPGIFYGRFDRMVTYPAVLSMVHQYEESKESKEIEKLCL
FT                   TDEGYQPFRIYDFDGDFSILKNPLKIFFKTLWDGVLHLSIIRKRIGSLDDYYDDFVRTN
FT                   TKDMCPYCGLYLIDEVDVKTWEAFDHYVLKRIYPFLSVDFKNLASMCNKCNSGNKGNKD
FT                   PLHDSSNNRKKAFYLFKEDYGQIEIKVTLAHGDYENLFLRLVMRKVCLDR"
FT   gene            112226..112581
FT                   /pseudo
FT                   /locus_tag="Spirs_0109"
FT   gene            complement(112595..113878)
FT                   /locus_tag="Spirs_0110"
FT   CDS_pept        complement(112595..113878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0110"
FT                   /product="Amidohydrolase 3"
FT                   /note="COGs: COG0402 Cytosine deaminase and related
FT                   metal-dependent hydrolase; InterPro IPR013108; KEGG:
FT                   mta:Moth_0460 amidohydrolase; PFAM: Amidohydrolase 3; SPTR:
FT                   Amidohydrolase; PFAM: Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79268"
FT                   /db_xref="GOA:E1R8C4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C4"
FT                   /protein_id="ADK79268.1"
FT                   /translation="MVDLVLRNCAVDGEPELIDIAVDKGMIVNRGPSVPYPCRQAIDLK
FT                   GRLLIPGFIEPHLHLDIALMNEHDRPGRPAPFQSVLELNDILERRRKDFTRQDIEQRAG
FT                   RALEMASRHGVTAVRAQCHVDTEVGLKHVEALQAVKEKYAGRVSLQIVGFPQQGLLRDP
FT                   CTPDLFREAFKCGVDVMGCVANTDLTPEGRINVAGHIDMAFKLAMEHDVDLDTHVDLTI
FT                   PRSIGFDDFEAVYLAKKTLEVGYQGRVTAGHLCSLGSAEPDVAQRVIELLNEARISVIS
FT                   QPDMYRLARQDDVHVRRGLTRVKELLDGGVNVTLASNNVRDVLRPVGNFNLLEEALILS
FT                   YGAHMDSIDQLDTLMRMATYGGAKAIGLEDYGLQPGCKADMVVLDAPTLSAAIVGQVEK
FT                   NYVFKGGCLMAASHTITERFNKASHNLR"
FT   gene            complement(114950..116146)
FT                   /locus_tag="Spirs_0111"
FT   CDS_pept        complement(114950..116146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0111"
FT                   /product="carbamoyltransferase YgeW"
FT                   /note="COGs: COG0078 Ornithine carbamoyltransferase;
FT                   InterProIPR006130:IPR002082:IPR017702:IPR006132:IPR 006131;
FT                   KEGG: efa:EF2577 aspartate/ornithine carbamoyltransferase
FT                   family protein; PFAM: aspartate/ornithine
FT                   carbamoyltransferase carbamoyl-P binding domain;
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; SPTR: Aspartate/ornithine carbamoyltransferase
FT                   family protein; TIGRFAM: carbamoyltransferase YgeW; PFAM:
FT                   Aspartate/ornithine carbamoyltransferase, carbamoyl-P
FT                   binding domain; Aspartate/ornithine carbamoyltransferase,
FT                   Asp/Orn binding domain; TIGRFAM: probable
FT                   carbamoyltransferase YgeW"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79269"
FT                   /db_xref="GOA:E1R8C5"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR017702"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C5"
FT                   /protein_id="ADK79269.1"
FT                   /translation="MDRIGIKEKIKSLSRLRTEDMYLNDFFHTWKKSDQEIKAVFEVAD
FT                   ILRGMRNNNISTRLFDSGLGISLFRDNSTRTRFSYASACNMLGLEVQDLDEGKSQVAHG
FT                   ETVRETANMISFMADVIGIRDDMYIGKGHTYMKEVAASVQAGYDAGILEQRPTLVNLQC
FT                   DIDHPTQSMADALHLINHFGGIENLKGKKIAMTWAYSPSYGKPLSVPQGIMGLMSRFGM
FT                   AVTLAHPEGYEVMPEVEKIAEINSAKSGGTFSKTNSMAEAFKDADIVYPKSWAPFKAME
FT                   KRTGLYGKGDFDGIDKLEKELLGQNADHKDWECTEELMNSTKEGKALYMHCLPADITDV
FT                   SCEKGEVAASVFDRYRDPLYKQASFKPYIIAAMIFLSKVKNPADRLDTILNANLPRIV"
FT   gene            complement(116187..117647)
FT                   /locus_tag="Spirs_0112"
FT   CDS_pept        complement(116187..117647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0112"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="COGs: COG0031 Cysteine synthase; InterPro IPR001926;
FT                   KEGG: pmo:Pmob_1727 pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   SPTR: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; PFAM: Pyridoxal-phosphate dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79270"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C6"
FT                   /protein_id="ADK79270.1"
FT                   /translation="MIDLTTNEEQIQKNAIRCKEQGILFPTFAEMREPETISEDIKKKL
FT                   KDVGLWDVNSLNLYRVNWQNEPKKFGGGFGDVNYMELPSSLTGTRARILALVGKWFPTG
FT                   AHKVGASYSCLAPRLVTGQFNPMKEKAVWPSTGNYCRGGAYISRLLACDSIAILPEEMS
FT                   QERFDWLKNIAGETIATPGCESNVKEIFDKCRELTESRGDTIEIFNQFDQFPNHLWHYE
FT                   VTGHSMEKVLKKAMGEDSRFAGTCLSSGSSGTLGSGEYLKTLYPKAKLSVAEALQCPTL
FT                   YNNGFGGHRIEGIGDKHVPWIHNLKNTDMVIAIDDEQTIRLLRLFNEPVGREYLKENGV
FT                   PAELLDQLDLLGISSIGNLIGTIKMAKYYELTEEDVLMTIFTDSFEMYESRLKELEEAR
FT                   GAYTREDAIRDYELINQVTFDHTMELSYQEQKRIHNLKYYTWVEQQDKTYDEINAQWYD
FT                   HDYWTNLYKVTPKLDELIIDFNRRIKAL"
FT   gene            complement(117651..118865)
FT                   /locus_tag="Spirs_0113"
FT   CDS_pept        complement(117651..118865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0113"
FT                   /product="peptidase M20"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro IPR002933:IPR011650:IPR001261;
FT                   KEGG: kol:Kole_2070 M20/DapE family protein YgeY; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; SPTR:
FT                   Peptidase; PFAM: Peptidase family M20/M25/M40; Peptidase
FT                   dimerisation domain; TIGRFAM: putative selenium metabolism
FT                   hydrolase; M20/DapE family protein YgeY"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79271"
FT                   /db_xref="GOA:E1R8C7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017706"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C7"
FT                   /protein_id="ADK79271.1"
FT                   /translation="MKQEILRKAEEYRDYVAQTLSEMVKIPSYSGKEEAICKRIKEICE
FT                   DAGFDEVRTDKLGSVIARIGNGPKSIAFDAHIDTVEIGDPDQWEKEPFSGLIADGLVHG
FT                   RGSSDQKGGAASMITAGRILKDINYNGQFTIYFTFTVMEEDCDGMCWKYLIEEEKLKPD
FT                   FYVSTEPTSTRIYRGHRGRMEMMVRLKGISAHGSAPERGESAAYKAARAALAMEKLNKD
FT                   LQPDEDNFLGKGTIVVSQIDVKGPSQCAVPDQAMLYLDRRLTWGEDADLAIGQVKEYIG
FT                   KALDCPPEEIDVTMPEYTKRGYRDYDYSQELYFPTWKMDADHPLVESGVDAYKTLWGKD
FT                   PVVDKWTFSTNAVATTGRHKIPAIGFGPGDESQAHAPNEINRIEDLVICAAFYAMLPYS
FT                   LEKRI"
FT   gene            119253..119996
FT                   /locus_tag="Spirs_0114"
FT   CDS_pept        119253..119996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0114"
FT                   /product="Hydantoin racemase"
FT                   /note="COGs: COG4126 Hydantoin racemase; InterPro
FT                   IPR015942; KEGG: rpf:Rpic12D_1297 Asp/Glu/hydantoin
FT                   racemase; PFAM: Asp/Glu/hydantoin racemase; PRIAM:
FT                   Hydantoin racemase; SPTR: Putative uncharacterized protein;
FT                   PFAM: Asp/Glu/Hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79272"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C8"
FT                   /protein_id="ADK79272.1"
FT                   /translation="MRCLIVNPNTSVHMTSSINHTMEELDKGDVSFDVISAEIGPESLE
FT                   SFYEYNLAASGVAYTLKKMDMQIYDGVLLACFGDPGLYGLKESLSCPVVGIAEASLSMS
FT                   LLLGYKFAIIVSLQKAVPMMINMVHQYGLGQRMAGVFPLNMPVLDLEKDKVSVIEKIRQ
FT                   VSRKAIIQGAETLILGCAGMTGIAKEVEKEMKVPVIDPVSAGFHSLKAIIESKLTTARH
FT                   GLYEPVPAKRIIGAEGRDSKYFGYF"
FT   gene            120206..121609
FT                   /locus_tag="Spirs_0115"
FT   CDS_pept        120206..121609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0115"
FT                   /product="dihydropyrimidinase"
FT                   /note="COGs: COG0044 Dihydroorotase and related cyclic
FT                   amidohydrolase; InterPro IPR011778:IPR006680; KEGG:
FT                   bcl:ABC3783 phenylhydantoinase; PFAM: amidohydrolase; SPTR:
FT                   D-hydantoinase; TIGRFAM: dihydropyrimidinase; PFAM:
FT                   Amidohydrolase family; TIGRFAM: D-hydantoinase;
FT                   dihydroorotase, multifunctional complex type"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79273"
FT                   /db_xref="GOA:E1R8C9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C9"
FT                   /protein_id="ADK79273.1"
FT                   /translation="MAAKKILIRGGTVVSESEIAPYDISIEGERIVAHGDKGQFDSESF
FT                   DEIVDADGLLVLPGLIDPHVHFDSPFMGSRTDHDFLTGTKAAAYGGVTTVISFSTQSKG
FT                   GSVLKNLEDQEKKALGQAYIDWSIHGILLDASEQTLSEIPELVNRGVPTYKCFTTYRHA
FT                   NRMVDDDGMLKILKATAENGGMLMVHCENDSIIEYRLKSEIEKGNTEWIYHALTRPRLA
FT                   ENISIQRIIDLMKVERAPVYIVHTSTSESAGIIHEARSQGAPLHSETCTHYLVLTEDEL
FT                   KKENGYLFICSPPLRTERDIDTLWTAARVGPIEVVSTDDAGLPVADQTRLAEGRFNKVP
FT                   SGMPGVEPRLTMLYTEGVRKGRISWPRLVSLTAGNPSRLFGLSPKKGSLAPGSDADVVL
FT                   FDPDVEWTMSAENLHMNTDFCPFEGRDVFGKPKTVLSRGEFVLRDYELIGTSKHGQRVI
FT                   RKLDSSYIY"
FT   gene            121640..122818
FT                   /locus_tag="Spirs_0116"
FT   CDS_pept        121640..122818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0116"
FT                   /product="peptidase M20"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro IPR002933:IPR011650:IPR001261;
FT                   KEGG: mta:Moth_0710 peptidase; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein; SPTR: Peptidase M20;
FT                   PFAM: Peptidase family M20/M25/M40; Peptidase dimerisation
FT                   domain; TIGRFAM: putative selenium metabolism hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79274"
FT                   /db_xref="GOA:E1R8D0"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017706"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D0"
FT                   /protein_id="ADK79274.1"
FT                   /translation="MKLNSSQQKEVLAFARQLVCEPGNSGDEEKSALLIEKKMNELGYN
FT                   QVRVDPYGSVIGIINGSKPGPTILFDGHVDVVPIHEPDEWHHDPYGGEVVGDKLISRGS
FT                   ADMKGSVTAMIFAASYLDKEKLLGTIIVSASVAEELIPGRALEKILDEYKVDAVVVGEP
FT                   TKLRLGFTEKGRCSISMTVTGEVAHSSSPELGKNAIYIANDAIRRIREIPVNSDPFLGD
FT                   EVRELVELRSEPTPGYGSVPYYCWGLWECRILPGESEQALLNKFVSSQKGSEWEERIHF
FT                   QFETIDIPNFTGTHLIGKDFLPAWREDKNSGLYKQMEAAVEKSGIPVEYEPIYYGSNAL
FT                   MSCGVKKLPTVIFGPGDVALAHKPDEYLRIQDLWKATKIFNHIMELNGKYTY"
FT   gene            122799..123008
FT                   /locus_tag="Spirs_0117"
FT   CDS_pept        122799..123008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0117"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: wsu:WS1642 flagellar biosynthesis regulator
FT                   FlhF; SPTR: Trypsin type 7"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79275"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D1"
FT                   /protein_id="ADK79275.1"
FT                   /translation="MESILISISHTTGEQDLMSSTKEKTKIDMTDVTQKEVVCPYDEEK
FT                   VFLKIKSYRFLYFNEKGEMRNEES"
FT   gene            122995..123981
FT                   /locus_tag="Spirs_0118"
FT   CDS_pept        122995..123981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0118"
FT                   /product="basic membrane lipoprotein"
FT                   /note="COGs: COG1744 Uncharacterized ABC-type transport
FT                   system periplasmic component/surface lipoprotein; InterPro
FT                   IPR003760; KEGG: ter:Tery_3674 basic membrane lipoprotein;
FT                   PFAM: basic membrane lipoprotein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Basic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79276"
FT                   /db_xref="GOA:E1R8D2"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D2"
FT                   /protein_id="ADK79276.1"
FT                   /translation="MKNLKLAVVLVLLSVLVFGGCQGSSDDKDAGTKSAESKLKVAMVL
FT                   PGLKTDEAFNQFTYEGMMRAAEDLDIETAFVEEVKQDEQIEVIRQFAQQGYDIIIGQGG
FT                   QFGEALQTVAKEYPDQEFVFSVATDTGGVPNLTAVTVSYSHAGYIAGIMAGQMTKNNKV
FT                   AMILGEWYTPHRQMWESFQKGVAASGKDVEVKSVATGSWSDVNKAREASLALIADGVDV
FT                   LLPVLDAAYVGVLSAAQDSDDVLVVGSVLDMAKVAPEVVVGSVVYNWNELGYQEATGEI
FT                   TDGGTHILGIKENGITPVLNDLLSDEGKTAVEDAIAGLKAGNIDILP"
FT   sig_peptide     122995..123063
FT                   /locus_tag="Spirs_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            124082..125605
FT                   /locus_tag="Spirs_0119"
FT   CDS_pept        124082..125605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0119"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG3845 ABC-type uncharacterized transport
FT                   systems ATPase components; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: ctc:CTC00370 sugar
FT                   transport ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: Putative uncharacterized
FT                   protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79277"
FT                   /db_xref="GOA:E1R8D3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D3"
FT                   /protein_id="ADK79277.1"
FT                   /translation="MAQDGAFALRMEGISKFFPGVIANDRINLDCRRGEVLGILGENGA
FT                   GKTTLMNILYGLHQPDEGQIFLDGKQVTIDSPSKAIDLGVGMVHQHFMLVEALSALENV
FT                   ILGMPSKRITLDIESARKRLETLCEDYELHVDPSVEVWKMPVGKQQWLEILKALYRDIN
FT                   LLVLDEPSSVLTPSEGKQLFKAIRKITAEGRSVIFISHKLDEVLEVTDRITVIRDGRVV
FT                   GTVETKDASQEELTRMMVGRPVTITRKPRPVVTKDSPVLVMENVNADDDRGLPALKNFN
FT                   LTVRAGEIVGVAGVDGNGQRELAECIVGMRKYTSGSVQIQDRLIDRIIADTSFVGYIPE
FT                   DRQKTGLCLDMTVAENLIFKEVDNPPYLKNGILRLNSIKEHAQNMIQKYDIRTRSGDDL
FT                   VGNLSGGNQQKVIFAREINNEPVLVIASQATRGLDLGAVENVHNVLLNERNRGAAVLFI
FT                   STELQEVMSLSDRIIVMFRGELMGDVAGEGTDVSTIGRMMLGETLELDK"
FT   gene            125602..126717
FT                   /locus_tag="Spirs_0120"
FT   CDS_pept        125602..126717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0120"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG4603 ABC-type uncharacterized transport
FT                   system permease component; InterPro IPR001851; KEGG:
FT                   cyt:cce_2447 permease protein of sugar ABC transporter;
FT                   PFAM: inner-membrane translocator; SPTR: Putative
FT                   uncharacterized protein; PFAM: Branched-chain amino acid
FT                   transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79278"
FT                   /db_xref="GOA:E1R8D4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D4"
FT                   /protein_id="ADK79278.1"
FT                   /translation="MTKIKRPGILNLPGIGEVVLSSARPLLGIFLGLLAGALLIAISGV
FT                   NPFVAYWAMVQGAFGSPQAFANVLVRASPLLLAGVGVAIGIKAGIWNIGAEGYMYAGAI
FT                   GAAVVGIAPLSVHPFIHILLSVIAAMVFAAVWGLLPAFLRAYKGLNEVVTTIMMNYVAI
FT                   AFTSWLVHPPVFMAEPDSFFPMSLMIKPSAKIPFLMKGTSLHPGFIFGIIACIICFLVI
FT                   RYTPFGFRTRMLGVNPEASRYAGLNEKRQIMLVMLIGAVMGGVAGAFEVLGLKTRLYMD
FT                   FVSGVGYEAVAVALLSAGNPLGVIGSAFFFSALKAGGATMSIVTGVGKPMTIVIEALCV
FT                   LFVIALGYHKRKRLKREDKEIEDEEVQKGEQ"
FT   gene            126707..127633
FT                   /locus_tag="Spirs_0121"
FT   CDS_pept        126707..127633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0121"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG1079 ABC-type transport system permease
FT                   component; InterPro IPR001851; KEGG: npu:Npun_R4718
FT                   inner-membrane translocator; PFAM: inner-membrane
FT                   translocator; SPTR: Putative uncharacterized protein; PFAM:
FT                   Branched-chain amino acid transport system / permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79279"
FT                   /db_xref="GOA:E1R8D5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D5"
FT                   /protein_id="ADK79279.1"
FT                   /translation="MNSEVIISWLQATLRWGGPLILVSIGEVYAERSGIINMGIEGIML
FT                   FGALTGIAVSFFTGSVLIAVLGTILLGTLFGMAFAFFTVDRRANHVVTGLMFNLAALGG
FT                   TNLLFAMLSETRSVRVATFPTLFPESFFDIPVLGPLLFRQSLITWIAFILPFISSRILY
FT                   RTNWGLNIRAVGDNPHAAATAGLNVNKYKYQAVILSGIFAALGGCALTLGDVGYFASGG
FT                   MTAGRGFVVLAAVVVGGWDPLKTALACLVFGAADAAQLRMQTIGSAIPYQFLQMLPYLI
FT                   TIAALAGLVGRTRPPKTWGASYDPEDI"
FT   gene            127941..128690
FT                   /locus_tag="Spirs_0122"
FT   CDS_pept        127941..128690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0122"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011663; KEGG: btl:BALH_3421 GntR family
FT                   transcriptional regulator; PFAM: UbiC transcription
FT                   regulator-associated domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH; SPTR:
FT                   Transcriptional regulators; PFAM: Bacterial regulatory
FT                   proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79280"
FT                   /db_xref="GOA:E1R8D6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D6"
FT                   /protein_id="ADK79280.1"
FT                   /translation="MIKYPKVSDELLSVKVKKILFKMMKDGEFDKTGRLPSEAEIADKL
FT                   SVSRTVIRDVYRLLETEGYIIRRRGIGTLINYNVLYIKERLDVDHVDEFYNLVRESNNT
FT                   PETRFLEYCELAATPELAERFNIEPGDLLICLKRVITADGIPVIYCENYFPKVFLCKKI
FT                   SSENDFKRPIFEFMEHYCNMRIHHEIANIKPILLSKKMISIFNIENTEPALKLQEISYN
FT                   IEQQPILYSYEFHRSGILEHTLLRKRI"
FT   gene            complement(128736..130249)
FT                   /pseudo
FT                   /locus_tag="Spirs_0123"
FT   gene            128879..129154
FT                   /locus_tag="Spirs_0124"
FT   CDS_pept        128879..129154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0124"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: cth:Cthe_0590 transposase
FT                   IS3/IS911; PFAM: transposase IS3/IS911 family protein;
FT                   SPTR: Transposase IS3/IS911; PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79281"
FT                   /db_xref="GOA:E1R8D7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D7"
FT                   /protein_id="ADK79281.1"
FT                   /translation="MSKRRRKFTSEQKFQIVIEAIKGERQISEIAAQYQVHPNQISNWK
FT                   KQFLEKGATVFNTKADDSKKILEETQEDLFKKIGQQQYEIEWLKKT"
FT   gene            129183..129998
FT                   /locus_tag="Spirs_0125"
FT   CDS_pept        129183..129998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0125"
FT                   /product="Integrase catalytic region"
FT                   /note="COGs: COG2801 Transposase and inactivated
FT                   derivatives; InterPro IPR001584; KEGG: glo:Glov_3665
FT                   integrase catalytic region; PFAM: Integrase catalytic
FT                   region; SPTR: Integrase catalytic region; PFAM: Integrase
FT                   core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79282"
FT                   /db_xref="GOA:E1R8D8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D8"
FT                   /protein_id="ADK79282.1"
FT                   /translation="MISPDEKLSISRQCKLVSLNRSSLYYKSMPVKGENIELMKRIDEL
FT                   YTDNPDFGSRQIRNSLRREGRKINRKRVQRLMRDMGIMAIFPGRNLSKPGIGSEHKVYP
FT                   YLLRKLSISRPNQVWATDITYIRLAHGFVYLVAIIDWYSRKILSHEISTTMDQEFCISA
FT                   YRMAITQYGNPEILNSDQGSQFTSKEYRKLVLGSGATFSMDGKGRALDNIAIERFWRTL
FT                   KYGEVYLKEYESVREAKDGIKALIEKYNSRRPHTKHGISTPDEVFGVAA"
FT   gene            complement(130540..131487)
FT                   /locus_tag="Spirs_0126"
FT   CDS_pept        complement(130540..131487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0126"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdl:CDR20291_0238 flagellar cap protein; SPTR:
FT                   Flagellar cap protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79283"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D9"
FT                   /protein_id="ADK79283.1"
FT                   /translation="MKKLLTALVLSMILFGCSTSIPVQMTVPPNLNYGGARTIGVIPFT
FT                   TSSEDASEATKDLRYYFSWYNSRALHDDLKLASALTSKVESVLASSDYFTVISTEQLQQ
FT                   QAANGTITAEAVVTGKIASVLDDYNKEYNERTDADGNTTKVPEYTREAQITVVFKILSA
FT                   SDLTVLDTIEYTVTAKDTANKYEALKSKEAVRFQAIDRIVNKVTYDLIPKTYTEYRTMA
FT                   KLENDKDPRVERINDLIKGDFYQEAYDLYMEIYSETSDFAALYNAILLTEVMGDYDKAL
FT                   DDMTQLAKTSGDKRAIAQMNRMKKQKADREALGE"
FT   sig_peptide     complement(131410..131487)
FT                   /locus_tag="Spirs_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(131721..132242)
FT                   /locus_tag="Spirs_0127"
FT   CDS_pept        complement(131721..132242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0127"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1247 Sortase and related acyltransferase;
FT                   InterPro IPR000182; KEGG: rcu:RCOM_1843230 hypothetical
FT                   protein; PFAM: GCN5-related N-acetyltransferase; SPTR:
FT                   GCN5-related N-acetyltransferase; PFAM: Acetyltransferase
FT                   (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79284"
FT                   /db_xref="GOA:E1R8E0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E0"
FT                   /protein_id="ADK79284.1"
FT                   /translation="MKLIDCGRSFASSILDIYNEAIIHSTALYDYKPRTIESMGTWFDD
FT                   KEKKGFPIIGLVDDKNRLIGFGTYGNFRARPAYHYTVEHSIYIQKEYRGCGYGELLLRE
FT                   IIAKAAEQDYHCLIAGIDSENAASIHLHKKLGFSLCGELKQVGYKFGRWLNLVFYQLIL
FT                   PTPQEPQREI"
FT   gene            complement(132244..133020)
FT                   /locus_tag="Spirs_0128"
FT   CDS_pept        complement(132244..133020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0128"
FT                   /product="putative esterase"
FT                   /note="COGs: COG0627 esterase; InterPro IPR000801; KEGG:
FT                   bbe:BBR47_31170 hypothetical protein; PFAM: putative
FT                   esterase; SPTR: Putative uncharacterized protein; PFAM:
FT                   Putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79285"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E1"
FT                   /protein_id="ADK79285.1"
FT                   /translation="MILRGSFFSQILEMETGLSILIPNRTIDTPPYRVAYLLHGLCGRN
FT                   GDWLDYTMLPAYAEVFDIMFIMPEVARSFYTDMVFGQKFFTYIHQELPVIVKKVFNISA
FT                   KREDTLVIGASMGGYGALKCALSYPDQYGYCAAFSSACLFLKEGLERQQRYGKTAEMEK
FT                   QYGKQLLNDFESIFGQALEWKPEYELLELAKSRPAPPRLYLACGTADHLKDENQRFSHE
FT                   LEKLNIPHRYEEWPGGHDWNFFNKALEKALRGINEV"
FT   gene            133393..134100
FT                   /locus_tag="Spirs_0129"
FT   CDS_pept        133393..134100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0129"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="InterPro IPR018060:IPR000005; KEGG: ppf:Pput_2324
FT                   AraC family transcriptional regulator; PFAM:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; SPTR: Transcriptional
FT                   regulator, AraC family; PFAM: AraC-like ligand binding
FT                   domain; Bacterial regulatory helix-turn-helix proteins,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79286"
FT                   /db_xref="GOA:E1R8E2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E2"
FT                   /protein_id="ADK79286.1"
FT                   /translation="MIKILRYCSDPVCELKWGWGEHAVRKHAHSLWSFSIVLSGRTQIA
FT                   LGRDRAILSAGSSIAIPSGVAHLCTPEKEPPFTFAVLYCDERWLKTCGVDSDRILWGRL
FT                   GAQEFQEMLHTSKGTEAGRMLGSLLQRFERILPDVDRLTFPKNADSGFAPVSIRSTSEN
FT                   RFKAYRQYAQRYSLGPHAVRQNRRIELAKAALRTGLSVAETAAACEFYDQSHFVKTFRL
FT                   YTGTTPSLYKKGI"
FT   gene            134162..134563
FT                   /locus_tag="Spirs_0130"
FT   CDS_pept        134162..134563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0130"
FT                   /product="Protein of unknown function DUF2000"
FT                   /note="InterPro IPR018988:IPR017021; KEGG:
FT                   cdl:CDR20291_1132 hypothetical protein; PFAM: Protein of
FT                   unknown function DUF2000; SPTR: Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function (DUF2000)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79287"
FT                   /db_xref="InterPro:IPR017021"
FT                   /db_xref="InterPro:IPR018988"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E3"
FT                   /protein_id="ADK79287.1"
FT                   /translation="MKAAIIVDTALPLGLIANSAAVLGASLGALHPEIIGEDLADLSGR
FT                   RHAGITGLPIPILGADKERLRKLVDSAEHDDDIDFIAFNDVAQRCKSYKEYSELLATVP
FT                   SDTLRYLALLVVGKKQAVNRLTGSLPLAK"
FT   sig_peptide     134162..134233
FT                   /locus_tag="Spirs_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(134625..135299)
FT                   /locus_tag="Spirs_0131"
FT   CDS_pept        complement(134625..135299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0131"
FT                   /product="YheO domain protein"
FT                   /note="COGs: COG2964 conserved hypothetical protein;
FT                   InterPro IPR013559; KEGG: ckr:CKR_0542 hypothetical
FT                   protein; PFAM: YheO domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: YheO-like PAS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79288"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E4"
FT                   /protein_id="ADK79288.1"
FT                   /translation="MNDAMKKQYSIIVEFLGKALGPDYEVVLHDVDDHINSIVAIANGH
FT                   VSHRSVGGPMTNFGLEVISEERYKKEDYKINYNGISKDQRILRSSTLFIKDEKDEIAGL
FT                   LCINFDDRRYKALSENILKLCHPDKLVELNTSYDSSTIVDNAEERFYGSAAEEISSVLD
FT                   KYLSENGIPSDRLSQDDRLHVVDILNQKGIFMVKGAVKEAAKQLACSEPTIYRYINKVN
FT                   NE"
FT   gene            complement(135466..136797)
FT                   /locus_tag="Spirs_0132"
FT   CDS_pept        complement(135466..136797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0132"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="COGs: COG0733 Na+-dependent transporter of the SNF
FT                   family; InterPro IPR000175; KEGG: ctc:CTC01190
FT                   sodium-dependent amino acid transporter (proline,
FT                   tryptophan); PFAM: sodium:neurotransmitter symporter; SPTR:
FT                   Transporter; PFAM: Sodium:neurotransmitter symporter
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79289"
FT                   /db_xref="GOA:E1R8E5"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E5"
FT                   /protein_id="ADK79289.1"
FT                   /translation="MDDKSAEITRDSFNTRIGFILACIGSAVGMANLWLFPYRIGQFGG
FT                   AAFLIPYCLSIIVIGLVGVIGEMSFGRAMRTGPLGSFKKAFLRRGKKHGELLGLIPVIG
FT                   SLGIAIGYAVVVGWILRFVVGSITGAVINTTDSAAYFGKIAGPLGSIGWHFTGLALTFV
FT                   IMLMGIAKGIEKVNKFMMPTFFILFVLLAIRVLTLPGSIEGYRYLFIPKWELLAKPKTW
FT                   VYALGQAFFSLSLAGSGTVVYGSYLKNTEDVVSCAKNVALYDTIAALLAAIVILPAVFV
FT                   FHLDPTAGPPLMFITMPNVFKMMPMGYLFSIIFFVAVLFAGISSLMNLLETPVEAIQQR
FT                   FKVSRGTAIAVVAIISASAGLILENGSTLGTWMDIVSIYIIPLGALLSGIMFFWVCGPG
FT                   FARQQAQTGRKKKIGRWFEPMTKYVFCGFTILIYILGILYGGIG"
FT   sig_peptide     complement(136705..136797)
FT                   /locus_tag="Spirs_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(136871..138253)
FT                   /locus_tag="Spirs_0133"
FT   CDS_pept        complement(136871..138253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0133"
FT                   /product="Tryptophanase"
FT                   /EC_number="4.1.99.1"
FT                   /note="COGs: COG3033 Tryptophanase; InterPro
FT                   IPR001597:IPR011166:IPR018176; KEGG: ctc:CTC01509
FT                   tryptophanase; PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; PRIAM: Tryptophanase; SPTR:
FT                   Tryptophanase; PFAM: Beta-eliminating lyase; TIGRFAM:
FT                   tryptophanase, leader peptide-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79290"
FT                   /db_xref="GOA:E1R8E6"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR011166"
FT                   /db_xref="InterPro:IPR013440"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018176"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E6"
FT                   /protein_id="ADK79290.1"
FT                   /translation="MAITYLPEPFRIKMVETIKMLTPEEREQRIAEAKYNLFNLKGKDV
FT                   YIDLLTDSGTNAMSQEQWAGVMKGDEAYAGGASYYKLLEAAQDITGYAYIQPVHQGRAA
FT                   EKVLFGILMGKGQFSISNMHFDTTRAHVELTGARAIDCVVSDAMDPAKRAPFKGNMDVD
FT                   KLESLIKKYGAEKVALVVMTVTNNSAGGQPVSMQNIRETASVCKKYNIKFCIDAARFAE
FT                   NAFFIKKREDGYRDASIKDITNEMFSYADMFTMSAKKDAIVNMGGLIGIKDDAELFSAC
FT                   KGRTISFEGFITYGGLSGRDLESLAIGLYEGIDENQLRYRIGQIEYLASRLDDAGITYQ
FT                   APAGGHGIFVDAKALLPHIPYYEFPGQALAVELYKEAGIRTCDIGSYMLGNDPDTGKQL
FT                   HAEFEFTRLAIPRRVYTQAHIDVMAEALIEIKKRANRVKGYKITWEPPVLRHFQASLKP
FT                   LT"
FT   gene            complement(138283..138666)
FT                   /locus_tag="Spirs_0134"
FT   CDS_pept        complement(138283..138666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0134"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="COGs: COG0251 Putative translation initiation
FT                   inhibitor yjgF family; InterPro
FT                   IPR006056:IPR006175:IPR019897; KEGG: tde:TDE2069
FT                   endoribonuclease L-PSP, putative; PFAM: Endoribonuclease
FT                   L-PSP; SPTR: Translation initiation inhibitor protein;
FT                   TIGRFAM: endoribonuclease L-PSP; PFAM: Endoribonuclease
FT                   L-PSP; TIGRFAM: endoribonuclease L-PSP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79291"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E7"
FT                   /protein_id="ADK79291.1"
FT                   /translation="MIKRIVTEKAPPAIGPYSQAVETDTLIFVSGQLPINPATGCFASA
FT                   EIKGQTQQSVENVKQVLQARGLDLDRVVKTTVFLSDMKNFTSMNEVYREMFDQESVPAR
FT                   SAVEVSRLPKDALVEIEAIAAKN"
FT   gene            complement(138846..140063)
FT                   /locus_tag="Spirs_0135"
FT   CDS_pept        complement(138846..140063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79292"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E8"
FT                   /protein_id="ADK79292.1"
FT                   /translation="METTQTVFAARVYYMQTALEVLADLMTTSEDIDREWRRFSLAAGP
FT                   FSGETKRRVFQTARVGSILTDPESTRAFARRIAPKVDLNIKAVLEHFTTYPWFYTIFEV
FT                   EKIVGDGFLIAKIRDSHEMLFSKPAEAKAREGGGCMLGLLFFNGACFQSWGEVVLLDSF
FT                   FEGDIRFFARTAACREYEEKGIESAIIASPLPFLLLREFSKLPQTLFHGEIARACSSQL
FT                   TLSSDIKCLIDQCRCKRQIIENDRYLRICLGGNLVTNPPTLYLDKKDHSLTLATFTLEG
FT                   YRKARFALLSSVEFPEKPQQAVSSAMQYAVFQLFKVQPYWMSFDATFLADEQDTAPLHC
FT                   LERVVYYRTRNGNLPPPDIVAEESGQDQRSAEIFLHAIQTIWDEAATKKASPGQRECTN
FT                   RRNCAA"
FT   gene            complement(140202..140744)
FT                   /locus_tag="Spirs_0136"
FT   CDS_pept        complement(140202..140744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0136"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="COGs: COG0717 Deoxycytidine deaminase; InterPro
FT                   IPR011962; KEGG: cac:CAC0025 deoxycytidine triphosphate
FT                   deaminase; SPTR: Deoxycytidine triphosphate deaminase;
FT                   TIGRFAM: deoxycytidine triphosphate deaminase; TIGRFAM:
FT                   deoxycytidine triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79293"
FT                   /db_xref="GOA:E1R8E9"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E9"
FT                   /protein_id="ADK79293.1"
FT                   /translation="MILSGNEIKKKLGKHIIIEPYNEGQLNPNSYNLRLHNKLVVYRDR
FT                   LLDMKRDNPADEITIPQEGLTLEPGRLYLGRTIEYTETHHAVPMLEGRSSVGRLGLFIH
FT                   VTAGFGDVGFRGYWTLEIFCVQPIVIYPAVEICQIYYHQISEDHVEYTDGKYQANSGIQ
FT                   TSQLFKDFGTVPNPGDS"
FT   gene            140833..141891
FT                   /locus_tag="Spirs_0137"
FT   CDS_pept        140833..141891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0137"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="InterPro IPR006675:IPR006674; KEGG: sus:Acid_4618
FT                   metal dependent phosphohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SPTR: Metal dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: HD domain; TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79294"
FT                   /db_xref="GOA:E1R8F0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F0"
FT                   /protein_id="ADK79294.1"
FT                   /translation="MDPVECLAEAGHNSAYVLWSALDGYFGSDSSSDYQIACTEATLPQ
FT                   LAGMPGALEFPGSEWADAIWYPADRGRGVMLRCVDALDVAPPSTVIQGRLLRMPGKAWY
FT                   RDPFGCYPLLRNSQLSVDFEDEGSWLDAAEIAIYLSRYDYRLPEKGFGPKRFTGLKLLP
FT                   GEQRMLLMLMLGGEHPDRGLRFLFDCGFIEEHWPLFLSMARTHQSKDFHPEGNVWDHTL
FT                   ATLVHRKKADPELGLALLLHDCGKPSSHRSEGNQFHRHAQIGAAVAVRFLRSLEFDEEV
FT                   IRRIRYLVANHMVPSFLSASPPPAIAEVLDHELFPLLLELFRCDISSSFRGPEPYYQAC
FT                   KLYRNWKRKRRV"
FT   gene            142012..143247
FT                   /locus_tag="Spirs_0138"
FT   CDS_pept        142012..143247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0138"
FT                   /product="putative two component, sigma54 specific,
FT                   transcriptional regulator, Fis family"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789:IPR003593:IPR002078; KEGG: dae:Dtox_1013
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   Fis family; PFAM: sigma-54 factor interaction
FT                   domain-containing protein; response regulator receiver;
FT                   SMART: response regulator receiver; AAA ATPase; SPTR: Two
FT                   component, sigma54 specific, transcriptional regulator, Fis
FT                   family; PFAM: Response regulator receiver domain; Sigma-54
FT                   interaction domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79295"
FT                   /db_xref="GOA:E1R8F1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F1"
FT                   /protein_id="ADK79295.1"
FT                   /translation="MITILYIDDDLHDGELVHSMLFGYRVVLARNGTAGLEAYYRFMPD
FT                   IVILDILLPDMNGLELLDRLPTGCEQHPEIIALSGVADPGLAQEVRRRGVKKFLRKPIE
FT                   SKILKGAINELLRGNGAAGHGQLQEHPPEYENTLNVKSPAFASIIGSSRIISRLKDRAH
FT                   RYARCSFPVLILGESGTGKELFAKSIHELSRRCKDPFIVLNCAALPDTLIESELFGTEA
FT                   GAFTGAVNRAGGFELANGGTLFLDEIGELSPSGQAKLLRILEEKVVYRLGSRRARKIDV
FT                   RFVAATNKDLFLRAEGGMFRKDLFYRISGLELHIPPLRERKEDIEELSDTILRKGVEGA
FT                   ESNRHYRLSAGALAQLRAHHWPGNVRELEHVLHRAMLHSDSAVIEAAHLEISRNGRGYA
FT                   SLPMDEKQLPLF"
FT   gene            complement(143261..143803)
FT                   /locus_tag="Spirs_0139"
FT   CDS_pept        complement(143261..143803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgo:TGME49_018300 zinc finger (CCCH type)
FT                   protein, putative; SPTR: Filamentous haemagglutinin family
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79296"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F2"
FT                   /protein_id="ADK79296.1"
FT                   /translation="MKQSAKQWAVLDRHVSTFYNIMMRRSFHHFFSFFLLLFCFAISFS
FT                   NAQTIAPEIDLKTLYLSVNSSQPPEINQNQTLAIDGTVSAREILQPAEEGFIGLLELTV
FT                   GEWEGLESVEVYRCYVQLEGDRFADMIPAGRTRETSPTEIPLNTKVLVFGTYIGYSEDA
FT                   QGNRYPVLLGNAVRIIR"
FT   sig_peptide     complement(143663..143803)
FT                   /locus_tag="Spirs_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            143872..144423
FT                   /locus_tag="Spirs_0140"
FT   CDS_pept        143872..144423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0140"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="COGs: COG1366 Anti-anti-sigma regulatory factor
FT                   (antagonist of anti-sigma factor); InterPro
FT                   IPR003658:IPR002645; KEGG: tde:TDE2083 anti-anti-sigma
FT                   factor; PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; SPTR: Anti-sigma factor antagonist;
FT                   TIGRFAM: anti-anti-sigma factor; PFAM: STAS domain;
FT                   TIGRFAM: anti-anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79297"
FT                   /db_xref="GOA:E1R8F3"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F3"
FT                   /protein_id="ADK79297.1"
FT                   /translation="MNNNDIVPGFDDEKDDSLKIRLQKVDDVEGCLVLYLTGYIDTYNS
FT                   NFFQKRVTKAVEHNFTRLIFNCGGLNYVSSTGIGSFTAFLKAVKPRGGDLVLLEIQPKV
FT                   YEVFQLLGFSQFFNIKDNLNEAVEFFSSEGKSGATDVFPKIFQCPICSKKLKATKSGRF
FT                   RCSECKTILAIDNAGQVFLG"
FT   gene            144429..144800
FT                   /locus_tag="Spirs_0141"
FT   CDS_pept        144429..144800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce5471 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79298"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F4"
FT                   /protein_id="ADK79298.1"
FT                   /translation="MNAVERYLLNLDLNYEEVAAKTYIIHEPEKGLENVAVMLDEPLVI
FT                   VQVKVMDVPSSGRERFFRTLLNLNATDLIHGAYGVNGDEVILIDTLRSATMDLEEFQAC
FT                   LDAIGLALSQHYRILSDFR"
FT   gene            144822..145508
FT                   /locus_tag="Spirs_0142"
FT   CDS_pept        144822..145508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0142"
FT                   /product="phage shock protein A, PspA"
FT                   /note="COGs: COG1842 Phage shock protein A (IM30)
FT                   suppresses sigma54-dependent transcription; InterPro
FT                   IPR007157; KEGG: hoh:Hoch_0487 phage shock protein A, PspA;
FT                   PFAM: PspA/IM30 family protein; SPTR: Phage shock protein
FT                   A, PspA; PFAM: PspA/IM30 family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79299"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F5"
FT                   /protein_id="ADK79299.1"
FT                   /translation="MGFFQRFRRMIKSNLNEMISKAEDPEKMLDQVIVDMNRQMIESKK
FT                   SVAGAIADEKKLERQLNQTIAAAREWEEKAKLAVRAGKDDLAKEALLRKQEYMGEAAQY
FT                   REQLEGQHDSVEKLKQSLRQLQQKIDEAQRKRNLLIARAKRAKAQQKMQETIKGINQNS
FT                   AFEAFDRLSEKVDRMEAENEAYEELDAPVKDDLERQFEALEDGSGTSADLLLEDLKQRM
FT                   KHEEPS"
FT   gene            145492..146151
FT                   /locus_tag="Spirs_0143"
FT   CDS_pept        145492..146151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0143"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001867; KEGG: aco:Amico_1683 two
FT                   component transcriptional regulator, winged helix family;
FT                   PFAM: transcriptional regulator domain protein; SPTR: Two
FT                   component transcriptional regulator, winged helix family;
FT                   PFAM: Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79300"
FT                   /db_xref="GOA:E1R8F6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F6"
FT                   /protein_id="ADK79300.1"
FT                   /translation="MKNHRNNNSFRFVAAGIDSGIRMRLKEATIIDSRFRLKEIDHFTI
FT                   PLEYDGPVILFSTFGVLSSPMLNEIMERGFPLIVSGPASSLLRAFELGVADYLREPWSV
FT                   EELLARCGRIASRFPIPVSDGLLTITSEGITGPGGSVDLSAAEGKLLRLLCSVPGRLVG
FT                   RMELALRVGLENRSRALDVHICHLRKKLVQAVPAWANAHRGPIICERAKGYRFIPS"
FT   gene            146453..147415
FT                   /locus_tag="Spirs_0144"
FT   CDS_pept        146453..147415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_00830 cytochrome c oxidase subunit I;
FT                   SPTR: Cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79301"
FT                   /db_xref="GOA:E1R8F7"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F7"
FT                   /protein_id="ADK79301.1"
FT                   /translation="MVKKIILTPFVHLLWFLVVFIVVFFFIVTYGTVVSSLPGTPNPSL
FT                   FPIAADALWDAFLIAMPLSLFLVIFFIRRRRSFRFLSGIITLVTATLLYAACFIALQTL
FT                   IAPSQIRNDRGPRQLFVEGMFHRFGDVSLYPFTVKDDGSPGESLLIRPGENPCFSLQSG
FT                   FSLQRSGAGVSLVASDGYRLSSPMVNPVVEPYIEPPAIVLRLSYDLETSRDVLLRARED
FT                   GLMFFLLMIGVQCWFCIQSWVIVRAGRWPLMNAVLGIGLFWLFLRAHWFFVSDLWLRFL
FT                   DWLPSSLPYTAITAGAFFFLALPLFFWNIFSSGEAAGHE"
FT   gene            147408..149150
FT                   /locus_tag="Spirs_0145"
FT   CDS_pept        147408..149150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0145"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR019734:IPR013026; KEGG: tde:TDE0867
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79302"
FT                   /db_xref="GOA:E1R8F8"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F8"
FT                   /protein_id="ADK79302.1"
FT                   /translation="MSKSATGRWLFVLVLFWLIAFGVAFGYAFFTFPADHILPLFRLPW
FT                   SFYTGFDLWIDFLPAVTSASMLLSFSFFFPTIASSNSGKISFFGRIFPGVMAWGIVFTL
FT                   LYVIGAELILPSLTERREDIAYQSERAGEWARQGAAAEALADFSEAYDAYKRALAIDLD
FT                   NPLLVEDLERVEGQIPLAEQGSPPSFIESKTGPTRQELEMQASDALVLAKKAYEDEDYF
FT                   TAHYWALLAARWDPEQKPTAMGIAGRSWEAIGKLSPGQRDEERFGRFAKKIAGYQALEQ
FT                   GDVIEAYQTFLELAGDSEAKSDPDIVEFLERSREAVADVSYSAELAIQAEAMPGVPDLL
FT                   FRDSSNGPFIAAGKMVSIEGKSFLLHLELLALDDDGKQLVHITAPAAQFHGKTLLLRGI
FT                   DPNSGRIVDIPEELFAQRRLYRGNGWMLDLDRGLLALSSDQREIADFGSQSHDLGVSNA
FT                   AALFRSSIRESRHGYFRFPGQLELLFRGSMPFLFLNIMIFSVGLGHFFRFRGERIPIFG
FT                   FLFVPFVPFLMKWAIDLFSYAMRLVTALLLFSVSFSLAFAAMLVFHGIMLFVVLLFSAG
FT                   QRDA"
FT   sig_peptide     147408..147485
FT                   /locus_tag="Spirs_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            149143..149604
FT                   /locus_tag="Spirs_0146"
FT   CDS_pept        149143..149604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0146"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="InterPro IPR001623; KEGG: tau:Tola_2364 heat shock
FT                   protein DnaJ domain protein; PFAM: heat shock protein DnaJ
FT                   domain protein; SMART: heat shock protein DnaJ domain
FT                   protein; SPTR: Heat shock protein DnaJ domain protein;
FT                   PFAM: DnaJ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79303"
FT                   /db_xref="GOA:E1R8F9"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F9"
FT                   /protein_id="ADK79303.1"
FT                   /translation="MPDMRSFGKGVHLAFERYPMEVLIGLLLGVLIGWGVFGSVIGALC
FT                   GYFFRVLRRQLAAERKECNHEGSIPRGALDGEEQEARRRALAEAYRVLGVDSDSEVEAI
FT                   RKVYRSLAASFHPDGMVALTDEQRRDAEEAFLRIRSAWECIARDRGVRP"
FT   gene            complement(149601..150887)
FT                   /locus_tag="Spirs_0147"
FT   CDS_pept        complement(149601..150887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0147"
FT                   /product="UDP-N-acetylglucosamine1-carboxyvinyltransferase"
FT                   /note="COGs: COG0766 UDP-N-acetylglucosamine enolpyruvyl
FT                   transferase; InterPro IPR005750:IPR001986; KEGG:
FT                   tde:TDE0641 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); SPTR:
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase; PFAM:
FT                   EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase); TIGRFAM:
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79304"
FT                   /db_xref="GOA:E1R8G0"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G0"
FT                   /protein_id="ADK79304.1"
FT                   /translation="MSTYTIDGSYPIGGRITASGNKNAALPCIAASLLTEEEIVLHNIP
FT                   DIEDVSVMLEIAEKLGATVTQEKRGVYHIKASDIVSSEIPSDMAKSIRASILFAGPLLA
FT                   RTGKVQLPPPGGDVIGRRRLDSHFLALSALGGRIEVDGMFRITANKLVGEDIFLDEASV
FT                   TATENAIMAAVLADGETIISNAASEPHVQDLCNMLNTMGANITGIGSNILYVKGVKKLQ
FT                   GTNFRIGADFMETGSYIGLAAVTRGDLEIEEADPKHLRMTRLAFAKLGIHWETDGSTIH
FT                   IPGGQSLKVVPDLGGMIPKIDDAPWPGFPADLTSIITVVATQVEGTTLIHEKMFESRMF
FT                   FVDKLIGMGARIILCDPHRAVVSGPCRLRGGELVSPDVRAGMAMVIAALCAEGKSIIHN
FT                   VYQIERGYEKLAERLKSLGARIERDGAAD"
FT   gene            complement(150935..152191)
FT                   /locus_tag="Spirs_0148"
FT   CDS_pept        complement(150935..152191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0148"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR018247; KEGG: dse:Dsec_GM19185 GM19185
FT                   gene product from transcript GM19185-RA; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79305"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G1"
FT                   /protein_id="ADK79305.1"
FT                   /translation="MSPQNRFSKILFFSLVLTGILLLGCGSTPKTIKEQPPPSTSSAET
FT                   GLAEHAATKEREGERTISSSQQGEQEATREQEASTDRSEESAAPPKAMSKEQLMLSVIQ
FT                   AAGQRFTPVRRNNGTPLLAIQDIDQNGEDDAFVLTVEQNGQSIFQSDLGNVKRLYQSQA
FT                   KSVNYYLSVYFQIRGKLISMYRIPFGGRMVLDGFRAFHLRENALYPYAVEAAFQNHDGL
FT                   AIEWVIFSSYNQFSLFSMHRSVSIGSFVEDIDEDGLLDIVEWHKGIEEGTGYETFLTWY
FT                   RWNGTNFGEAGATNIVRNLNAFLSLVEEAILTGTPQKLTPYLSRPVELQKSNDLLKRIF
FT                   TPLDENSLESGLDYCDEIVSIIYPPILENPFSLDSSSGKSVPLDLRLICKNSESLLCRM
FT                   EIAISKNPFVAPQYRIIVR"
FT   sig_peptide     complement(152093..152191)
FT                   /locus_tag="Spirs_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            152254..152700
FT                   /locus_tag="Spirs_0149"
FT   CDS_pept        152254..152700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0149"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /note="InterPro IPR007313; KEGG: sfr:Sfri_3664 FxsA
FT                   cytoplasmic membrane protein; PFAM: FxsA cytoplasmic
FT                   membrane protein; SPTR: Membrane protein FxsA (Suppressor
FT                   of F exclusion of phage T7); PFAM: FxsA cytoplasmic
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79306"
FT                   /db_xref="GOA:E1R8G2"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G2"
FT                   /protein_id="ADK79306.1"
FT                   /translation="MADVRDYIRLFDTNNVLKWFFLIMLCGLVLVGEAVVLLFAVDRFS
FT                   RYYVLACLTGSAVIGLLLTWPAVHRIVKHIRKDIAEGEFPEHDMERLLGTIASGIFMLI
FT                   PGFVTDCLGLIIFFFGLRRPVGKLIMMKNRDRLFQAYEYLKLYD"
FT   gene            complement(152701..153447)
FT                   /locus_tag="Spirs_0150"
FT   CDS_pept        complement(152701..153447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0150"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="COGs: COG1922 Teichoic acid biosynthesis protein;
FT                   InterPro IPR004629; KEGG: tde:TDE1876 WecB/TagA/CpsF family
FT                   glycosyl transferase; PFAM: glycosyl transferase
FT                   WecB/TagA/CpsF; SPTR: Glycosyl transferase, WecB/TagA/CpsF
FT                   family; TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: Glycosyl transferase WecB/TagA/CpsF family;
FT                   TIGRFAM: bacterial polymer biosynthesis proteins,
FT                   WecB/TagA/CpsF family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79307"
FT                   /db_xref="GOA:E1R8G3"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G3"
FT                   /protein_id="ADK79307.1"
FT                   /translation="MNDQNRIQIFGVPVDDIDEERFGETIRRLATDNGKHQIVFLDFRG
FT                   LMRARGKGEYADMIRTASLVVPTSKSILAGARFLKLPVPHRHNPFAFVIKLLGAIEQIG
FT                   GTLYLVGSRPDALQKAFGNVRDSFPGLRLVGRYAGYFRKDIERDVITAIKKAGPTILLA
FT                   GDGLKGKALWLKRHERSFGFGISLFCDGCFKIFSGKRQRISNKSWERNSWWIPAVIIRP
FT                   WRWFSFLRYILYGILLFIEKMRRRNL"
FT   gene            complement(153444..154262)
FT                   /locus_tag="Spirs_0151"
FT   CDS_pept        complement(153444..154262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0151"
FT                   /product="protein of unknown function DUF558"
FT                   /note="COGs: COG1385 conserved hypothetical protein;
FT                   InterPro IPR006700; KEGG: adg:Adeg_0610 protein of unknown
FT                   function DUF558; PFAM: protein of unknown function DUF558;
FT                   SPTR: RNA methyltransferase family protein; PFAM: RNA
FT                   methyltransferase; TIGRFAM: RNA methyltransferase, RsmE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79308"
FT                   /db_xref="GOA:E1R8G4"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G4"
FT                   /protein_id="ADK79308.1"
FT                   /translation="MRTFVLDDSETKLASGKRFSPAPERAHYLLRVLRLSQGAVFPGQD
FT                   SRGKRYLITLESETPCTLSLRREEEASAREVEACFRELPEQGPDFPPIIFYQAILKGKK
FT                   MDQVIRQATEAGADFIIPVLTDRSVPQFTPGEAEKKQKRWEIIVREAIQQSGATGTTLL
FT                   LPRSLKKVIEDPPMPRPQGGGREVKLFFHERPIANGSLHGYLSGEISSITAAVGPEGGF
FT                   SPKESEMFLQAGFCPLFFSGNILRAETAAIYGLAAIRALVAERDIWRLVQ"
FT   gene            complement(154273..154677)
FT                   /locus_tag="Spirs_0152"
FT   CDS_pept        complement(154273..154677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0152"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="COGs: COG0432 conserved hypothetical protein;
FT                   InterPro IPR001602; KEGG: hor:Hore_00760 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0047; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   protein family UPF0047; TIGRFAM: conserved hypothetical
FT                   protein TIGR00149"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79309"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G5"
FT                   /protein_id="ADK79309.1"
FT                   /translation="MNRWETVLNIKTSGRSDMVDITDKITSAVQESGVRNGICMVYIPH
FT                   TTCAVTINENADPAVKHDIMAELDKIVPWKDAYHHMEGNSAAHIKSSMFGFSQTIPITE
FT                   GALPLGTWQGIYLCEFDGPRSRTVSVQIFG"
FT   gene            complement(154674..156176)
FT                   /locus_tag="Spirs_0153"
FT   CDS_pept        complement(154674..156176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0153"
FT                   /product="carboxyl-terminal protease"
FT                   /note="COGs: COG0793 Periplasmic protease; InterPro
FT                   IPR004447:IPR001478:IPR005151; KEGG: bga:BG0359
FT                   carboxyl-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SMART: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SPTR: Carboxy--processing
FT                   protease; TIGRFAM: carboxyl-terminal protease; PFAM:
FT                   Peptidase family S41; PDZ domain (Also known as DHR or
FT                   GLGF); TIGRFAM: C-terminal peptidase (prc)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79310"
FT                   /db_xref="GOA:E1R8G6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G6"
FT                   /protein_id="ADK79310.1"
FT                   /translation="MKQIRNRLAWLMVAIVTVSFSLFLIITPTLSAQSSSSVEVKNYLA
FT                   RFQYIFQYILQAYVDEVDPKQLYEGALNGMFDTLDDPWSYYLSEDDMEDLNNNTTVGRY
FT                   GGVGLYIARPVPVDEKDKGKVMKIPDQWPELDTTKEDLPFIKVVSPIEDTPAYRKGIHS
FT                   GDYIIAIGDQSTENMTSDDASGKMKGLPGTDVTVTILRGKNIIFDVTITRASIEIPTVK
FT                   EAMIPGRIGYIRIIQFSPYTEPRVREALKTLNSQGYDSLIIDVRGNGGGLLNAAVNIID
FT                   MFLSSGPIVSTKGRIAEENKVFNATSSLEVAADVPIAILIDGGSASASEILAGAFKDTG
FT                   RGYLIGNTSFGKGLVQTVVPLGREGFKLTISRYYTPSGVNINGTGIEPNLKIAEPELND
FT                   EENASLKKLFEEHLVENFVNGNPKPSEQEQKAFARRLQQEEEITLPFDLLMRLIRGEVF
FT                   RRMDQPPVYDLDYDPVLKKAVSLLETGAIQPTTGTLAQEQKQ"
FT   sig_peptide     complement(156081..156176)
FT                   /locus_tag="Spirs_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            156266..156727
FT                   /locus_tag="Spirs_0154"
FT   CDS_pept        156266..156727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cla:Cla_0909 sodium-dependent transporter (SNF
FT                   family); SPTR: Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79311"
FT                   /db_xref="GOA:E1R8G7"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G7"
FT                   /protein_id="ADK79311.1"
FT                   /translation="MIKKLVLLLIVLWEAFRAVGLFFSAVALLNPTYRTETTLLMGWLF
FT                   SGSLTVLATEALLLFRGPTAQGGRILPGIAALGKFVTLLPGIMLFLLLSGVGPQQDQTP
FT                   LLLFPFRTIIALVSFVDLLCIGFLLLLLKDGSGTSRPDSDYRFTVVEEE"
FT   gene            156728..157870
FT                   /locus_tag="Spirs_0155"
FT   CDS_pept        156728..157870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0155"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="COGs: COG0455 ATPase involved in chromosome
FT                   partitioning; InterPro IPR002586; KEGG: tde:TDE1397
FT                   flagellar synthesis regulator FleN, putative; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; SPTR: ATP-binding
FT                   protein; PFAM: CobQ/CobB/MinD/ParA nucleotide binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79312"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G8"
FT                   /protein_id="ADK79312.1"
FT                   /translation="MRILPIASGKGGVGKSLVAANLSIALAQSGKKVVLADLDLGASNL
FT                   HLILGVRAVQQGIGTFLTNAEIEFEEVILPTDYPNLRFIPGDAEIPGMANLKSSQKAKL
FT                   IRKLRTIEADYIIIDLGAGTSYNTLDFFLSSSRGIIVTAPTLTATLNAYLFLKNSVFRL
FT                   MNGAFRKSSPAGKYIENLQREGTPLQRVYIPRLLERIMEEDPDSYKNFARSMANFHPML
FT                   VLNMLEDPEDGKKAARIRRSCKQYLDVDMEHLGVLYFDHLQEIALGSRIPIVAYKPQSV
FT                   LSQGIYRIADKLIQKQDEGESPLDLMSLEESYQVAEMEAEIDFEAKVQDMENLLHSGAL
FT                   TRGDLIDTIRSQQYEISTLKKENQLLKSKLLKAAENGFQI"
FT   gene            157889..160840
FT                   /locus_tag="Spirs_0156"
FT   CDS_pept        157889..160840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0156"
FT                   /product="protein of unknown function DUF342"
FT                   /note="COGs: COG1315 polymerase most protein contain PALM
FT                   domain HD hydrolase domain and Zn-ribbon domain; InterPro
FT                   IPR005646; KEGG: tde:TDE1398 hypothetical protein; PFAM:
FT                   protein of unknown function DUF342; SPTR: Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF342)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79313"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G9"
FT                   /protein_id="ADK79313.1"
FT                   /translation="MEQGKGSLKIEINEGGLNATLVLTADPEGEVWSLPKVQNVLEEKG
FT                   IIEGVSKAAVQEALQAFAEAEAGISVRKEIARGTEPEPATSEYYEWKELPLPESLKTQA
FT                   DRLFLEYAFPDIKIKRTEKVKVRKKVLKKSKLLFVAPKEQIVEEWQKKIVEEPAPINPK
FT                   VAATGYVEQGEYIAELRAGEPGKDGRSVLGKPLSPDPAKPILFYPGKGVKVDRNGLVAE
FT                   KSGFFRRGSNWVEVFDFLSHSWELSLSKDKATLLFAFTPGHREASIPEPSLIISKAGEE
FT                   FGFSVEQLKGPDKLREVMTRSVQTGKALERIPLTRDRDAFFSVEASSDNLKGLLTVVKG
FT                   SGRGKPLILRDVGAAIKASGFSGLDFGKIQNDLLEFYHGNGIELRDYLLAEGAAPSRGE
FT                   DRSFDFSVDFLPETEYEALKVGESGFPSEEAYPMSQARSLARVAEGTVVGVLSSAQEGS
FT                   PGKDVYGKVIPGIPGIDPHIELLENVRMEKERFIAETAGLLEVFDGADGIILRVRPYRD
FT                   AEVKIELSTDKMEAWLTIEPPAGSGTKANRSEIDQALKEVGIVKGIIEEAITDALEISG
FT                   AGSPVRRSVVARGKRPDDAGGSRIALIADRASGKGVTITRSGRADYRNQDRFVSVKAGA
FT                   LLAEILPNDQPAEDGWDLTGKPISAKDAPALDIDIGENIRQEEEGNRIKLYAACSGEFV
FT                   YEKKKLDILKVHTVSGDVDFSSGNVKFSGTVAVSGSVRSGFSILAEGHVKVAGNAESSL
FT                   ISSGESITIAQGIVGGGKAVIRAKSSIETIFAEQATLLAVGSVSMKNACLRCMVKCNGR
FT                   LRLVGEKGNLIGGVVRAREGVIAANIGNPKGSRTEISFGQDYLVMDRIELEEREVKKLR
FT                   NALARIDTTMASLEKQGDKGRLEMARKEKLKMMKMLEKRSMLLFTLRERFEQHFDSSVV
FT                   VRGTVYPGVVIESHGRYWSTETPKKGITLIFDQETGRIIEVSEAEPKEGEKSA"
FT   gene            160837..161784
FT                   /locus_tag="Spirs_0157"
FT   CDS_pept        160837..161784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0157"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="COGs: COG0682 Prolipoprotein
FT                   diacylglyceryltransferase; InterPro IPR001640; KEGG:
FT                   tde:TDE1399 prolipoprotein diacylglyceryl transferase;
FT                   PFAM: prolipoprotein diacylglyceryl transferase; SPTR:
FT                   Prolipoprotein diacylglyceryl transferase; TIGRFAM:
FT                   prolipoprotein diacylglyceryl transferase; PFAM:
FT                   Prolipoprotein diacylglyceryl transferase; TIGRFAM:
FT                   prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79314"
FT                   /db_xref="GOA:E1R8H0"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H0"
FT                   /protein_id="ADK79314.1"
FT                   /translation="MIYINYPEWISPQIIPGLPFHWYGMMYLVAFGITYLLFNYQRKHG
FT                   EIAVSEDQMAGIFFWVILGLLIGARIVATLVYDTSGQYLRRPWLIFWPFDEHMHLVGLQ
FT                   GMSYHGGLIGGVVAGVLYCRKEKISFWAVADTAVAGIPLGYTFGRLGNFINGELWGRVT
FT                   ASPLGMIFPHAPGLSSRYEWVRRIADSVGIGYSPGSLVNLPRHPSQLYEAFFEGVFLWL
FT                   IIWFVFRKRKQIQGTLLGVYLIGYGIIRFFIEYFRQPDADIGFPIALGPDSPPSLFLSP
FT                   LNISTGQIFCFAMILAGIAVIVFRRLVSSRKAGS"
FT   gene            161842..162195
FT                   /locus_tag="Spirs_0158"
FT   CDS_pept        161842..162195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0158"
FT                   /product="Hpt protein"
FT                   /note="InterPro IPR008207; KEGG: srm:SRM_02645 conserved
FT                   hypothetical protein containing Hpt domain; PFAM: Hpt
FT                   domain protein; SPTR: Probable sensor/response hybrid,
FT                   putative; PFAM: Hpt domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79315"
FT                   /db_xref="GOA:E1R8H1"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H1"
FT                   /protein_id="ADK79315.1"
FT                   /translation="MRCMETIIHFDAAESALRLDRETLLMLLDAFFSTREDYIKPIKGA
FT                   IESRDAEALRSEAHRLKGAANNLRVTKIGTLAQTLEKSSSDADPSLLLSTLEQIEVSFS
FT                   AGEKELSVLKSEV"
FT   gene            162200..164248
FT                   /locus_tag="Spirs_0159"
FT   CDS_pept        162200..164248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0159"
FT                   /product="Alpha-galactosidase"
FT                   /note="COGs: COG3345 Alpha-galactosidase; KEGG:
FT                   shi:Shel_06470 alpha-galactosidase; SPTR: Putative
FT                   uncharacterized protein; PFAM: Melibiase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79316"
FT                   /db_xref="GOA:E1R8H2"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H2"
FT                   /protein_id="ADK79316.1"
FT                   /translation="MNTSWSILFSYHLGSEEFELGGLSGGATFADGVRIVVEQRKLPLG
FT                   ERILFHAEPAPGGEGLFPVAERLELRLRCSSCEAVFLNGYQSWTESRELEAEVFPFRFR
FT                   RLFRPWINHYLLDRYGDACFTGRSFSKKRYHGCSFATLRKGKQVTLLAGMIEDRALSRI
FT                   EWRSERRGRGYLSFLPELSSNKISGVRTLMDLVVLTGEEEAVYEGWASAADGFGPVEPG
FT                   ESLSGWTSWYDHYEKVTEADVLRVLDSWQRLSLPPGVIQIDDGWQQAVGDWLRVKPTFP
FT                   RGMAPLAADISKAGMEPGLWVAPFIAEGSSLLFAEHRDWFLTDDAAEPLAAGNNPFNWS
FT                   GYFYALNIYHPEVKTYLRTLFSTIVKQWGFRFLKLDFLYAAALRLPEGKTRGEVMRDAV
FT                   AFLREISGEAKLLGCGVPLASAAGLVEYCRVGADVALRWEDRRLRALGYPERVSTLNAL
FT                   RSTISRRGLDGRFFLNDPDVFLLRDWNSDLNEQERFTLFLCNHIFGSLLFTSDDPGRYD
FT                   EATLALFRSGYPLRKKHGLRMNRIGECFEIEFSIGTLCYLAFINLENRPHHVTLASGLY
FT                   YAYGEGFRREGPLDLRPHQSICFLVVGETDFAVAGSTGMLFPGSEVERIDVDGEHVTLS
FT                   LAPGTLSEGLLFFRAPQGASGCSINGIDIEAEEKVGLRLCVVEKRLL"
FT   gene            164351..165319
FT                   /locus_tag="Spirs_0160"
FT   CDS_pept        164351..165319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0160"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD subfamily"
FT                   /note="COGs: COG0568 DNA-directed RNA polymerase sigma
FT                   subunit (sigma70/sigma32);
FT                   InterProIPR000943:IPR014284:IPR009042:IPR007627:IPR
FT                   007624:IPR007630; KEGG: tcu:Tcur_3197 RNA polymerase, sigma
FT                   70 subunit, RpoD subfamily; PFAM: sigma-70 region 4 domain
FT                   protein; sigma-70 region 2 domain protein; sigma-70 region
FT                   1.2; sigma-70 region 3 domain protein; SPTR: RNA polymerase
FT                   sigma factor; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70, region 4; Sigma-70 region
FT                   3; Sigma-70 region 2; Sigma-70 factor, region 1.2; TIGRFAM:
FT                   RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79317"
FT                   /db_xref="GOA:E1R8H3"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H3"
FT                   /protein_id="ADK79317.1"
FT                   /translation="MKYGTYSDTVIDSDVDFNDSDPLSLYLKQISAYPLLTKEEELMIG
FT                   REIQERKQELLELEELLGKEEIERSAYLFRKRTIEAVLRKSRDRMITSNLRLVVSIAKK
FT                   YQHRGLSFLDLIDEGNIGLIEAVERFDYTKRCKFSTYGTWWIQQSVIKALADKGRTIRI
FT                   PIHVLNIIRKLFSVTKHLTQELGRDPSSAEIAAYMDLPVERVESILQYSGETASLDVTV
FT                   DDENITSLSDLVFSDDYIEPFESVFHVTLKDLLDTILGQLSEREQTIIKLRFGLADRTP
FT                   LTLEEIGSILGITRERVRQIQNKAIEKLRSIAAIQELEEIV"
FT   gene            165410..165775
FT                   /locus_tag="Spirs_0161"
FT   CDS_pept        165410..165775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0161"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789; KEGG: gsu:GSU1289 chemotaxis protein
FT                   CheY; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; SPTR: Chemotaxis protein CheY; PFAM:
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79318"
FT                   /db_xref="GOA:E1R8H4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H4"
FT                   /protein_id="ADK79318.1"
FT                   /translation="MTKKVLVVDDSRAIRRSISFVLEQNGYEVLEASDGVVGLAKLEEG
FT                   TVELIITDVNMPNMDGITFIKKVRELDAFRFVPILVLTTESQKSVMEDGKAAGATGWIV
FT                   KPFSTDKLMAAVRRVAG"
FT   gene            complement(165785..166672)
FT                   /locus_tag="Spirs_0162"
FT   CDS_pept        complement(165785..166672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0162"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="COGs: COG2215 ABC-type uncharacterized transport
FT                   system permease component; InterPro IPR011541; KEGG:
FT                   dap:Dacet_2269 high-affinity nickel-transporter; PFAM:
FT                   high-affinity nickel-transporter; SPTR: High-affinity
FT                   nickel-transporter; PFAM: High-affinity nickel-transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79319"
FT                   /db_xref="GOA:E1R8H5"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H5"
FT                   /protein_id="ADK79319.1"
FT                   /translation="MNTRHRYVLFPFIFIIIFVTNSWGQQVNPFTATQKAPTESKQSSQ
FT                   PQKAVESGTLQTLSSMQKQLNAALSDTMKQLKDHPSAPVMALTMLIAFGYGFIHALGPG
FT                   HRKTILAALFASGRYRKRDALGAGMGFAFLHASSAVAIVGFLYFLSSGPISAGMDKIGL
FT                   ALEKGSFLLLVGIGLWIMISAIRALMAKEDKPAKKGVTVITIIGSGLIPCPGAALILSF
FT                   ALVYDIVPYGIVAVFCMSVGMGTALSIIAVAAKSIGASLIKLGERSKRTDRIHSALEFA
FT                   GGVVITTFALFMLT"
FT   sig_peptide     complement(166601..166672)
FT                   /locus_tag="Spirs_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(166684..167337)
FT                   /locus_tag="Spirs_0163"
FT   CDS_pept        complement(166684..167337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0163"
FT                   /product="protein of unknown function DUF1007"
FT                   /note="COGs: COG3683 ABC-type uncharacterized transport
FT                   system periplasmic component; InterPro IPR010412; KEGG:
FT                   tde:TDE0115 hypothetical protein; PFAM: protein of unknown
FT                   function DUF1007; SPTR: Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function (DUF1007)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79320"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H6"
FT                   /protein_id="ADK79320.1"
FT                   /translation="MKLEKRHLPLFLFVFTLFIPCTLFAHPHMFIDSKTTLEFDEAGMK
FT                   GFWVEWLFDQFFTAQILLDYDRNMDKNFSADEISAIEAGAFSNLANYHYFISVTTGEAQ
FT                   VDIKKVSDFRAFMKDDRLGYTFFVPMAIPINNEKKPVQFRISIFDDTFFCDIAWMEKDS
FT                   VIVRAPGVFSVDWKILRNKNAPIIYDPTGGTARRNGVDYSGTVYPEELYIEVSK"
FT   sig_peptide     complement(167263..167337)
FT                   /locus_tag="Spirs_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(167360..169501)
FT                   /locus_tag="Spirs_0164"
FT   CDS_pept        complement(167360..169501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0164"
FT                   /product="ferrous iron transport protein B"
FT                   /note="COGs: COG0370 Fe2+ transport system protein B;
FT                   InterProIPR005225:IPR003373:IPR002917:IPR011619:IPR
FT                   011642:IPR011640; KEGG: pgi:PG1294 ferrous iron transport
FT                   protein B; PFAM: Ferrous iron transport protein B domain
FT                   protein; GTP-binding protein HSR1-related; nucleoside
FT                   recognition domain protein; Ferrous iron transport B domain
FT                   protein; SPTR: Ferrous iron transport protein B; TIGRFAM:
FT                   ferrous iron transport protein B; small GTP-binding
FT                   protein; PFAM: Ferrous iron transport protein B; Ferrous
FT                   iron transport protein B C terminus; Nucleoside
FT                   recognition; TIGRFAM: ferrous iron transporter FeoB; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79321"
FT                   /db_xref="GOA:E1R8H7"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H7"
FT                   /protein_id="ADK79321.1"
FT                   /translation="MGSFRFALTGNPNSGKTSIFNAATGANQKVGNWGGVTVDVKEGNI
FT                   RRGNDRVTLIDIPGTYSLSAYTMEELVAREVIIKGDADVIINVLDSTNLERNLYLGVQV
FT                   MEMGRPMVLAFNMSDELKRSGTVIDTEALSRLFGIPIRFTVGRNGEGVRELLDEAIRVA
FT                   KGEHPATRQVSVNYGKEIEAAIESLAELVEKSSFNLRGISPRWYALKLLERDDEILRKV
FT                   RERVPADSPDDNVIFKELESRSKEIEQLYGEDAATIISERRYGFIIGALNETVNKPKAN
FT                   RINISEKIDDVLTNRFLAYPIFAFFMWILFQTTFGLGAYPMAWIESGITALGNWIGTTM
FT                   PPGAIRDLLTDGVIAGVGGVLVFLPNILILFLGISILEDTGYMARIAFIMDKVMHRIGL
FT                   HGKSFIPLVMGVGCSVPAIMAARTLESKKDRILTILIAPLITCSARLPVYILFTGAFFP
FT                   NIAGNVIFILYFLSFLFAFGMGWLFRKTLFRGEEYPFVMELPPYRIPTFRSALIHMWEK
FT                   AKHYLQKMGGVVLIFSIIIWFLGNYPKQPEMEKQYDTMIAEQREQGHQEEVQALQRELK
FT                   RKQVMQSYIGKAGTFIEPVLAPLGFDWRMDVSLMTGFVAKEVVVSTLGVLFTAGNEEGK
FT                   EESGTELRDALRDAYSPLVGFAFLIFVMLYTPCIVAFVTLVKEVGSWKWSIFSLGYQLT
FT                   LAWIAAFIVYRGGIILGLG"
FT   gene            complement(169501..169779)
FT                   /locus_tag="Spirs_0165"
FT   CDS_pept        complement(169501..169779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0165"
FT                   /product="FeoA family protein"
FT                   /note="COGs: COG1918 Fe2+ transport system protein A;
FT                   InterPro IPR007167; KEGG: dat:HRM2_10920 Fur; PFAM: FeoA
FT                   family protein; SPTR: Fur; PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79322"
FT                   /db_xref="GOA:E1R8H8"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H8"
FT                   /protein_id="ADK79322.1"
FT                   /translation="MKKTLSQYRQGDIVTITRLNGSGRLKNRLMELGFRRGETISIIRY
FT                   APLKDPVEILVAGCNVSLRVEEADMIEVEPAKDQYIHAAEGECAGSL"
FT   gene            170022..172286
FT                   /locus_tag="Spirs_0166"
FT   CDS_pept        170022..172286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0166"
FT                   /product="5-methyltetrahydropteroyltriglutamate/homocystei
FT                   neS-methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="COGs: COG0620 Methionine synthase II
FT                   (cobalamin-independent); InterPro
FT                   IPR006276:IPR013215:IPR002629; KEGG: drm:Dred_1751
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase; PFAM: Methionine synthase vitamin-B12
FT                   independent; Cobalamin-independent synthase MetE domain
FT                   protein;
FT                   PRIAM:5-methyltetrahydropteroyltriglutamate--homocy
FT                   steineS-methyltransferase;
FT                   SPTR:5-methyltetrahydropteroyltriglutamate--homocys
FT                   teinemethyltransferase;
FT                   TIGRFAM:5-methyltetrahydropteroyltriglutamate/homoc
FT                   ysteineS-methyltransferase; PFAM: Cobalamin-independent
FT                   synthase, N-terminal domain; Cobalamin-independent
FT                   synthase, Catalytic domain; TIGRFAM:
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79323"
FT                   /db_xref="GOA:E1R8H9"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H9"
FT                   /protein_id="ADK79323.1"
FT                   /translation="MICKTLVTGFPRIGENRELKRALEHYWSKTASLQELRATAAELRK
FT                   RHWLFQKRQNIDFISSNDFSYYDNMLDTIVMLNAVPDRFSGIEDETERYFAMARGTAGA
FT                   SAMTMSKWFDTNYHYIVPELSGTLDFRLCPGKILTEYAEAKKLGVKTKINVIGPITFMG
FT                   LSRASKGENPFGYASRIIPLYKELLARCAELDDTLYIQMEEPYLVKNPTAEVLALLKAA
FT                   YQDLASVSSNIRIIVTSYFEHSNETTKILAETPIWGLGLDFVHGPQNIQGLKYAKGKKI
FT                   FAGVVDGRNIWRNDLGASLFLLEKISDMVGREQVVVSTSCSLLHVPYSLQNEPESDIKQ
FT                   HLAFCCEKVEELALLGRVFRGEVVLDSDNIGMKTARSRTPSTQHDGPADIAFGERKVRA
FT                   GDFAERNALQRRKFHLPKLPTTTIGSFPQTQELRRLRRDFKKRAISEEAYEQGIKTYID
FT                   DCIAFQEEIGLDVLVHGEPERNDMVEYFGEMLKGFHFTDNGWVQSYGSRCVKPPIIYGD
FT                   ISRTKPMTVRWISYAQRRSKKPVKGMLTGPVTILNWSFVREDIPRPLVARQIAAALCEE
FT                   VADLQAAGISIIQVDEAAFREGYPLRKENVSAYERWAVDSFRLAVSSAAKETQIHTHMC
FT                   YSDFTDIIKTIEAMDADVITIETARGGNRLLDVFEREGYHNEIGPGVYDIHSPRIPSED
FT                   EFEKQIFSRLEVLDGKRMWINPDCGLKTRRWEEVRPALQHMVSATRNVRLTLERNETSL
FT                   T"
FT   gene            172378..172701
FT                   /locus_tag="Spirs_0167"
FT   CDS_pept        172378..172701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0167"
FT                   /product="FeoA family protein"
FT                   /note="InterPro IPR007167; KEGG: iho:Igni_1229 FeoA family
FT                   protein; PFAM: FeoA family protein; SPTR: FeoA family
FT                   protein; PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79324"
FT                   /db_xref="GOA:E1R8I0"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I0"
FT                   /protein_id="ADK79324.1"
FT                   /translation="MHNTFAMKFGLDRGRRHMFHGHGHRNHHCQEMGSVVLSGVDAGSS
FT                   VRVVCLFGGQDAKRKLLDMGLVPGELLKVVQNDSDGPLLLQVQGSRLMIGRGLADKIRV
FT                   AAA"
FT   gene            172799..173035
FT                   /locus_tag="Spirs_0168"
FT   CDS_pept        172799..173035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0168"
FT                   /product="FeoA family protein"
FT                   /note="COGs: COG1918 Fe2+ transport system protein A;
FT                   InterPro IPR007167; KEGG: alv:Alvin_1526 FeoA family
FT                   protein; PFAM: FeoA family protein; SPTR: FeoA family
FT                   protein; PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79325"
FT                   /db_xref="GOA:E1R8I1"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I1"
FT                   /protein_id="ADK79325.1"
FT                   /translation="MGQLKEFRAGDNGTVIGFAPGSAQWKSRLLAMGMTVGTAFQVERV
FT                   APLGDPVEIMVRGSRITLRKGEAEALLVERRVS"
FT   gene            173032..175332
FT                   /locus_tag="Spirs_0169"
FT   CDS_pept        173032..175332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0169"
FT                   /product="ferrous iron transport protein B"
FT                   /note="COGs: COG0370 Fe2+ transport system protein B;
FT                   InterProIPR006073:IPR005225:IPR003373:IPR002917:IPR
FT                   011619:IPR011642:IPR011640; KEGG: cpb:Cphamn1_0623 ferrous
FT                   iron transport protein B; PFAM: Ferrous iron transport
FT                   protein B domain protein; GTP-binding protein HSR1-related;
FT                   nucleoside recognition domain protein; Ferrous iron
FT                   transport B domain protein; SPTR: Ferrous iron transport
FT                   protein B; TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: Ferrous iron transport protein
FT                   B; Ferrous iron transport protein B C terminus; Nucleoside
FT                   recognition; TIGRFAM: ferrous iron transporter FeoB; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79326"
FT                   /db_xref="GOA:E1R8I2"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I2"
FT                   /protein_id="ADK79326.1"
FT                   /translation="MKRVEGGASVSNFTIALAGNPNCGKTTLFNALTGGNQRIGNWPGV
FT                   TVEKKEGWLSGSKQRKVVDLPGIYSLNAGSEDERVARDYLLSGEADLVVNIVDASHLER
FT                   NLYLTTTIMEMGVPVVLFLNMMDLLEKEGSTINIKELESALGVPVVAGTATDKKSVAEA
FT                   VARITELVGNVRPSDHKPVYPNEIEELISKWEKQAGGRWNALALYEGTAPSELHGRIPT
FT                   EKIAAEREKISSLLKEESEVILADSRYGFIRGVIHDVFHAQERRRSVSEQIDKVVLNRF
FT                   LGIPIFLVVMYLMFWLAISVGSSFIDFFDVLFGTIFVDGFGVLLGSIGSPDWVVSFLAG
FT                   GVGAGIQTVATFVPVVFFMFLALSLLEDSGYMARAAFVMDRLMRALGLPGKAFVPMIVG
FT                   FGCTVPAILATRTLENKRDRFMTIFMAPFMSCGARLPVYALFGAALFGAHAGAIVFSIY
FT                   IIGVLLAVLTGLFLKHSLFRGEPGYFIMELPPYHAPRFKHVMIHTWTRLKVFLARAGKV
FT                   IVIAVFLLGVLNSLGTDGSFGNEDTENSVLAVTGKAITPIFSPMGIKEESWPATVGLFT
FT                   GLFAKEAVVGTLNGLYGQIAAAENNVAGDEGGEEEAFSLGAGIKDSFVALKDGVLGISG
FT                   GIGSIVGADVISGGDEEAVAEAAEVDISIFSLMRRGFTPVSGYAYLLFVLIYFPCLAAF
FT                   GAIVKEMGIGLGILEAIYLTVSAWAVAVFYYQIAEGGNFLWMIVSAAIMVAQFFVFRAI
FT                   GNRNRKKEALQSA"
FT   gene            175463..175849
FT                   /locus_tag="Spirs_0170"
FT   CDS_pept        175463..175849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0170"
FT                   /product="Domain of unknown function DUF2023"
FT                   /note="InterPro IPR018594; KEGG: bfs:BF2690 hypothetical
FT                   protein; PFAM: Domain of unknown function DUF2023; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF2023)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79327"
FT                   /db_xref="InterPro:IPR018594"
FT                   /db_xref="InterPro:IPR036780"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I3"
FT                   /protein_id="ADK79327.1"
FT                   /translation="MKVLAHHIYEYKKGLRSLVLHTLDASYEAEAVRRLERNNISYLIR
FT                   RVNKRKINIFFGNKACVHVVTSFGDKPLNAFTPEEDFILGIMLGYNRTEQCKRYLARKE
FT                   IFEIEAETARDLSFLPSGSLEKTG"
FT   gene            complement(175886..176524)
FT                   /locus_tag="Spirs_0171"
FT   CDS_pept        complement(175886..176524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0171"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG3437 Response regulator containing a
FT                   CheY-like receiver domain and an HD-GYP domain; InterPro
FT                   IPR006675:IPR003607:IPR006674; KEGG: tex:Teth514_1141 metal
FT                   dependent phosphohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region; SPTR: Putative uncharacterized
FT                   protein; TIGRFAM: metal dependent phophohydrolase; PFAM: HD
FT                   domain; TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79328"
FT                   /db_xref="GOA:E1R8I4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I4"
FT                   /protein_id="ADK79328.1"
FT                   /translation="MATAEDKITLHEMVEVIVTILNARDPYTYEHSWRVAALCEQIAKE
FT                   MNVPQKWIDTLHIAAHLHDIGKVGIPDFILNKPGKLLPYEYELIKAHSIIGYQIVHKIP
FT                   ILQEIALYIRHHHERWDGKGYPDGLAGKEIPLGSRIIAVADTFDAITTHRPYRSPRPLG
FT                   EAFTEIKAAAGSQLCPETCEVFIGMEKKITQLLGTVEQELKEAGRSLKK"
FT   gene            176646..177143
FT                   /locus_tag="Spirs_0172"
FT   CDS_pept        176646..177143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0172"
FT                   /product="flavodoxin"
FT                   /note="COGs: COG0716 Flavodoxins; InterPro
FT                   IPR001094:IPR010086:IPR008254:IPR001226; KEGG:
FT                   paa:Paes_0557 flavodoxin; PFAM: flavodoxin/nitric oxide
FT                   synthase; SPTR: Flavodoxin; TIGRFAM: flavodoxin; PFAM:
FT                   Flavodoxin; TIGRFAM: flavodoxin, long chain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79329"
FT                   /db_xref="GOA:E1R8I5"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I5"
FT                   /protein_id="ADK79329.1"
FT                   /translation="MSKIAIFYGSTTGNTKDAAERIKNAFGDVELFDIADTSVEKMEQF
FT                   DAVVVGTSTWGAGDLQDDWEMAIGKLGAVNLAGKKMAFFGLGDQESYSDTFVDGMGQLY
FT                   DAFAKKDVSCIGQWPTDGYDFEESSAVRDNAFIGLALDEDNQSDLSDGRIASWAEQVKK
FT                   EL"
FT   gene            complement(177237..178136)
FT                   /locus_tag="Spirs_0173"
FT   CDS_pept        complement(177237..178136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0173"
FT                   /product="Sirohydrochlorin cobaltochelatase"
FT                   /EC_number="4.99.1.3"
FT                   /note="COGs: COG4822 Cobalamin biosynthesis protein CbiK
FT                   Co2+ chelatase; InterPro IPR010388:IPR019758; KEGG:
FT                   ctc:CTC00743 anaerobic cobalt chelatase CbiK; PFAM:
FT                   anaerobic cobalt chelatase; PRIAM: Sirohydrochlorin
FT                   cobaltochelatase; SPTR: Anaerobic cobalt chelatase cbiK;
FT                   PFAM: Cobalt chelatase (CbiK)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79330"
FT                   /db_xref="GOA:E1R8I6"
FT                   /db_xref="InterPro:IPR010388"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I6"
FT                   /protein_id="ADK79330.1"
FT                   /translation="MKSKSMRKVACMALALAGSLMLAACASTGGEKLTMNTNGKKGILV
FT                   ISFGTSYPETRAVTIDACEQKIAEAFPEYEVRRAFTSHIIIGILDKRDGIHVDAPAEAL
FT                   EKMYKEGFSEVLIQPLHIIPGEEYTGEVLAVARRYSGKFEKIAIGSPILSTTENYWKAV
FT                   DAVSAQLPSLGTGEAVVLMGHGTEHPANCAYAAFQYMLARKGLPVYVGTVEGYPALDDV
FT                   IDLLHRDHISKVTLMPFMVVAGDHATNDMAGDEDDSWKSILTKEGFTVDVYLHGLGENS
FT                   IIQNMYIDNLHSAEVINE"
FT   sig_peptide     complement(178059..178136)
FT                   /locus_tag="Spirs_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(178164..180140)
FT                   /locus_tag="Spirs_0174"
FT   CDS_pept        complement(178164..180140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0174"
FT                   /product="TonB-dependent receptor"
FT                   /note="COGs: COG4771 Outer membrane receptor for
FT                   ferrienterochelin and colicins; InterPro
FT                   IPR012910:IPR000531; KEGG: cts:Ctha_2253 TonB-dependent
FT                   receptor; PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; SPTR: TonB-dependent receptor; PFAM:
FT                   TonB-dependent Receptor Plug Domain; TonB dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79331"
FT                   /db_xref="GOA:E1R8I7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I7"
FT                   /protein_id="ADK79331.1"
FT                   /translation="MAMTRQLLPVVLLIAGAFAWPPALSAQQQEGKPEDEAAEAQAETI
FT                   EEQTEEADALPVLNIVVAGTRTEKEQKDSPIQTEVITEDQIEASGSDTLEGVLGETGLQ
FT                   FAETGMGSHVQMQGMDGERILFLIDGRRVSGRVASNIVANTIAMDNVERIEIIRGPQSA
FT                   LYGSEAIGGVINIITKEPDYELSGDYQVTTRALLPISESSDPAYTSLANKQSGLAHLNL
FT                   PIGAFANRLTLSAEHAFPYLDDEDQSLYPGATRADAGLDSDIVLSSGGTLAFGSAYSFH
FT                   RQKENISSGGAFDRIDTQRLNSYIAYDVTTEKKGFLKANLYHNYFQRDKSQYSSILDEW
FT                   NDSGSEYQHYLSGDLQYTQPLGDQNELTMIGSYGYDRLKKYNIGDYAVHQRHTFSLVLQ
FT                   DEQYKKDSYSLLAGLRSEYSNDYGIFFAPKLSGMYVPRPGIRILPSVGLGYRAPSFLEL
FT                   YLDSAGNIYHKYGNPDLDPERSVSFNLGVDWTRENVTLQFAGYHSELSDEIVYDYTDRA
FT                   DDDGRQVIIKENLDRSSRSGFDLSLNWNVLSDLSMTARYGYLFAYDRSAGEELDLVPSH
FT                   TGGASVHYLLKPLALKAKFSTSVTGPHERSEHTLVTFDVYLEKSLKDNFELFGGVDNIT
FT                   GVQDDFSDLLAGPVLYLGIRGSF"
FT   sig_peptide     complement(180063..180140)
FT                   /locus_tag="Spirs_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(180140..180976)
FT                   /locus_tag="Spirs_0175"
FT   CDS_pept        complement(180140..180976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0175"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kko:Kkor_2439 Na-Ca exchanger/integrin-beta4;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79332"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I8"
FT                   /protein_id="ADK79332.1"
FT                   /translation="MRKHVYTKNVGKAITPFLVILLFFAGCDLNSSGSSDSDGDTITYE
FT                   GKRNKPSDTWIYTYLFIDLEDPENPVEATGGDDLSTITEGSNTNWEIMITAQKEILTNS
FT                   GVTATSLSSSGQGGVVYAQTSNFDQSISITEAQALFADDSNDYSNDGKDYSYYGKYKVD
FT                   SSDPSEPTTGNAISYPGYAYNSSYPQDPQRDGQAPSTAWAFGEVGAHVDVNFGLGRAYA
FT                   EWERMSPNFSNFTNNVYIVRGGDGSSYYKLQILDAEYLSDSTNRTYIYKVKTAKIQ"
FT   gene            complement(181581..182609)
FT                   /locus_tag="Spirs_0176"
FT   CDS_pept        complement(181581..182609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0176"
FT                   /product="nicotinate-nucleotide/dimethylbenzimidazolephosp
FT                   horibosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /note="COGs: COG2038 NaMN:DMB phosphoribosyltransferase;
FT                   InterPro IPR017846:IPR003200:IPR000209; KEGG: fno:Fnod_1365
FT                   nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase; PFAM:
FT                   Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; PRIAM:
FT                   Nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase; SPTR:
FT                   Nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase;
FT                   TIGRFAM:nicotinate-nucleotide/dimethylbenzimidazole
FT                   phosphoribosyltransferase; PFAM: Phosphoribosyltransferase;
FT                   TIGRFAM: nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79333"
FT                   /db_xref="GOA:E1R8I9"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I9"
FT                   /protein_id="ADK79333.1"
FT                   /translation="MNNEQIRTAARKHLDGLTKPVGSLGKLEDFAVKMAEIQGKVVPES
FT                   GKMGAFVIAADHGINEAGVSMYPKEVTKQMVANFTQNGAGINVLARHCGFDVFIVDAGI
FT                   ASDVDLSQVIGCKAGYGTRNFHEIEAMTADQLEICLANGKQLAENAVTEGYKILALGDM
FT                   GISNTTTAAAMAIAGGLPAESIIDKGTGISSEMLDHKRRVILESIERHAPFSDAKDIMR
FT                   KVGGFELATMAGFILGLKGKGCACMIDGFPVTAGAYMAWLMDNEVSAYLFAGHKSKVKG
FT                   HAVMLQAMGLEAIVELDMRLGEGTGAVIGGFLVNLGIKIASEMASFNDAGVSQSTGKEE
FT                   NY"
FT   gene            complement(182606..183748)
FT                   /locus_tag="Spirs_0177"
FT   CDS_pept        complement(182606..183748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0177"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0079 Histidinol-phosphate/aromatic
FT                   aminotransferase and cobyric acid decarboxylase; InterPro
FT                   IPR004839:IPR004838; KEGG: dev:DhcVS_593
FT                   histidinol-phosphate aminotransferase; PFAM:
FT                   aminotransferase class I and II; SPTR: Aminotransferase
FT                   class I and II; PFAM: Aminotransferase class I and II;
FT                   TIGRFAM: histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79334"
FT                   /db_xref="GOA:E1R8J0"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J0"
FT                   /protein_id="ADK79334.1"
FT                   /translation="MVPDAKHQAGKPEQAALIRPELLTSQTVPHGGREAKPFDFSVCLN
FT                   PFPLPDPVVTAIAAAPMNRYPDTRGRQLAGELARLHGCDPERLLLTNGVSQAIFLTAFG
FT                   LLERGRNVLVVGPTYEEYAKNSALMGARIDSFRAKPQEGFTLSIPSLIRTIGELKPALT
FT                   WICNPNNPTGLLLDRRDIEEIADSCSSCGGLLVVDEAYMNFVDENRRYCAEAENIVVLR
FT                   SMTKDFALPGLRLGYSIAPHRIARALSAARPEWSINAPALAAGLAAIQHREVFETQWRR
FT                   LRLQRQSLETAAAALGYGIFPGTANFFLLYSGAKARARRFREHLAASDIALRDCTSFDL
FT                   PGFYRIGISSEENNRQLLGFLAAESGPTGQDETTEKREKT"
FT   gene            complement(183738..184700)
FT                   /locus_tag="Spirs_0178"
FT   CDS_pept        complement(183738..184700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0178"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="COGs: COG1270 Cobalamin biosynthesis protein
FT                   CobD/CbiB; InterPro IPR004485; KEGG: det:DET0688 cobalamin
FT                   biosynthesis protein CobD; PFAM: cobalamin biosynthesis
FT                   protein CbiB; SPTR: Cobalamin biosynthesis protein CobD;
FT                   TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   CobD/Cbib protein; TIGRFAM: cobalamin biosynthesis protein
FT                   CobD"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79335"
FT                   /db_xref="GOA:E1R8J1"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J1"
FT                   /protein_id="ADK79335.1"
FT                   /translation="MNLCLPILAGALLYDLLWGDPPNRFHPVAWMGSLISRLWQHRPKQ
FT                   GKWLLFSYGALMTICGALLFSLPLLLLNRIPILPRLVLSIVFLKMSFSLTTLLRTGDKI
FT                   ARALEAGDLASARKLTAFHLVSRNTSELEESELCGAVVESLAENLTDSFTSPLLYYLLA
FT                   GLPGAFAFRYINTSDAMIGYRTGDFEFGGKWAARCDDLLNFIPARVTALLIILAGSIIP
FT                   IRSAPGEGNGAGRKRSLASLFAWQNATESPNAGWTMGAAAAILGLRLEKRGHYVINSTG
FT                   RLPKPADIRRCIRLVRRSALLFLLLLAGILACTGVILGS"
FT   gene            complement(184697..186169)
FT                   /locus_tag="Spirs_0179"
FT   CDS_pept        complement(184697..186169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0179"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="COGs: COG1492 Cobyric acid synthase; InterPro
FT                   IPR004459:IPR002586:IPR011698:IPR017929; KEGG:
FT                   deg:DehalGT_0781 cobyric acid synthase CobQ; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase;
FT                   Cobyrinic acid ac-diamide synthase; SPTR: Cobyric acid
FT                   synthase CobQ; TIGRFAM: cobyric acid synthase CobQ; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain;
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   cobyric acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79336"
FT                   /db_xref="GOA:E1R8J2"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J2"
FT                   /protein_id="ADK79336.1"
FT                   /translation="MIQGTSSNVGKSLLVAAFCRIFARKGLRVFPFKSQNMALNSFVTS
FT                   EGLEIGRAQALQATAAKRDAEVAMNPVLLKPEGNSSSQVVLMGKPWRRLSGGEYYKAKP
FT                   ALWETITEVLDRAGKENDLLIVEGAGSPAEINLKEHEIVNMRVARYLQAPVLLAADIDR
FT                   GGVFAFLYGTLALLEPEERELVKGFIINKFRGDVELLKPGLDMLRNLTGGVPTLGVVPY
FT                   LKEISLAQEDSVFLEEHRFFGSGSTEIAVMLLPHISNYDDFDALTMEPGLQLRFVEHPR
FT                   ELGNPAAIILPGTKTTMADLLWLRQSGLAEAICRKVEEGTSVIGICGGFQMLGRQIIDK
FT                   EGVEGSAGSLRGLGLLDVTTYFSREKKTIQETGTLCSDKGTLAPMKGYKVSGYEIHMGH
FT                   SALGESAGPFLATGSGGRDGAVSPDGRIIGTYFHGLFDEAAFRRGWLASLGWEPEGKPV
FT                   SLVQRREEELEALADAVEAAIDMKQLEAIIGL"
FT   gene            186599..187630
FT                   /locus_tag="Spirs_0180"
FT   CDS_pept        186599..187630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0180"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR002491; KEGG:
FT                   aoe:Clos_0318 periplasmic binding protein; PFAM:
FT                   periplasmic binding protein; SPTR: Periplasmic binding
FT                   protein; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79337"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J3"
FT                   /protein_id="ADK79337.1"
FT                   /translation="MVFVRRALAVFLLFVCMTSLLFAGGTQEPASDRKVAGSPQSGMSI
FT                   LGESDASVRFREVSGRIVEIPKFPKRTVIMHNSILDLWYMAGGTSLARLRGAINVPAEA
FT                   KDLPVLGSIASIDVEKIMKLEPDLLIFSGTSEYQRKISDFFASEGVASLGINYENYDDF
FT                   GLIFDLFTRLNGRRDLYEAYLIPTQEKVQSIIDRVPKGVHPKVCILFASTNYVKVETEE
FT                   TVTGDYCKRLGAVNIYRESAFEGAGRVDLSLEYILEQDPDLIFVTTMGDVEKCTARIEM
FT                   EVSSNPVWASLSAVKNGRFHYLDKSFSIYKPNRAYPEAFQRIAELLYPGTDFSLGSGEG
FT                   KAE"
FT   sig_peptide     186599..186667
FT                   /locus_tag="Spirs_0180"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            187627..188652
FT                   /locus_tag="Spirs_0181"
FT   CDS_pept        187627..188652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0181"
FT                   /product="transport system permease protein"
FT                   /note="COGs: COG0609 ABC-type Fe3+-siderophore transport
FT                   system permease component; InterPro IPR000522; KEGG:
FT                   aoe:Clos_0319 transport system permease protein; PFAM:
FT                   transport system permease protein; SPTR: Transport system
FT                   permease protein; PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79338"
FT                   /db_xref="GOA:E1R8J4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J4"
FT                   /protein_id="ADK79338.1"
FT                   /translation="MSRFDIRSRTGYRLAILVLLLCLLFAALLLAIRFGSSGFTFRQIL
FT                   RALFIDTTSVDHRILMMVRMPRAIAAALVGFCLALSGTLLQGVMRNPLASPNVIGVSAG
FT                   AGLAAVCIYILFPGHYFLVTPVAFGGAFLAALLVYLLAWKGGASPLRLVLSGIAVSSFL
FT                   GAGSNALMIFFPDRVQHVIGFMVGNLSAVTWQQVRILWPYAFIGFLFSMLLADRLNILL
FT                   LGDETANSLGLNVEASRMFFMLIASLLAASAVSIVGLLGFVGLIVPHVARLVIGNNARY
FT                   LIPASALLGAVVVLLCDTLGRVILRPQELPVGIIMAMLGAPFFLYLLRQKGEKMGGGHG
FT                   H"
FT   sig_peptide     187627..187740
FT                   /locus_tag="Spirs_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            188642..189424
FT                   /locus_tag="Spirs_0182"
FT   CDS_pept        188642..189424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0182"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems ATPase components; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: aoe:Clos_0320 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79339"
FT                   /db_xref="GOA:E1R8J5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J5"
FT                   /protein_id="ADK79339.1"
FT                   /translation="MVIEADKLCLGYGGKPIVKDLSLSVPAGSWASIIGPNGCGKSTLL
FT                   KALSRNLKPVSGSVRVMDRPLDSYGGRGLARTMAFLAQTPQIPDYFSVKELVGYGRYPH
FT                   TGWFGSFRPRDREVVEQALEATDMLDFSEREVASLSGGERQRAWIAMALAQEAELLLFD
FT                   EPTTHLDIAYQFQILELIDRLRREMGRTVVTVLHDLNQAARYSDQLFVMKDGRIFATGE
FT                   PSVVLTPPLLGDVFSIDVRLLQDEEHDCPFVVPLGGKQ"
FT   gene            189424..190920
FT                   /locus_tag="Spirs_0183"
FT   CDS_pept        189424..190920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0183"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="COGs: COG1797 Cobyrinic acid a c-diamide synthase;
FT                   InterPro IPR004484:IPR002586:IPR011698:IPR017929; KEGG:
FT                   adg:Adeg_0183 cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; CobB/CobQ domain
FT                   protein glutamine amidotransferase; SPTR: Cobyrinic acid
FT                   a,c-diamide synthase; TIGRFAM: cobyrinic acid a,c-diamide
FT                   synthase; PFAM: CobQ/CobB/MinD/ParA nucleotide binding
FT                   domain; CobB/CobQ-like glutamine amidotransferase domain;
FT                   TIGRFAM: cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79340"
FT                   /db_xref="GOA:E1R8J6"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J6"
FT                   /protein_id="ADK79340.1"
FT                   /translation="MEHISSLALPRFVIAGASSGSGKSTLTLALIEALHRRGYRPLPWK
FT                   VGPDYIDPGHLSAAAGLACRNLDPVLMGEAGMVSSFIGHCNEACRKEPKSLAVIEGVMG
FT                   LFDGRGGLSSEGSTASVAKSLSAPVIVVIDAGAAAQTAGAVALGMQQFDPDCPVAGFIA
FT                   NRIGSDRHFSMVRRAVEGATGLPVLGWLPKSSMPSMPERHLGLVAAWEEEGRQRLSSLL
FT                   RILGDAAAEHIDLDALLAIAASASSLTPIRGESVDGIDISGSSGGKADRAVAGIGTDTP
FT                   SPCIAVAMDDAFHFYYQDNLDMLESLGARIVPFSPLSASRLPDGCDGVYIGGGYPELHA
FT                   ERLSANRTMIESIRAASFDNMPIYAECGGLMYLCRRLFVGGKGYPMVGLFDTEIEMGNK
FT                   LSALGYHKARTLRPSVIGPAGMELVGHIYRWSNMVKGPSETEWLFRLDKEGTIGFDGLS
FT                   VRRSTAAYLHLHFTGVPEPARHLVAACREYRQSRSKHDEQ"
FT   gene            190910..191554
FT                   /locus_tag="Spirs_0184"
FT   CDS_pept        190910..191554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0184"
FT                   /product="Precorrin-8X methylmutase CbiC/CobH"
FT                   /note="COGs: COG2082 Precorrin isomerase; InterPro
FT                   IPR003722; KEGG: scl:sce0238 hypothetical protein; PFAM:
FT                   Precorrin-8X methylmutase CbiC/CobH; SPTR: Precorrin-8X
FT                   methylmutase CbiC/CobH; PFAM: Precorrin-8X methylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79341"
FT                   /db_xref="GOA:E1R8J7"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J7"
FT                   /protein_id="ADK79341.1"
FT                   /translation="MNSSRGKAITEESFRIIRSRLGDFSAGDDVTEIVIRIAHTTGDVE
FT                   FGKSCHVPELSVKRGIEAISSGCPIVTDVEMVRTGIRAALAEKLGCRVHCFLNDTKVID
FT                   GTRQSGETRSALGMRQAAEHSLLNGAVVAIGNAPTALFALLSMIESGRVKPALVVGIPV
FT                   GFVGALESKQALYDSGYPCITNLSERGGSPIAAAIVNGLLFLAEQRAEQRG"
FT   gene            191557..192696
FT                   /locus_tag="Spirs_0185"
FT   CDS_pept        191557..192696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0185"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="COGs: COG1903 Cobalamin biosynthesis protein CbiD;
FT                   InterPro IPR002748; KEGG: pth:PTH_0951 cobalamin
FT                   biosynthesis protein; PFAM: cobalamin (vitamin B12)
FT                   biosynthesis CbiD protein; SPTR: Cobalamin biosynthesis
FT                   protein CbiD; TIGRFAM: cobalamin biosynthesis protein CbiD;
FT                   PFAM: CbiD; TIGRFAM: cobalamin biosynthesis protein CbiD"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79342"
FT                   /db_xref="GOA:E1R8J8"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J8"
FT                   /protein_id="ADK79342.1"
FT                   /translation="MAQWYDQELGKVSGMRLGITTGSCAQAAARAALEFLLGIFADKRV
FT                   EITLPKGHRRYSGRQILVPVESIGATSDGTGAEALVRKDSGDDPDITDGILIGARVRLK
FT                   EGNGVEIDGAEGVGRITRPGLAGKVGEAAINPIPRRMIREELLPLLPEGKGCRVEIFVP
FT                   EGIALAEKTWNPRIGILGGISIIGTKGVVEPKSEEAYKASINRVIHSYLKSGMSRLIIT
FT                   PGYVGEAFLSSRGIALDRVVTVGDHVGHALLRGADHGAKELLLVGHIGKLTKIAVAMFN
FT                   THWSSGDARLEVIAAYAGAAGASAEKVRRLLSLSLAEEAVALIHDWGLDEIWNAIARRA
FT                   AERTEKLVEGRCTIGVVLLDLKGHSLGSWPKERVEGWLK"
FT   gene            192693..193367
FT                   /locus_tag="Spirs_0186"
FT   CDS_pept        192693..193367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0186"
FT                   /product="Precorrin-6B methylase 1"
FT                   /note="COGs: COG2241 Precorrin-6B methylase 1; KEGG:
FT                   cac:CAC0584 precorrin-6B methylase 1 CobL1/CbiE; SPTR:
FT                   Precorrin-6y C5,15-methyltransferase (Decarboxylating),
FT                   CbiE subunit; PFAM: Tetrapyrrole (Corrin/Porphyrin)
FT                   Methylases; TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79343"
FT                   /db_xref="GOA:E1R8J9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J9"
FT                   /protein_id="ADK79343.1"
FT                   /translation="MIHIIGTGPGDGRYTLDLARETIKTCTVFAGFRSHALRFIPPSSP
FT                   FVDLSSDGGVGIYSGLDEIDRLRLGGEDEIGILVSGDPGFHSLLPLVRSRYPQWELRIV
FT                   PGLSAFQVACAKIGIPWQELELVSLHGSGGEDIASFVRRFVSHPPSGMSGFVVLTAGPR
FT                   GDRDLAERIIVEEPRFRGFKAWFCWDIGEDGESIAYCRLDAVQEGGRLCTIIMHRMEEE
FT                   SV"
FT   sig_peptide     192693..192800
FT                   /locus_tag="Spirs_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            193364..194140
FT                   /locus_tag="Spirs_0187"
FT   CDS_pept        193364..194140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0187"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="COGs: COG2875 Precorrin-4 methylase; InterPro
FT                   IPR006362:IPR000878:IPR003043; KEGG: mta:Moth_1092
FT                   precorrin-4 C11-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; PRIAM:
FT                   Precorrin-4 C(11)-methyltransferase; SPTR: Precorrin-4
FT                   C11-methyltransferase; TIGRFAM: precorrin-4
FT                   C11-methyltransferase; PFAM: Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases; TIGRFAM: precorrin-4
FT                   C11-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79344"
FT                   /db_xref="GOA:E1R8K0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8K0"
FT                   /protein_id="ADK79344.1"
FT                   /translation="MKVYFIGAGPGDPELITLRGRRLIEEAEIVMYAGSLVNPKLLDWA
FT                   LPEAEIYDTSSMDLDAICAVFKKRAGHTGSIARLHTGDPSLYGAIGEQIRFCRAERISW
FT                   EVVPGVSSFSASAAALGRELTLPGISQTVILSRRQGRTPVPEPQRLRALAQSQSTLVLF
FT                   LSASMVKEAMEEIAPFYGTDTPAAAVYRASWPDQRIIEGTISTLAGLMQEAGIDRQAII
FT                   LVGDVLNPGSFEASKLYDANFSHGFRSGRETTGGEA"
FT   gene            194137..195780
FT                   /locus_tag="Spirs_0188"
FT   CDS_pept        194137..195780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0188"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="COGs: COG1010 Precorrin-3B methylase; InterPro
FT                   IPR006363:IPR002750:IPR000878; KEGG: rca:Rcas_0637
FT                   precorrin-3B C17-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase;
FT                   cobalamin (vitamin B12) biosynthesis CbiG protein; SPTR:
FT                   Precorrin-3B C17-methyltransferase; TIGRFAM: precorrin-3B
FT                   C17-methyltransferase; PFAM: Cobalamin synthesis G
FT                   C-terminus; Tetrapyrrole (Corrin/Porphyrin) Methylases;
FT                   Cobalamin synthesis G N-terminal; TIGRFAM: precorrin-3B
FT                   C17-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79345"
FT                   /db_xref="GOA:E1R8K1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8K1"
FT                   /protein_id="ADK79345.1"
FT                   /translation="MKLAALCINEAGKNAAALLAGQMPDLSVVDCSRPGSLAEESARLF
FT                   PLYEGLIFFSAVGIAVRMISGFLRDKYHDPAVVVVDNGCRNAVSLLSGHEGGANRLCWE
FT                   VSRILGCRPVVSTATEARRSIVLGIGTRKDIAASTVAEAVTTALMEAGLSLSDVRIAAT
FT                   IGKKCLEPGLLEALADLDIPLSRVSAREISRFSGAFLPSAAARHIGIPAVAEPCALLAA
FT                   RQGSLIAPLYRRDGVTVAIARERIGPLSISDELSASADLPQVSESINSVNGGSAGEHAG
FT                   GEAEGLPPHRKLHTKGVLYVVGIGPGSPEHMTLAAVRAIEACEVVVGYHRYLELLGELI
FT                   EGKEIFASGMRKEKDRAAAAIDLARTGRIVTVVSTGDAGIYGMAGLILELAGTEAGERF
FT                   DLRIIPGVTAASSAAALLGAPLMHDFAVISLSDLLTEASLIEKRLRLAAEGDFITVLYN
FT                   PKSRSRKALLEKALDSFRACRPLDTPAAVVTNALREGQSVRLESLGSIDADDPDIGMSS
FT                   VVVIGNSSSYRQGRWFITPRGYKIEEPHEG"
FT   gene            195770..196036
FT                   /locus_tag="Spirs_0189"
FT   CDS_pept        195770..196036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0189"
FT                   /product="cysteine-rich small domain protein"
FT                   /note="COGs: COG2158 Uncharacterized protein containing a
FT                   Zn-finger-like domain; InterPro IPR007212; KEGG:
FT                   dsa:Desal_0255 cysteine-rich small domain protein; PFAM:
FT                   cysteine-rich small domain; SPTR: Cysteine-rich small
FT                   domain protein; PFAM: Cysteine-rich small domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79346"
FT                   /db_xref="InterPro:IPR007212"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8K2"
FT                   /protein_id="ADK79346.1"
FT                   /translation="MKDKRPYSHKFFENRDCRYYPCHQGIEEMNCLFCFCPLYQFPDCG
FT                   GDYRLTADGVKDCTGCIRPHIPENYDLIIAELKRRKSPPGKKK"
FT   gene            196042..196887
FT                   /locus_tag="Spirs_0190"
FT   CDS_pept        196042..196887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0190"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="COGs: COG0388 amidohydrolase; InterPro IPR003010;
FT                   KEGG: drm:Dred_2191 nitrilase/cyanide hydratase and
FT                   apolipoprotein N-acyltransferase; PFAM: Nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase; SPTR:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; PFAM: Carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79347"
FT                   /db_xref="GOA:E1R8K3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8K3"
FT                   /protein_id="ADK79347.1"
FT                   /translation="MAGEDKLRIGLAVMEARPGDVRHNAAIVEHLCDEAAEAGAMLICF
FT                   PEAALTSYSGPKARELALYPEEVAAILLPLADRYGLTIFCGFIEAGESGGKPFVSQAVA
FT                   LPGASEIGLYRKSHLGTLEQEWFEAGNEIGLFDIGTMIGVGGSAGPTVGIQLCIETHLP
FT                   EIALAQSLRGAALILAPFASPLSAQRRRELWLRYLPARAYDNGLYVASCNLCGGRFGGG
FT                   ALIIDPKGQAVVEDFSGRQALLCADIDLSLVKDLRQQKSTKDPAMGDRWYPSLRRPELY
FT                   "
FT   gene            197004..197432
FT                   /locus_tag="Spirs_0191"
FT   CDS_pept        197004..197432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0191"
FT                   /product="PilT protein domain protein"
FT                   /note="InterPro IPR002850:IPR002716; KEGG: cyc:PCC7424_2307
FT                   PilT protein domain protein; PFAM: PilT protein domain
FT                   protein; SPTR: PilT protein domain protein; PFAM: PIN
FT                   domain; TIGRFAM: conserved hypothetical protein TIGR00305"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79348"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8K4"
FT                   /protein_id="ADK79348.1"
FT                   /translation="MNAFPVVIDTNVILSGLRFRNGFSFTLLKQIPEKLFTMCISVPLI
FT                   LEYETVLTKHMKQTGLTKEDIGDFIDYTCCVGRRTEIFYLWRPVLKDPFDDHVLELAVA
FT                   SGSRYIISFNKKDFSPARSFGIGVVSPKEFLQSKEEIE"
FT   gene            197429..197662
FT                   /locus_tag="Spirs_0192"
FT   CDS_pept        197429..197662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0192"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="InterPro IPR002145; KEGG: srm:SRM_00772 hypothetical
FT                   protein; PFAM: CopG domain protein DNA-binding domain
FT                   protein; SPTR: CopG domain protein DNA-binding domain
FT                   protein; PFAM: Ribbon-helix-helix protein, copG family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79349"
FT                   /db_xref="GOA:E1R8K5"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8K5"
FT                   /protein_id="ADK79349.1"
FT                   /translation="MSSLSIRIPESLHETLKKISKKDRVSINQFIASAVAEKVTALETE
FT                   EYIKVRGEKGTIDKFNNVLSKVKNIEAEENDT"
FT   gene            complement(197713..198450)
FT                   /locus_tag="Spirs_0193"
FT   CDS_pept        complement(197713..198450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0193"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /note="COGs: COG2243 Precorrin-2 methylase; InterPro
FT                   IPR006364:IPR000878:IPR012382; KEGG: cvi:CV_1565
FT                   precorrin-2 C20-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; SPTR:
FT                   Precorrin-2 C20-methylase; TIGRFAM: precorrin-2
FT                   C20-methyltransferase; PFAM: Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases; TIGRFAM: precorrin-2
FT                   C20-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79350"
FT                   /db_xref="GOA:E1R8K6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8K6"
FT                   /protein_id="ADK79350.1"
FT                   /translation="MADKKSPHTRATAKLIGIGVGPGDPGLLPLASAQAIKEADIVFTP
FT                   VSRFSKASLAASIAAGTGIDESKIQKITFPMAKDTETLQKAWTQAAAPVIKALDNGLRA
FT                   VFLTLGDPSVYSTWIYLRREVEAQRPSASIAVIPGIMAANAAAARLGLPLVEGKERLVL
FT                   LPLPEKVGELDAYLPLADRIVVYKIGSRLEELALWVRERGLDEQAHLVVGVGLDREAAG
FT                   RLIDLAEKEQGYLSVALIRGRRE"
FT   gene            complement(198520..199368)
FT                   /locus_tag="Spirs_0194"
FT   CDS_pept        complement(198520..199368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0194"
FT                   /product="ABC-3 protein"
FT                   /note="COGs: COG1108 ABC-type Mn2+/Zn2+ transport systems
FT                   permease components; InterPro IPR001626; KEGG:
FT                   pca:Pcar_3024 ABC-type transport system, permease
FT                   component; PFAM: ABC-3 protein; SPTR: ABC-type transport
FT                   system, permease component; PFAM: ABC 3 transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79351"
FT                   /db_xref="GOA:E1R8K7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8K7"
FT                   /protein_id="ADK79351.1"
FT                   /translation="MLNFFGQFFHDLVTFPFLRNALLACLFLAPAAGIIGTYVTVERIN
FT                   SMAGAVAHSVLAGLGAARFLQVSFGWSYPTPLQGAAVAAVIVALIIGGITGRGRERTET
FT                   VLAAIWAIGMAIGIFFIAATPGYSQDLMSYLFGNILMIRKSDTILLLVMDLVLILVILF
FT                   RYKEIFAVTFDGEFAALRGVKVRRIYYLMLLLTSLTIVLAVQLVGIVMVIALLTLPAAT
FT                   AGLFSHTLWKMMIFASLLSFLYTGGGLAISYSADKPAGATIILFAAAVYLGTMLVKRRT
FT                   R"
FT   gene            complement(199362..200171)
FT                   /locus_tag="Spirs_0195"
FT   CDS_pept        complement(199362..200171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0195"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1121 ABC-type Mn/Zn transport systems
FT                   ATPase component; InterPro
FT                   IPR003593:IPR003439:IPR017871:IPR018184; KEGG:
FT                   pca:Pcar_3025 ABC-type transport system, ATP binding
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79352"
FT                   /db_xref="GOA:E1RA61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA61"
FT                   /protein_id="ADK79352.1"
FT                   /translation="MSDNEGRGAPSTEPLSVVNFEDVSFGYGEDRVLESVSFEILQGDF
FT                   AAIIGPNGGGKTTILKLILGLLIPDEGRIRLFDSPSEEARKRVGYVPQYTLFDPLFPAT
FT                   VEDVVLMGRLGAKSRLGFFRREDRRIAASALKTVGLEGLEKRPFPALSGGQRQRVLIAR
FT                   ALASEADLLILDEPTSNVDRTAEKEIYTLLGSLKGEKTILLVSHDTAVVSNLADTILCI
FT                   NRTLARHPGCELTGEDLGKLYGDDMKLVLHDIHNEASAASAKEDSTC"
FT   gene            complement(200171..201127)
FT                   /locus_tag="Spirs_0196"
FT   CDS_pept        complement(200171..201127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0196"
FT                   /product="periplasmic solute binding protein"
FT                   /note="COGs: COG0803 ABC-type metal ion transport system
FT                   periplasmic component/surface adhesin; InterPro IPR006127;
FT                   KEGG: dal:Dalk_1551 periplasmic solute binding protein;
FT                   PFAM: periplasmic solute binding protein; SPTR: Periplasmic
FT                   solute binding protein; PFAM: Periplasmic solute binding
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79353"
FT                   /db_xref="GOA:E1RA62"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA62"
FT                   /protein_id="ADK79353.1"
FT                   /translation="MKRHKKRCSIVSALLFMLIASLPLMAGGNRESAPTSGDSEKPIVY
FT                   SSILPVQFLADRIGGDRITSEVVVLPGESPATYEPTPKQMSALAQASLLFRVGVPFENG
FT                   FLPKVRELSPDLTIIDLRKGLTLRTMDAAHSHDEEHDGDHEGEGEDGHDHEAGTPDPHI
FT                   WMSPRNMMIMAQTMADALAAADPDGAELYKDNLAGLESDLKTLDERLAQDLEPLRGKRF
FT                   FVYHPAFGYFADDYGLIQIPLEIEGKEPTPKQLVFYIEEAKELDVEIIFVQPEFPRQSA
FT                   QTVAKEIGGMVVPVSALAKEYIANLDTVASALEEGLR"
FT   sig_peptide     complement(201050..201127)
FT                   /locus_tag="Spirs_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(201102..201392)
FT                   /locus_tag="Spirs_0197"
FT   CDS_pept        complement(201102..201392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hmg:100209601 similar to Zinc finger protein
FT                   418; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79354"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA63"
FT                   /protein_id="ADK79354.1"
FT                   /translation="MAQQKEETITFKVDPALAELLRRVPNRSEFIRKALFAQLDNVCPL
FT                   CQGSGYLTPDQKNHWEKFSKHHHVVRCESCHEYYLSCDLKEDHHEASQKEM"
FT   gene            complement(201481..202368)
FT                   /locus_tag="Spirs_0198"
FT   CDS_pept        complement(201481..202368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0198"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847:IPR005119:IPR017871; KEGG: ere:EUBREC_1090
FT                   transcriptional regulator, LysR family; PFAM: LysR
FT                   substrate-binding; regulatory protein LysR; SPTR:
FT                   Transcriptional regulator, LysR family; PFAM: LysR
FT                   substrate binding domain; Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79355"
FT                   /db_xref="GOA:E1RA64"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA64"
FT                   /protein_id="ADK79355.1"
FT                   /translation="MINPNFEYYKIFYYVGKHQNLTTAAHLLLTSQPSVSRSIKNLEHD
FT                   LSCRLFVRSKKGVTFTPEGALLYSHIASACESIFEGEKALSRALHLESGAVAIGTTEIA
FT                   IHCYLLEKLASFHKAHPKVTLTIINRSAPALIDEIKSGAIDIAVVTTPIEGEKNLTITK
FT                   VKKFRDILVAGPAFSHLGDRVLTIEELPTYPLITLSKETATYRFYSSLYASHEMTWKAD
FT                   IELATADLLIPFIKQNLGIGFVPHIMASPALASGEIRALTLSTDIPEREICIVQDKRHP
FT                   LSAASRQLIHWLAP"
FT   gene            202501..202911
FT                   /locus_tag="Spirs_0199"
FT   CDS_pept        202501..202911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccu:Ccur_10090 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79356"
FT                   /db_xref="GOA:E1RA65"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA65"
FT                   /protein_id="ADK79356.1"
FT                   /translation="MLDLLEALMILCFGLSWPISIYRSYVSRTAKGKSLFFEVFLWIGY
FT                   VFGISRKILQWYGSDSASLNFLFYLGWFFYILNIVEITIDMGLYFRNVKLDREREAEPG
FT                   IERAEEVIEESNEIIEQMKELERGLDGKAKGK"
FT   gene            203035..204087
FT                   /locus_tag="Spirs_0200"
FT   CDS_pept        203035..204087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0200"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="InterPro IPR001509; KEGG: gym:GYMC10_0509
FT                   NAD-dependent epimerase/dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase; SPTR: NAD dependent
FT                   epimerase/dehydratase family protein; PFAM: NAD dependent
FT                   epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79357"
FT                   /db_xref="GOA:E1RA66"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA66"
FT                   /protein_id="ADK79357.1"
FT                   /translation="MSYLKRERLPEYIESEEELDDLMSLPSKQLIDFQKNLEGDLIILG
FT                   VGGKIGVQLALAAKKASIAAAVPRRIIGVSRFSNPEKRTQLEEKGIETISCDLSDPVAV
FT                   KQLPDAKNVVFMVGRKFGTCGSEEETWAMNTLVPDYVSRRYANSAIVVYSTGNVYGLVP
FT                   VNCGGSIEADTLHPQGEYAISALGRERIFQYYSKKNETPISILRLNYAIDLRYGVLREI
FT                   GEKVKNQEVIDLSMGNVNVIWQGDVINQTLLSFAHCTSPANIINITGPETVSIRYVAGR
FT                   FSRLFNKPLRLEGEESGTALLNNASYAASLFGYPHVSLLTMVKWIAHWLEIGGTSLDKP
FT                   THFASRNGIF"
FT   gene            204099..205157
FT                   /locus_tag="Spirs_0201"
FT   CDS_pept        204099..205157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0201"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="COGs: COG0329 Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase; InterPro
FT                   IPR002220:IPR002136; KEGG: rba:RB7999 hypothetical protein;
FT                   PFAM: dihydrodipicolinate synthetase; ribosomal protein
FT                   L4/L1e; SPTR: Putative uncharacterized protein; PFAM:
FT                   Dihydrodipicolinate synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79358"
FT                   /db_xref="GOA:E1RA67"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA67"
FT                   /protein_id="ADK79358.1"
FT                   /translation="MNMKEIRRLLFQGMAIPAIPLALHEDGTFDPLHQRALLRYYIDSG
FT                   VGGIAAAVHTTQFEIRERPDFFRDFLTFVSGEISSYAAKKGRQILKIGGVCGNTKAAVS
FT                   EAGLLREKGFDLGLLSLATFKGKSPDSILEHCRKVAKEIPLFGFYLQPAVGGIPLSRDF
FT                   WKDFASIPNVLGIKVAPFNRYKTLDVVQGVSEAGRGHEVALYTGNDDSIIFDLLSSYPC
FT                   SGEEGRALRFSGGLLGHWCVWTSKAVELLEEIKKLRAKGSDIPFELLERAQKITDANAA
FT                   IFDAQNDFAGVIPGVHEILRRQGLLESRRCLDPSLELSPSQMGEIERVIGAYPELQDDA
FT                   FISLHIDQWLTN"
FT   gene            205170..206381
FT                   /locus_tag="Spirs_0202"
FT   CDS_pept        205170..206381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0202"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="COGs: COG1914 Mn2+ and Fe2+ transporter of the NRAMP
FT                   family; InterPro IPR001046; KEGG: phe:Phep_1689 natural
FT                   resistance-associated macrophage protein; PFAM: natural
FT                   resistance-associated macrophage protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Natural
FT                   resistance-associated macrophage protein; TIGRFAM: NRAMP
FT                   (natural resistance-associated macrophage protein) metal
FT                   ion transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79359"
FT                   /db_xref="GOA:E1RA68"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA68"
FT                   /protein_id="ADK79359.1"
FT                   /translation="MDKKGKGISQLAFLLGPGVITAATVLGPGSITVSSKSGALMEYSV
FT                   LWAVVIAGIFMATFTRMAARIGCLNDDSLLNIVRTKQHPVLAVVVGLSVFLIAGGFQTG
FT                   NNIGVGLAMDAMFGGGIMLWAPVFTIIALLFIWISRDFYKLLEKVMMTLVVIMIVAFIA
FT                   NVFMAGPSVGKIALGLVPSQPKIWGLVIAISATSFSIAAAAYQAYLVQGKGWSAAFLKK
FT                   AQRDATIGIVILCGLAALIMITSAAVLAPRGIGVKSAVDMAIQLEPLLGPLAKWLFLFG
FT                   LLAASFSSFISNAVLGGMFLSDGFGLGKSLNDISVKVFTTVLLLFSTTLAVILKTNPIE
FT                   VLVVAQASTILGGPLVAIVLLLLGNNKDVLQEHTNKPVTNVIAVLAILWISYLSYNQLM
FT                   AFIG"
FT   sig_peptide     205170..205235
FT                   /locus_tag="Spirs_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            206388..207074
FT                   /locus_tag="Spirs_0203"
FT   CDS_pept        206388..207074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0203"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="COGs: COG1309 Transcriptional regulator; InterPro
FT                   IPR001647; KEGG: reu:Reut_A1048 TetR family transcriptional
FT                   regulator; PFAM: regulatory protein TetR; SPTR: Putative
FT                   uncharacterized protein; PFAM: Bacterial regulatory
FT                   proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79360"
FT                   /db_xref="GOA:E1RA69"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA69"
FT                   /protein_id="ADK79360.1"
FT                   /translation="MLSGLASKEQYVPVLLFLPMLKFESDGIVMQKRSRDTKERIFKAA
FT                   VEEFAKSGFHGARVDNIAKKAKSNKERIYAYFGSKEDLFIEVWKRTYMLIIEVDEQFMD
FT                   LTDEDIPSLTGIILKRYVHFHQEHSEFWKIFVWENMLDGKHTEKVKGFKERPYKHLRRL
FT                   YARGQELGFFSREVSFETYMFVITAVSFFYASNRCTMSQSLSINLTNNDVVEGMIEEAT
FT                   KMLNGK"
FT   gene            207078..208277
FT                   /locus_tag="Spirs_0204"
FT   CDS_pept        207078..208277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0204"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro
FT                   IPR010169:IPR002933:IPR011650:IPR001261; KEGG:
FT                   bid:Bind_1040 acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; SPTR:
FT                   Acetylornithine deacetylase (ArgE); TIGRFAM:
FT                   acetylornithine deacetylase (ArgE); PFAM: Peptidase family
FT                   M20/M25/M40; Peptidase dimerisation domain; TIGRFAM:
FT                   acetylornithine deacetylase (ArgE)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79361"
FT                   /db_xref="GOA:E1RA70"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA70"
FT                   /protein_id="ADK79361.1"
FT                   /translation="MIMEQQLEKISQEAVRILSDLVSFRSVSGSDNEDIITYIADYLIS
FT                   YGLSPKRISAGRSHSNNLFVTIGESRDGGVLLSGHTDIVPASGAGWDSDPFVLSPRQVC
FT                   GEEMLYGRGACDMKGFLAAILALVPRWIEKRLGCNKEPIHLAFTYDEEIGCIGVDDLIA
FT                   ELGSCLPRPDAVLVGEPTLLRPADGHKSASRYITTVKGVSTHSSRPASGVNAIYGANHL
FT                   IAELQRFAGEIQSRSSRDPEARRFDPPYSTISLGTIHGGTAINVVAEQCELGWEARALP
FT                   WEDPQQYLRHIEDFSRHLSETLPDGKKLVFTHRLDSFLPGLSPKASKAYGYYQAMMVAG
FT                   NKIPQPTTTVAFGTEAGKYDQAGIPALIWGPGSIDRAHGKNEYIEKQQLVDCCALLSKL
FT                   "
FT   gene            208342..209445
FT                   /locus_tag="Spirs_0205"
FT   CDS_pept        208342..209445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0205"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_7828 peptidase M14, carboxypeptidase
FT                   A; SPTR: Glycoprotein B"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79362"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA71"
FT                   /protein_id="ADK79362.1"
FT                   /translation="MEKKSRIILLIGLGLFLCLCSPLFADPGLEALYKEHFDTLVTSVY
FT                   PLFDVRFFPSGALEDSFSPLEEQRAQELFSVLDDYLDKDEDPHPYLIDARDYGTKAFAE
FT                   GAFSIGTYAAGDDFPSLFPVIEPKFTPDGNDAMIRLALSKRAFDEEGVATAVAVAQFAN
FT                   LLKQFYDANHNSIVQFINGRNLSEEFLYMRDALMVQDSVIEFYLDASDKTLEGAEFFLA
FT                   DSFFRDQMDSVMMLGYGIDQRMMKFLDTRYQVLLSQQENFESFIDGFDQMIQGAEDNAP
FT                   DPEQGSEFDLLIYRNRVATMWIFQGWYLALLPGRFPVYDAPEPIKMKLSALLRRWEGME
FT                   DDILASEAMLTQKRTEFVARIMEPADG"
FT   sig_peptide     208342..208416
FT                   /locus_tag="Spirs_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            209438..211105
FT                   /locus_tag="Spirs_0206"
FT   CDS_pept        209438..211105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0206"
FT                   /product="Ankyrin"
FT                   /note="InterPro IPR002110:IPR020683; KEGG: afv:AFLA_025240
FT                   ankyrin repeat-containing protein, putative; PFAM: Ankyrin;
FT                   SMART: Ankyrin; SPTR: Ankyrin repeat-containing protein,
FT                   putative; PFAM: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79363"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA72"
FT                   /protein_id="ADK79363.1"
FT                   /translation="MVELQRGAAVALLLLCFSGWGFSLPEDHRPSLLSMEELSQAALQV
FT                   HDRYEIPYPPLADITLLYDGARVRAWIEACNEGKAQPMPRRWFTGTGTGFSSMIYMSCV
FT                   SFLTGKGWALAESAFEKRLGNDSVNERNRAILNAFLAIDNQEEMKEAAPRFFPFSMFLK
FT                   RRELGDGVSIMLPDVAWKLLPSGSTPLARTLVYGDEGFLRGLGYDRKRVGPGYDIRRDP
FT                   IAMASCIKVRMEKAINGNGTYLPLRPGMPFAIAKKVAVGDFFADTIWFQPFISAPDGVE
FT                   TGAEGRLYFKQGNQLFVVSLFSMVDSSHPAADGDLLLGEAASLLSTLQFPAEDTLLDSH
FT                   RLAALSDLLHAGDVSLLRPELQTIVRETGSIHFPDSHGEPFWHKIFLDFDRDDPRREAL
FT                   LKLFISLGINPDASGPSGKRAVDYVVEQGDAGLLEDVLLARAHGDYLTKDGSSPLIEAA
FT                   SGGDVWCVLTLLRAGVNVDLPDIRGRSALHWAARHDYLAVAKLLLEKGASPESRDIAGK
FT                   SPLDLSPAFQDMRRSPLFVMVQKFCGSPTWAKVQPEEQ"
FT   sig_peptide     209438..209500
FT                   /locus_tag="Spirs_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(211015..211278)
FT                   /locus_tag="Spirs_0207"
FT   CDS_pept        complement(211015..211278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0207"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC1032 transcriptional regulator; SPTR:
FT                   Putative transcriptional regulator, AsnC family; PFAM: FeoC
FT                   like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79364"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA73"
FT                   /protein_id="ADK79364.1"
FT                   /translation="MQYRSILQQIKEEGRVDKASIAEKQETTVAMIEMLLTELERLGYL
FT                   QRDALARCSGACTHCSSGCTFAHVGLPQNFWTITNKGERLIS"
FT   gene            211335..211826
FT                   /locus_tag="Spirs_0208"
FT   CDS_pept        211335..211826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0208"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="InterPro IPR005358:IPR017969; KEGG: sga:GALLO_0915
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   UPF0153; SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterised protein family (UPF0153)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79365"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA74"
FT                   /protein_id="ADK79365.1"
FT                   /translation="MDPEYRILIQTAESRGRLYRDLVRKLRRVAPKELAAVMQELHDEA
FT                   FRRIDCLKCAHCCAVVGPRLTDTDIQRLGKALSMKPSAFEDTYLIRDEDGDLVFREHPC
FT                   PFLLADNRCLLYDRRPKACREYPHTDDKHARGLLKISLVNTRFCPIVALVFQGLEERYG
FT                   "
FT   gene            complement(211823..212923)
FT                   /locus_tag="Spirs_0209"
FT   CDS_pept        complement(211823..212923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0209"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="COGs: COG2114 Adenylate cyclase family 3 (some
FT                   protein contain HAMP domain); InterPro IPR001054:IPR018370;
FT                   KEGG: amc:MADE_00483 adenylate cyclase; PFAM: adenylyl
FT                   cyclase class-3/4/guanylyl cyclase; SMART: adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; SPTR: Adenylate cyclase; PFAM:
FT                   Adenylate and Guanylate cyclase catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79366"
FT                   /db_xref="GOA:E1RA75"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA75"
FT                   /protein_id="ADK79366.1"
FT                   /translation="MEGTILIVSNLPIDTTKIRRYLAEHKIGDFDVVKVETEAAAEEIF
FT                   YGGGGVDCIVAQSEMTGTVALLKEMKQDEMFRHVPILLIIKGNETKLINEVYDSGFDAH
FT                   IVYTDIHCLPQRIRPLIVMNVMYRNMMKQVGDLHEKAISDFILLDLIKNYIPKTIWDIA
FT                   KTFAHEQKISIPEEELDLTIVFADIKGFTAMTQHMEPRQVVSILNTVFEVAAKHIYQNH
FT                   GDIDKYIGDAFFAVFTKAKEAVTAMTAMQDELEQINLQRKNQEHSPVEFRVGIHSGPII
FT                   RGNVGGHDRYDNTLIGDTVNTASRLEHIAPAGGIVISEETRTRIGITLPESCKSETELR
FT                   GRDSKITVYNAFSFLRSKLLAPQDKS"
FT   gene            212996..213250
FT                   /locus_tag="Spirs_0210"
FT   CDS_pept        212996..213250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slt:Slit_1635 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79367"
FT                   /db_xref="GOA:E1RA76"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA76"
FT                   /protein_id="ADK79367.1"
FT                   /translation="MKRFILSLLIGALAGLVAGYFVFGKSGVTGSYVPVDQLFGGAKNA
FT                   LVSLSRAVTGLDHIRNEILLSGLFGASMGVHIGSIGRRR"
FT   sig_peptide     212996..213067
FT                   /locus_tag="Spirs_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            213253..215031
FT                   /locus_tag="Spirs_0211"
FT   CDS_pept        213253..215031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0211"
FT                   /product="peptidase M24"
FT                   /note="COGs: COG0006 Xaa-Pro aminopeptidase; InterPro
FT                   IPR000587:IPR000994; KEGG: bth:BT_2743 putative
FT                   aminopeptidase; PFAM: peptidase M24; creatinase; SPTR:
FT                   Putative uncharacterized protein; PFAM: Metallopeptidase
FT                   family M24; Creatinase/Prolidase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79368"
FT                   /db_xref="GOA:E1RA77"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA77"
FT                   /protein_id="ADK79368.1"
FT                   /translation="MNNPVLPRLSALRREMEERALQAVVFFGTDPHQSEYAAPRWKDRL
FT                   WMSGFSGSAGTVVVTETEAALWTDSRYWLQATDQLDGSGIVLMADGDPSVPSLPDWLIS
FT                   KLSPGARVGVDYQTLSVASERRLSHILGTKGIALVSFESLLNDLWTDRPARPCEPLYAI
FT                   DLHYVGKSRDQKITLLRDAAKNVGADAMFLSALDEIAWLLNLRGNDIAYNPFFFSYLLI
FT                   RETDTLLFADIHAVSKELEELLAEEHITLKAYEAVGEMLREFEGTLFVDPASFSMALKG
FT                   ALSPGVRIVEEQSPVAALKARKEAVEVEGFRHALRKDGVALVRFWMRLERMLERGDGDE
FT                   ISVASLLYEERSRMPGFVGESFAPIVGFAEHGAVVHYSATKESAIPVTGRGLLLIDSGG
FT                   QYIEGTTDITRVFAVGKATEEEIFDYTTVLKAHISLATAIFPIGTVGTRLDAMARRPMW
FT                   EAGLNYGHGTGHGVGAFLGVHEGPQSISTKLLPVPIEPGMVCSNEPGVYREGKHGIRIE
FT                   NLILAVEKFNTPFGRFLGFETLTPFPFECKLIDVSLLTEGERQWVDRYHAWVFELLSSE
FT                   LNPQERSFLAAKTGVV"
FT   gene            215034..215990
FT                   /locus_tag="Spirs_0212"
FT   CDS_pept        215034..215990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0212"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="COGs: COG0053 Co/Zn/Cd cation transporter; InterPro
FT                   IPR002524; KEGG: kol:Kole_0844 cation diffusion facilitator
FT                   family transporter; PFAM: cation efflux protein; SPTR:
FT                   Cation diffusion facilitator family transporter; TIGRFAM:
FT                   cation diffusion facilitator family transporter; PFAM:
FT                   Cation efflux family; TIGRFAM: cation diffusion facilitator
FT                   family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79369"
FT                   /db_xref="GOA:E1RA78"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA78"
FT                   /protein_id="ADK79369.1"
FT                   /translation="MKEKGRKPSDFRIRMIRRASWVGILGNGLLSALKVTVGFFSGSLA
FT                   LVGDGIDSATDVVTSFVSLLTAGIVERPPDNEHPYGHARAETVATKILGFLIFFAGAQL
FT                   ALSTLRSLFSGVSRPLPEFPAAMVALVSVVGKSLLAFYKLRVGRTIDSPMLIADARNMT
FT                   GDVVISLGVFAGIGATLLSGIAFLDSIIALLVSLWIMKVAFSIFMEAGDELMDGLDNPD
FT                   LYRRLFDAVGTVKGAGNPHKARIRKLGNACIVDLDIEVDGAISVAEGHEIAREVERAIH
FT                   LQLKNVYDVQVHVEPLGNLEKKERFGLSRQSLETSGK"
FT   gene            216028..217680
FT                   /locus_tag="Spirs_0213"
FT   CDS_pept        216028..217680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0213"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /note="COGs: COG0696 Phosphoglyceromutase; InterPro
FT                   IPR005995:IPR011258:IPR006124; KEGG: mca:MCA0753
FT                   phosphoglyceromutase; PFAM: BPG-independent PGAM domain
FT                   protein; metalloenzyme domain protein; PRIAM:
FT                   Phosphoglycerate mutase; SPTR: Phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; TIGRFAM:
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: Metalloenzyme
FT                   superfamily; BPG-independent PGAM N-terminus (iPGM_N);
FT                   TIGRFAM: 2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79370"
FT                   /db_xref="GOA:E1RA79"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA79"
FT                   /protein_id="ADK79370.1"
FT                   /translation="MVEALKANPAFSGRKGPVVLVIMDGVGFGKYTEGDAVAAAHTEVL
FT                   DELMASYPMTKLKAHGIAVGLPSDDDMGNSEVGHNAIGAGRVFAQGAKRVNGAIESGEM
FT                   FTGETWKKLTENVKKSGGSLHFLGLLSDGNVHSHINHLKAMVARAKEDGVKRVRVHALL
FT                   DGRDVGETSALDYFDPFADYLASLSDGGFDAKIASGGGRMKITMDRYNADWEMVHRGWQ
FT                   IHVLGEGRQFANAHEAIETLRKETGAIDQDLPPFVIAEGGKAVGTVEDGDSFILFNFRG
FT                   DRALEITKAFEAGDDFSEFDRVRVPNVEYAGMMEYDGDLHVPKQYLVSPPSIDKTMAEY
FT                   LAASGVKMFSISETQKFGHVTYFFNGNRSGKFSEELEEYVEIPSDRVPFEERPWMKAAE
FT                   ITDRVIEEIEKGSYRFIKLNYPNGDMVGHTGIYEAVLCSMEALDLSLGRLKKAVEKAGG
FT                   VMVISADHGNSDDMFEHDKKSGAVKTKANGKPQAKTSHSLNPVPCIVYDPGYKGEYAKE
FT                   LRSGLGISSLAATCIELLGFQAPEDYDTSVFTW"
FT   gene            complement(217731..218495)
FT                   /locus_tag="Spirs_0214"
FT   CDS_pept        complement(217731..218495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0214"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="COGs: COG1349 Transcriptional regulators of sugar
FT                   metabolism; InterPro IPR001034:IPR014036:IPR018356; KEGG:
FT                   cbt:CLH_0701 deoxyribose operon repressor; PFAM: regulatory
FT                   protein DeoR; SMART: regulatory protein DeoR; SPTR:
FT                   Transcriptional regulator, DeoR family; PFAM: Bacterial
FT                   regulatory proteins, deoR family; DeoR-like
FT                   helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79371"
FT                   /db_xref="GOA:E1RA80"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA80"
FT                   /protein_id="ADK79371.1"
FT                   /translation="MNSSLRRGHLIDYLKNSRSATIQELAEHFEVSHMTIRRDLEKLIE
FT                   NQPIKIIHGGVIYQESGQGDHYSIIKARTHMLEAKKKIAKKAASLVEADDIIIIDAGST
FT                   GELIAEFLPKDRPITIICYALNIATVVSKRENCTLILTGGCYHGSSMVFESEEGLSLIK
FT                   RNRAKKAFVTASGISAKLGITCSNFFESTTKRIALKSSLTTILVADSSKFGEIQNGYFS
FT                   DLSDFDIIITDEGLPPEFRKEIARLEKTLYIE"
FT   gene            218708..219700
FT                   /locus_tag="Spirs_0215"
FT   CDS_pept        218708..219700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0215"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="COGs: COG1879 ABC-type sugar transport system
FT                   periplasmic component; KEGG: cro:ROD_24811 ABC transporter,
FT                   substrate-binding protein; SPTR: ABC transporter,
FT                   substrate-binding protein; PFAM: family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79372"
FT                   /db_xref="GOA:E1RA81"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA81"
FT                   /protein_id="ADK79372.1"
FT                   /translation="MKKIVLIIVIVLVLLPLHLFAGGQKDAADANKYEIVTVVKITGIP
FT                   WFNRLEEGVDAAAKDLDVNAYQIGPSDADPAQQVKMVEDLISKGVDAICITPNDATALE
FT                   PVFQKAKEKGILILTHESPDQAGKDVDIELIDNVEFGRHTWDMLVKYMGDKGQYAIFVG
FT                   GLTVPLHNLWADEGLKYAKEHYPGLELVTSRIPCGEDQELAKQKTLELLKTYPDLKGII
FT                   GFGSLGPPGAAQALKEKGLAGKVAVVGNVIPGHAAPYLKDGSMSHGVLWDPKDAGYSLT
FT                   YVAKYLLDGGSLADLKEIPGIGAVVVDGDVIKVDAMADITKENVDSFGF"
FT   sig_peptide     218708..218770
FT                   /locus_tag="Spirs_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            219776..221278
FT                   /locus_tag="Spirs_0216"
FT   CDS_pept        219776..221278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0216"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1129 ABC-type sugar transport system ATPase
FT                   component; InterPro IPR003593:IPR003439:IPR017871; KEGG:
FT                   rle:pRL80086 putative ATP-binding component of ABC
FT                   transporter; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: ABC transporter ATP binding protein; PFAM:
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79373"
FT                   /db_xref="GOA:E1RA82"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA82"
FT                   /protein_id="ADK79373.1"
FT                   /translation="METLFLSMKQITKVYAGVRALDGVDFSIARGEIHCLAGTNGSGKS
FT                   TLVKIISGVVAPEAGAEIIMDGELLDQHTSRTAISHGVEVIYQDLSLFPNLTVAENIAV
FT                   SSNIAQRRYLMDWKRAETTATKAMNRIGISIPLDARVGELSMADQQLVAICRALTGDVR
FT                   LLIMDEPTTALTKKEIDALLRVVIELKNKGIASLFISHKLNEVMQIAERVTVLRDGTLI
FT                   GTYDGKTIDDKKLEFLMTGETSVYEPYHVSPDRNGKPILRLENFSRNHSFCNVSLEVYS
FT                   GEIVGITGLLGSGRSELALSIFGFHPADSGRMEMNGEEVSIDSVETAKHHGIAYVPEDR
FT                   IHQGLVMDQSVSRNLVATVIDRLQGKTSLIDTKKLHETVAYWVETLKIKVPSLDAPVKT
FT                   LSGGNQQRIVLGKWIATEPRLFILDNPTVGIDVSAKSSIHKTIKKLAREGMGVIIISDE
FT                   ISEVLNNCSRILVMHKGRIIGSFDTTEASEEEIQAFIESQSI"
FT   gene            221290..222297
FT                   /locus_tag="Spirs_0217"
FT   CDS_pept        221290..222297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0217"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG1172 Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems permease components; InterPro
FT                   IPR001851; KEGG: cro:ROD_24831 putative ABC transporter
FT                   membrane protein; PFAM: inner-membrane translocator; SPTR:
FT                   Ribose/xylose/arabinose/galactoside ABC-type transport
FT                   systems permease component 2; PFAM: Branched-chain amino
FT                   acid transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79374"
FT                   /db_xref="GOA:E1RA83"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA83"
FT                   /protein_id="ADK79374.1"
FT                   /translation="MKRFMKTHEFHVLVVVLILSAAITAVNPNFLTLENGFDLLKSYSF
FT                   MGVLAIGILFVLISGGIDISFAATATVAEYVMAVVSIKLGGNMITSLLLATLVGLLLGA
FT                   FNGFLISKFKIAPIITTIATMNFYYGILTVITGGKWIYALPEWFRAFADIRVFTLVSRA
FT                   GTPYGLSVITLFWAVITVLAFFLLRYTMLGRGIYAIGGDIGSAERVGFPVRRLQIFVYS
FT                   FMGMMAGIAGVIQALLVQTVAPNSIVGKELDVIAAVVLGGASLSGGFGSVGGTLLGVFL
FT                   IAVVKNGMTLVKIPAVWYDVFIGAVILISVGFTSWQGKKGYHQAVIDIEKEEAA"
FT   sig_peptide     221290..221364
FT                   /locus_tag="Spirs_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            222297..223274
FT                   /locus_tag="Spirs_0218"
FT   CDS_pept        222297..223274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0218"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG1172 Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems permease components; InterPro
FT                   IPR001851; KEGG: spe:Spro_4696 monosaccharide-transporting
FT                   ATPase; PFAM: inner-membrane translocator; SPTR: Putative
FT                   uncharacterized protein; PFAM: Branched-chain amino acid
FT                   transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79375"
FT                   /db_xref="GOA:E1RA84"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA84"
FT                   /protein_id="ADK79375.1"
FT                   /translation="MKRKELRVLTIIMVLSFVFMTVLNPRDFLRAGNFQGMAFQLPELG
FT                   VLSLAMMIVMLTGGINLSIIATADLAGIVAAMILTIPKFGGVQAPGWLVMLALVGAIAA
FT                   ALLVGLLNGVLIAYIGVAPILTTLGTMTLINGITIVLTKGYVISGFPPAVRFIGNGMLL
FT                   GIPFPLLLFGLLAVVMAIFLNRTPTGFNIYMYGSNDVATHFYGGNNAGIILRTYLVSGL
FT                   LSGFAALIMISRFNSAKAGYGASYLLVTILAAVLGGVSSEGGFGRVSGLILSLVTLQII
FT                   SSGLNLLRVSSFMTIAIWGFVMILVMVVNYYSDKRRERLLRTQG"
FT   gene            223288..224763
FT                   /locus_tag="Spirs_0219"
FT   CDS_pept        223288..224763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0219"
FT                   /product="Carbohydrate kinase, FGGY"
FT                   /note="COGs: COG1070 Sugar (pentulose and hexulose) kinase;
FT                   InterPro IPR018484:IPR018485; KEGG: ttr:Tter_2252
FT                   carbohydrate kinase FGGY; PFAM: Carbohydrate kinase,
FT                   FGGY-like; SPTR: Putative uncharacterized protein; PFAM:
FT                   FGGY family of carbohydrate kinases, N-terminal domain;
FT                   FGGY family of carbohydrate kinases, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79376"
FT                   /db_xref="GOA:E1RA85"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA85"
FT                   /protein_id="ADK79376.1"
FT                   /translation="MSGKEIHCVGFDCGNSSIRTVLGHFDGTNIEVELIQQVPNGTVRV
FT                   EGYDYWDILHIFSQMQQGLKQAVAAAGGTVASAGISTWGIDFGLFGPSGQLLGNPLCYR
FT                   NELGGLGLGTLGEESRKKMFEQSGIQNHPMNSVYQFVGIRDHLPEYYRLAEKMMLTPDL
FT                   LNFLFTGSFNTETSIASTTQLMNMRSGRFDDSLFDIAGIKKGIMPPVVDHGTVRGMLRQ
FT                   DIADYLDIAPLPFVAVPSHDTAAAVVTVPSLEGPFAFISSGTWSLIGTELSAPLINDEV
FT                   YNCELANEGGACGTITLLKNSAGMHILQNVKNELEMRENRRFAWDEVVDLSLKAAAFLG
FT                   DEKIPLFDPNHPSLYNPDSMIQALQLLTGEKKLDNILAGIYASLACNYGAAICDIEKIT
FT                   GTEYPVIHIIGGGCRNDHLNQMTADISGKPVVAGPVEATSLGTIAVQLMHHVPGLGLTD
FT                   IRKIVSDSVQPLRFEPKVGRDRLYQRYEELLKP"
FT   gene            complement(224839..225072)
FT                   /locus_tag="Spirs_0220"
FT   CDS_pept        complement(224839..225072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ton:TON_0294 hypothetical protein Plut_1211;
FT                   SPTR: Putative Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79377"
FT                   /db_xref="GOA:E1RA86"
FT                   /db_xref="InterPro:IPR025517"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA86"
FT                   /protein_id="ADK79377.1"
FT                   /translation="MNKKALLIINPILFLSLLVQGISGIFMKFGLFYSLMYGIHSITGF
FT                   IFLGIVTLHIVFNWNWIKANLRKKSKRADQHA"
FT   sig_peptide     complement(225010..225072)
FT                   /locus_tag="Spirs_0220"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(225069..225572)
FT                   /locus_tag="Spirs_0221"
FT   CDS_pept        complement(225069..225572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0221"
FT                   /product="DOMON domain protein"
FT                   /note="InterPro IPR005018:IPR013050; KEGG: ton:TON_0876
FT                   DOMON; PFAM: DOMON domain protein; SMART: DOMON domain
FT                   protein; SPTR: DOMON; PFAM: DOMON domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79378"
FT                   /db_xref="InterPro:IPR005018"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA87"
FT                   /protein_id="ADK79378.1"
FT                   /translation="MKRVLFILFLAFLILTPLAAATESTREIAGVTVTWKAEGEYVLIT
FT                   MSAKTTGWIAVGIEPENKMKGADMYIGYVDDKGAVVLEDHYGHRTFSHKSDVALGGSSD
FT                   VEIIQGTESGGETSITFRIPKNSRDVYDKLLEEGKEYTVITAWGEKDNLTARHKGRGSG
FT                   SLPL"
FT   sig_peptide     complement(225510..225572)
FT                   /locus_tag="Spirs_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(225742..228162)
FT                   /locus_tag="Spirs_0222"
FT   CDS_pept        complement(225742..228162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0222"
FT                   /product="pyruvate formate-lyase"
FT                   /EC_number="2.3.1.54"
FT                   /note="COGs: COG1882 Pyruvate-formate lyase; InterPro
FT                   IPR010098:IPR004184:IPR001150; KEGG: str:Sterm_1074
FT                   pyruvate formate-lyase; PFAM: pyruvate formate-lyase PFL;
FT                   formate C-acetyltransferase glycine radical; PRIAM: Formate
FT                   C-acetyltransferase; SPTR: Putative uncharacterized
FT                   protein; TIGRFAM: pyruvate formate-lyase; PFAM: Glycine
FT                   radical; Pyruvate formate lyase; TIGRFAM: pyruvate
FT                   formate-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79379"
FT                   /db_xref="GOA:E1RA88"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA88"
FT                   /protein_id="ADK79379.1"
FT                   /translation="MNKRIAALRERLFEKIPEICPERAVLFTESMKQSEGQPIAKRRAQ
FT                   ALYEVLDKMTIFVRDGELIVGNQASTTRGAPAFPEYSVDWIIKEFNGDPYHFAERPCDR
FT                   FTYSERTKEQLLATIDYWKGKTLFENVWSQLPEEARVAWEINAIDDTWCAAAGLGNVLP
FT                   DHQMVLEQGLERIIERAEKRIADLDLTEPGTISQYWFLQAVVTANKAVINFAGRFADLL
FT                   LDLAEKERDQVRKKELLTMSENCRQVPAKPAQSFWQAIQAVWFIQLILQIETNGHAISL
FT                   GRFDQYLWPYFQRDIQRGVLTREKALELVESFFIKANEINKLRSWADSEYFPGYHLAEN
FT                   LAIGGQTADGRDAVNELTYTILDATADLKLTKPSVSLKWFEGTSDEFMDKALSVVEAHK
FT                   GGQPALYNDLAVMRILDNMGVKKEDQYGWAPVGCIEATVPGKWDFAAKGSWLNVGKIFE
FT                   MTLNNGKDPATGITLMKGEGDLTAFSDTHAIMEACKKQLFYYMRLQVIVEHISDEMHIL
FT                   HDQNAFRSSLVHDCIERGKSLIEGGAVYTADGGPAAGHISVGDSLAAIEYAVFEKGILS
FT                   LSQLQHALSTNFEDQTTSPSGEEIRQLMIHKAPKFGNDDDAADKWTVEINEFLGSTYQK
FT                   AFKSSRYGKGPIPATFALSQSSVTGNVAFGKSVGALPCGRKAGEPVNNGVSPANGSERN
FT                   GPTAVINSEAKLPSIWFQKGSIFNMRLTPQTLSTAEGRKRTLALVKTHFKNYQYHIQFN
FT                   VLDDATLEEAQKKPEEYRDLMVRISGYSAFFTPLNKELQNDVIARMKFNMADK"
FT   gene            complement(228238..229017)
FT                   /locus_tag="Spirs_0223"
FT   CDS_pept        complement(228238..229017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0223"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="COGs: COG1349 Transcriptional regulators of sugar
FT                   metabolism; InterPro IPR001034:IPR014036; KEGG:
FT                   cbt:CLH_0701 deoxyribose operon repressor; PFAM: regulatory
FT                   protein DeoR; SMART: regulatory protein DeoR; SPTR:
FT                   Transcriptional regulator, DeoR family; PFAM: Bacterial
FT                   regulatory proteins, deoR family; DeoR-like
FT                   helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79380"
FT                   /db_xref="GOA:E1RA89"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA89"
FT                   /protein_id="ADK79380.1"
FT                   /translation="MGNKEKRLDALKKMIQLERSMKISEISDRLHVSPMTTRRDIEILA
FT                   QDGTVKVLHGVVVSNSGGMAGGLSDYMLAVAETRNIDEKKAIARHALNFVEEDDIIFID
FT                   AGSTTETFASMLPPDIRLTVVCYSINIFLAVASHKNIEVLLTGGHYSRKTTILELSQTS
FT                   PVLQHNRTRKAFISASGYHQRLGVTCAHQSECITKKAAMNNTAEAFLLMDSSKFDVVHS
FT                   CHFADIEQFSRIFTNESIPTEYHRLLKEKGITVDYVR"
FT   gene            229146..229820
FT                   /locus_tag="Spirs_0224"
FT   CDS_pept        229146..229820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0224"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="COGs: COG0235 Ribulose-5-phosphate 4-epimerase and
FT                   related epimerase and aldolase; InterPro IPR001303; KEGG:
FT                   hor:Hore_18470 L-fuculose phosphate aldolase; PFAM: class
FT                   II aldolase/adducin family protein; SPTR: L-fuculose
FT                   phosphate aldolase; PFAM: Class II Aldolase and Adducin
FT                   N-terminal domain; TIGRFAM: L-ribulose-5-phosphate
FT                   4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79381"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA90"
FT                   /protein_id="ADK79381.1"
FT                   /translation="MGRVKQELKELIVSTGVEMIKTGITVGTWGNISYRDPETDYMYIS
FT                   PSGMDYMKVKTDHVVVMDLDLNIIEGEAEPSIEKHMHVAVYKARPDAHAVIHTHPTFST
FT                   VFGVAGLPLPAVSEDFVQIVGEEIAIASPYALPGTPELGEVAVKGLGKNGAVLLPGHGA
FT                   LIAAANMPMALKISTVLEKNAQIYLYAKLLGNGIRLFSREEIDAMQNFAKNHYGKKNQE
FT                   LV"
FT   gene            229964..230998
FT                   /locus_tag="Spirs_0225"
FT   CDS_pept        229964..230998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0225"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843:IPR001761; KEGG: gka:GK2115 transcriptional
FT                   regulator; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; SPTR: Putative uncharacterized
FT                   protein; PFAM: Bacterial regulatory proteins, lacI family;
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79382"
FT                   /db_xref="GOA:E1RA91"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA91"
FT                   /protein_id="ADK79382.1"
FT                   /translation="MSRYTITEFAKICGTSPATVSRVLNNPELVAAPLRKHVEEKMKEL
FT                   GYKPNPFASKLSSKSSWGLALFVFDILNPFFALIVRRISHLAMEQGIPLTICDTENNAD
FT                   KERIYLDYLLDNKIAGVIFAEGISLPTIERAQHYTETVLIDRHSQEGFVSEVSSDNYTG
FT                   GRQATEYLLQLNHQRIAFISGPENWPSVEDRFHGYRDALDAYGVPFHPELVYQGDLRYE
FT                   SGISAIEYFLTLPEWPTAIFSANDQMAYGAMSKARHLNIAIPEDISLVGFDDIPFHNFF
FT                   QANLTTVKQDIPALCENAFSILIGKVNNGSQGGIEKRVVVPTTLKIGDTCRKLVGSVKR
FT                   PAIR"
FT   gene            231015..231932
FT                   /locus_tag="Spirs_0226"
FT   CDS_pept        231015..231932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0226"
FT                   /product="glycyl-radical enzyme activating protein family"
FT                   /EC_number="1.97.1.4"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterProIPR012839:IPR007197:IPR001450:IPR017896:IPR
FT                   011352:IPR017900:IPR005829:IPR001989; KEGG: rpc:RPC_1176
FT                   glycyl-radical activating protein; PFAM: Radical SAM domain
FT                   protein; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; PRIAM: [Formate-C-acetyltransferase]-activating
FT                   enzyme; SPTR: Glycyl-radical enzyme activating; TIGRFAM:
FT                   glycyl-radical enzyme activating protein family; PFAM:
FT                   Radical SAM superfamily; TIGRFAM: glycyl-radical enzyme
FT                   activating protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79383"
FT                   /db_xref="GOA:E1RA92"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA92"
FT                   /protein_id="ADK79383.1"
FT                   /translation="MAENLTIFELERYALEDGPGIRTVVFFKGCNLHCLWCQNPESQQR
FT                   RPQVLYYRKQCVGCGKCIETCPAGAIDTASDLGFVTIHDRCTLCASCVDACFYNARRIA
FT                   GEVRSSEDIMREIMKDQSFYENSGGGVTFSGGEPLLQIEGLVDLASRCRSEGIHTALET
FT                   AGSVPWDRFERIFPYMNLIYFDVKHIDPLVHERVVGAPNGVILNNLIRLSREFEPVIVR
FT                   IPVIPGVNDSPEVIGDICSFLSTRTRVRKVELLPFHRLGSGKYAALGREDSMEGVPSLD
FT                   KAACLPLAGLGKRFGLDITVGAGH"
FT   gene            231932..232858
FT                   /locus_tag="Spirs_0227"
FT   CDS_pept        231932..232858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0227"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0934 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79384"
FT                   /db_xref="InterPro:IPR025117"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA93"
FT                   /protein_id="ADK79384.1"
FT                   /translation="MKGLALSKLFYHDRVLPSFREHFPDDISSMAFGLVGHGSECYGFD
FT                   DEFSRDHDWGARLCLWLPAGTPEEKIHAMEKLYRSLEGPFGGFGAVRRLDPAVGRDGVM
FT                   TVPFFFEHLIGSPSPPETIKEWMAMREEGLSLATNGDIFFDGSGEIGAFRESLNHYFPR
FT                   DLWLKKIASRCFAFSQYGQYNLSRALLRSDIPLLQYTRASALKEAAALFFLLRRRYRPY
FT                   YKWLFHALSLEGPEGELLARYINMAASLSDPGTLKESIEAIARFMVTQLEERGLSFACG
FT                   AFLQEYGFHITEMIETPWLRSGSQIIE"
FT   gene            232869..233420
FT                   /locus_tag="Spirs_0228"
FT   CDS_pept        232869..233420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP0584 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79385"
FT                   /db_xref="InterPro:IPR025191"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA94"
FT                   /protein_id="ADK79385.1"
FT                   /translation="MDQAQKRIIAEILDREVAMFLRVPARQEPSCRAHLDDMQLHRRGQ
FT                   FSVWSLSCCESYLRDLRRAEEEGRNLMTIKYARMEDLIPPVSQSKRIPEIVSRFVGWQR
FT                   EMLSHYPNIMRGGRDIDDFANYLRCELETYSDATLELLWKDVDAFSRKKQNMSKAIYEF
FT                   LARQSGYTNIDEMEKRLKKS"
FT   gene            233632..234588
FT                   /locus_tag="Spirs_0229"
FT   CDS_pept        233632..234588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0229"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="COGs: COG1879 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR001761; KEGG:
FT                   monosacharide ABC transporter periplasmic
FT                   monosacharide-binding protein; PFAM: periplasmic binding
FT                   protein/LacI transcriptional regulator; SPTR: ABC
FT                   transporter, periplasmic sugar binding protein; PFAM:
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79386"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA95"
FT                   /protein_id="ADK79386.1"
FT                   /translation="MSKKLLVLVLTAMLIPAGFLFSAGQQDGGEASNLMVIITPDKDNT
FT                   FFTAEADAAKAKAESLGYTTLLAVHGDDPKKEGDIIDTAIARKAVAIIIDVANADASPN
FT                   NLKRATDAGIPVFCMDREINATGIAKAQLISNNFQGAKLGGEYFVQVMGEKGNYVELVG
FT                   KESDTNAGVRSKGFHNIIDQYPDMKMVARQTANWSQTEGYSVIESVLQANPEVNGIICG
FT                   NDTMALGAQAAIDAAGRSDIIVIGFDGNDNVLDSIMEGKIEGTVMQPNAKNAEMAVELA
FT                   DTYIKTGSTGLDEEKILNDCFLITKENASQWRGFRKK"
FT   sig_peptide     233632..233697
FT                   /locus_tag="Spirs_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            234682..235380
FT                   /locus_tag="Spirs_0230"
FT   CDS_pept        234682..235380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0230"
FT                   /product="periplasmic lipoprotein"
FT                   /note="COGs: COG5618 periplasmic lipoprotein; InterPro
FT                   IPR014582; KEGG: acr:Acry_1065 periplasmic lipoprotein-like
FT                   protein; PFAM: periplasmic lipoprotein; SPTR: Periplasmic
FT                   lipoprotein-like protein; PFAM: Predicted periplasmic
FT                   lipoprotein (DUF2291)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79387"
FT                   /db_xref="InterPro:IPR014582"
FT                   /db_xref="InterPro:IPR036215"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA96"
FT                   /protein_id="ADK79387.1"
FT                   /translation="MMMRERTLCSFVMLLIGIAVLLSGCTIKKISELDEQQGDEYSTWT
FT                   KSGKAFDPVAYVDSIWDTKLIPAFKEESCDFETLLAALKKDPETATQEYGLMSKAGGMG
FT                   VTFKITGSARVVSYDDSSRNGLLLLDTPPYEGTVDAKMQVGPVIRNTAIRDSVSFIRFT
FT                   EVGNQLQFASLADELNARMKKEAVEPLDLSSIAGKEINYYGAFKLEDDDSLDDVVITPV
FT                   IIEPTIAGGA"
FT   sig_peptide     234682..234753
FT                   /locus_tag="Spirs_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            235382..236935
FT                   /locus_tag="Spirs_0231"
FT   CDS_pept        235382..236935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0231"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1129 ABC-type sugar transport system ATPase
FT                   component; InterPro IPR003593:IPR003439:IPR017871; KEGG:
FT                   mlo:mll7012 ribose ABC transporter, ATP-binding protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79388"
FT                   /db_xref="GOA:E1RA97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA97"
FT                   /protein_id="ADK79388.1"
FT                   /translation="MAEEQSEVVLEARNITKVFPGTRALQGVDFKVYKGKINVLVGENG
FT                   AGKSTLMKILAGIEEATSGTICLFDNEGTPHEVTLSSARDAAGKGIGIVHQELNLFTNL
FT                   NVAENIFMNKELSRHHSLYIDHQEQVERSRTILKRLGQDIDPETLVRDLRLGQQQIVEI
FT                   AKTMIDEPKILIMDEPTSSLSIQEVRVLFNVIADLKAQGVGIIYISHRLEEIREIGDYI
FT                   TILRDSKLVDCGLVAEMEMADIIRKMVGRDPKKFFSGQAHEAGKELLSVKHMTLPRFGG
FT                   GYTFQDVSLSVCEGEILGIYGLMGAGRTELLETMMGLYDKASGEITLEGQRLDTMDTKE
FT                   RIEHGLVLIPEERQREGLFLNLSVEKNLTMASIARYLKLWQINVKVEMKRVAEMIKEMV
FT                   IKVSSPSISINALSGGNQQKVVIGKALLTKPKVLLMDEPTRGIDVGAKSDVFEIMNKMA
FT                   KGKFGIVFVSSELEEIFSMSDRIIVLSKGKITGEFDRSEATEEKIRKASEIGHGITASA
FT                   "
FT   gene            236913..238043
FT                   /locus_tag="Spirs_0232"
FT   CDS_pept        236913..238043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0232"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG1172 Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems permease components; InterPro
FT                   IPR001851; KEGG: sme:SM_b20352 sugar ABC transporter
FT                   permease protein; PFAM: inner-membrane translocator; SPTR:
FT                   ABC transporter, permease; PFAM: Branched-chain amino acid
FT                   transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79389"
FT                   /db_xref="GOA:E1RA98"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA98"
FT                   /protein_id="ADK79389.1"
FT                   /translation="MESPRQRSTGRLKKRFMTALANKKPGTGFSIGMLVLKLRTLIAFL
FT                   AVLIVFSFIAPNFLSITNLIAMAKHSAIWAILAVGMTYVIIGGGIDLSIGSIVGLCGMI
FT                   AGGLIAEGLRLPIFGIVIYFNVPMIILIVLLIGVLLGAVNGLIITKLGVAPFIATLGML
FT                   YMGRGFAMLRSGGKTFPNLIGNPALGNTGFPILGAGTMLGIPLVVWIAAVIAIIAAYVS
FT                   QKTPFGRHIYAVGGNEDAAVLSGIRVNRLKMAIFMFSGFTAALTGLVLASQLVASHPAT
FT                   GEAYEMTAIAAVVLGGASLNGGRGSIGGTIIGALILGVLNDGLVMIGVSSFWQTAIKGM
FT                   VLVLAVVIDQYQLRKQNEAALHQQQADEKGPEKVSA"
FT   gene            complement(238088..239269)
FT                   /locus_tag="Spirs_0233"
FT   CDS_pept        complement(238088..239269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0233"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; InterPro IPR001176:IPR004839:IPR004838;
FT                   KEGG: cce:Ccel_1965 aminotransferase class I and II; PFAM:
FT                   aminotransferase class I and II; SPTR: Aminotransferase
FT                   class I and II; PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79390"
FT                   /db_xref="GOA:E1RA99"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA99"
FT                   /protein_id="ADK79390.1"
FT                   /translation="MIAEKIHRNLQQASLIRAMFEEGEKLRAIYGADKVFDFSLGNPDP
FT                   EPPKEVKDSLRKLVMEDRPGLHGYMNNAGYPETREKIAEAINKETGKKLSAQHIVMTCG
FT                   AGGALNITLKTILNPGEEVIVFTPYFGEYTFYIDNYSGTMVELPSNPDTFEPDLAQLEK
FT                   SITPLTKAIIINSPNNPTGVVYSEQLLKEMARIVDCKEEKFHTTIYVISDEPYSKLVYD
FT                   GIKLPYILNIFRHSVLVNSFSKSHSLPGERIGFVAVNDAIENPKEFVDGLSFSNRILGY
FT                   VNAPALFQRVITDSMEKVVDKAIYEERRDILYNHLISLGFSCVKPQGAFYLFPKTLIPD
FT                   DIEFKNRALKHNLVVVPGRSFGCPGYFRISYCVGRDTITNSLPAFSALAEEFK"
FT   gene            239390..240028
FT                   /locus_tag="Spirs_0234"
FT   CDS_pept        239390..240028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0234"
FT                   /product="YheO domain protein"
FT                   /note="COGs: COG2964 conserved hypothetical protein;
FT                   InterPro IPR013559; KEGG: aoe:Clos_1744 YheO
FT                   domain-containing protein; PFAM: YheO domain protein; SPTR:
FT                   Putative uncharacterized protein; manually curated; PFAM:
FT                   YheO-like PAS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79391"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA0"
FT                   /protein_id="ADK79391.1"
FT                   /translation="MNKNEAFEFLNRLAAGIAKTFGNSCETVVHDMNNKKHSILVIYNG
FT                   HVTKRKIGGGLDLLGTNKQINDFLSNGSDLINCDGRSANGKQIKSTTLHLQGDNYHYAL
FT                   GINFDYTLLSVAENAIKELTRVGENLEAAVKESGENRLKDIFKECVTILGKPVAIMNKD
FT                   DRMRIVALLQERNAFSFQKSIPCISAWLHISRYTIYNYLKEINEKQRTG"
FT   gene            complement(240080..240751)
FT                   /locus_tag="Spirs_0235"
FT   CDS_pept        complement(240080..240751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0235"
FT                   /product="YheO domain protein"
FT                   /note="COGs: COG2964 conserved hypothetical protein;
FT                   InterPro IPR013559; KEGG: dvl:Dvul_1030 YheO
FT                   domain-containing protein; PFAM: YheO domain protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: YheO-like PAS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79392"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA1"
FT                   /protein_id="ADK79392.1"
FT                   /translation="MRDTIRNYLPIVQFLGSVLGSYYEIILIELKDEGSGIVAIENSHI
FT                   SGRKIGDGLTDLCLRFIKEETYKDTSFKSNYTCISNGRKLRGSTYFIKEGDMLVGMLCI
FT                   NFDTETFIELDTRLLQFANIQAQGIIDTLFPPQGVPDNNTETVLSSVTELCEQEVRKYA
FT                   EKNKLDAKKFTQENRIEIIEHLNNLGIFLIKGIVPDVANLIGTSEASVYRYLSIVNRKK
FT                   K"
FT   gene            241034..242455
FT                   /locus_tag="Spirs_0236"
FT   CDS_pept        241034..242455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0236"
FT                   /product="Na+/solute symporter"
FT                   /note="COGs: COG0591 Na+/proline symporter; InterPro
FT                   IPR001734; KEGG: cdl:CDR20291_2109 putative sodium/solute
FT                   symporter; PFAM: Na+/solute symporter; SPTR: Na+/solute
FT                   symporter; PFAM: Sodium:solute symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79393"
FT                   /db_xref="GOA:E1RAA2"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA2"
FT                   /protein_id="ADK79393.1"
FT                   /translation="MQKDGIVLLVCCLYFISLIIAGIVAAKRNKNVTDFLVAGRNLGLF
FT                   LTTATLVAVQVGAGVVLGGAGNGASMGVWPGMYYALGCGGGLILAGIFMAPKLKTADGY
FT                   VPMDFFEKRYGANKAVRLWAWMSNIPSMLGIFVAQMLACGSILAGFGLPFGWGVVICAA
FT                   VILVYCYIGGMWGVVLTDLIQTIVILIGIPILAVASLLAVKHAGFAPSSILATPFIPKG
FT                   LFSKFIYLVLPFLLSISVSYDAYMRYQSAKDVKTARWGCIISGIIVIIIGIFASIVGAV
FT                   SGKLYPDIQDGVFASMAIHTLHPVMAGIVIAAILAAAMSSANCLLIALGATFSRDFYNK
FT                   FLHPEKSLEELPYSKRISKITVFVSCLVGVLIAFKLTNILDAIIIFNYPYMGSLLVPLL
FT                   LGVLWKGATKKGAFAAIFVGGVIGVFCFVLGLTGPISPLLDADWGLLYSYVVSAIVLVG
FT                   VSLTDKSRASLPSAQ"
FT   sig_peptide     241034..241111
FT                   /locus_tag="Spirs_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            242546..244480
FT                   /locus_tag="Spirs_0237"
FT   CDS_pept        242546..244480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0237"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit; InterPro IPR006076; KEGG:
FT                   str:Sterm_3522 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; PFAM: FAD dependent oxidoreductase; SPTR:
FT                   Predicted protein; PFAM: domain; FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79394"
FT                   /db_xref="GOA:E1RAA3"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA3"
FT                   /protein_id="ADK79394.1"
FT                   /translation="MFSMKWPYPIECNQEERVKTDVLVIGGGISGCMAAISAAKQGAKV
FT                   ALLEKGATIRSGAGGSGCDHWESATTNPCSTVSPEEITQAMIDDNDGYNNGISHYIECR
FT                   EGWDCLREIEKMGGKIRDTEDEFLGADFRDPETKLMFAYDLKNKFTIRIWGSTFKPVLY
FT                   KELKRLGVKIYDRIMVTSLLTEGGEIGKRVIGCTGFHVRTGKHLVVSSKATVLATSRPA
FT                   RIWLFSPAYPGLCEFRPTQCVGDGHAMGWRAGAAFSMMEKSVTAEFSAAGRSFPPYGTG
FT                   NNHNTWYPASMCDARGKPIPYLDRDGKELKEFSDRYRPAAGQQYFLKGGSIDYPKYEYD
FT                   GPETIDQKKLLSMGYKLPFYADLTTMPELERKAIWGMMVGEEGKTKIPIYQNYTERGFD
FT                   PTRHVLQAYGGGWKSASFLPQERQLFGLPGGFLNDWNLATNLEGLFVAGDALFASNCFG
FT                   HAAATGSYAGRHASAYAKNVQHLVPCEKQIAKERSRTYASLGAEGQERYSWKELNMAIA
FT                   KTMQNYCGDPKCDDLLETGLDVFRHYETNILPHLYSRNPHELMRTLEVENILTNAQIIL
FT                   RSCLQRKSSSRALCFNRADYPEMDPERDRRFFTIRLTKSGVDMGSVPLRYYGDLSRNYE
FT                   KYNGNYIAE"
FT   gene            244485..244781
FT                   /locus_tag="Spirs_0238"
FT   CDS_pept        244485..244781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0238"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="InterPro IPR001450:IPR017896:IPR017900; KEGG:
FT                   ckr:CKR_2705 hypothetical protein; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: Predicted
FT                   protein; PFAM: 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79395"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA4"
FT                   /protein_id="ADK79395.1"
FT                   /translation="MNIENICAGPDIASIEPISFNTERCIACNRCADVCQVDVLVPSLE
FT                   KGKPPLVLFPGECWYCGCCVMECPTHAIQLRHPLMNQAHFRLKKELEDTLESE"
FT   gene            244878..245948
FT                   /locus_tag="Spirs_0239"
FT   CDS_pept        244878..245948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0239"
FT                   /product="Polyprenyl synthetase"
FT                   /note="COGs: COG0142 Geranylgeranyl pyrophosphate synthase;
FT                   InterPro IPR000092; KEGG: geranylgeranyl pyrophosphate
FT                   synthase; PFAM: Polyprenyl synthetase; SPTR: Geranylgeranyl
FT                   pyrophosphate synthase; PFAM: Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79396"
FT                   /db_xref="GOA:E1RAA5"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA5"
FT                   /protein_id="ADK79396.1"
FT                   /translation="MQQYLSQQKQNLTEEIRRACRREAAAMEQKNPRASDLFTLLADFS
FT                   TRGKMIRGSLVSLGAGLVAGEAPPAALPLGAAMELFQSALLIHDDIMDRDTMRRGQSTV
FT                   HHYYALEAAKYGTDDAAHLGESLGICAGDVAIFLAFSLVNEAGLIAGNHHELVGLFSRE
FT                   MSIVGTAQMSDVAWSDGWGDPNLAEVISLYRYKTGRYTFSLPLSAGALIAGADRRFRDL
FT                   LEEYGELLGILFQIRDDELGLFGESEEVGKPIGSDIAEGKKTLFYLMLKKAAEGEALSV
FT                   LERIYGKGKAGIDEVRQIRKIAVSTGVLSSVETMMDDYKRKAEAVLDQILSFGIGREPW
FT                   SGYLRQLLDYVCRRNS"
FT   gene            complement(245963..247480)
FT                   /locus_tag="Spirs_0240"
FT   CDS_pept        complement(245963..247480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0240"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR016047; KEGG:
FT                   eat:EAT1b_0890 peptidase M23; PFAM: Peptidase M23; SPTR:
FT                   Peptidase M23; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79397"
FT                   /db_xref="GOA:E1RAA6"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA6"
FT                   /protein_id="ADK79397.1"
FT                   /translation="MKGRYSKRQMEERLELLTEQIIHTLLARLGTGRASSSKPVKCQVN
FT                   GLIPGTYTLSMVRINPKELLLQELVSTKTRGNVIFRSWTFRKEEKWYVAGMEKLGKPVF
FT                   YRSIGQDLADLVRRNDTVSAVEASEGMYLVETAERAARNLGVELPSDYELKRNGLYPKS
FT                   IRFLTKHSALVAVLLIAVGIGTILGLYALKIGSIESEMNKSVKAYTANIDDQVKSFLDD
FT                   TEDEILGLINDVEKNRKNFEFDKRNAYLNVQRLAEELTRYTPARKRAYRLIADNILQST
FT                   TYSEIMYEMSRLPTEEYQARIFLATNRQSVIPLASFTPAIPGMLYPVRVDGENNDGRGF
FT                   RITDGYMDRRENPLGTGGSSPHFAVDIINVSNIAYVSHAGEIIREGNPPGDVVAVAPGA
FT                   ICDTGWDDGYGWYIEINHGISDEVKALYPDAERWCSYYAHLDEKPTQAIGTKVEADALI
FT                   GHIGNTGRSTGPHLHFEVRIYHKNGSYRSGDARYDKINPYPAERQEE"
FT   gene            247587..248948
FT                   /locus_tag="Spirs_0241"
FT   CDS_pept        247587..248948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0241"
FT                   /product="DNA photolyase FAD-binding protein"
FT                   /note="COGs: COG0415 Deoxyribodipyrimidine photolyase;
FT                   InterPro IPR006050:IPR005101:IPR008148; KEGG: hmo:HM1_1861
FT                   deoxyribodipyrimidine photolyase; PFAM: DNA photolyase
FT                   FAD-binding; DNA photolyase domain protein; SPTR:
FT                   Deoxyribodipyrimidine photolyase; manually curated; PFAM:
FT                   FAD binding domain of DNA photolyase; DNA photolyase;
FT                   TIGRFAM: photolyase PhrII"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79398"
FT                   /db_xref="GOA:E1RAA7"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR032673"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA7"
FT                   /protein_id="ADK79398.1"
FT                   /translation="MIQNERLFLLKKGECNEKGAYVLYWMQQSQRSRYNHALEYALGEA
FT                   NRRSLPLLVLFVVSRDYLGAGRRHYRFLLEGIEQLEVDLADRGIGFLLKIGDPPGIVAE
FT                   FAADAALVVFDTGYTRLQRSWRKAAAAGSFCAPVMEVESDLVVPVRTASGKEEYSAATI
FT                   RRKITPLLFRFMQPLKRQSAKIDSTALAGRADGLDSKAAEELLRFSQPEVEPVSWIHGG
FT                   SVEAHRRLDAFITSGTLERFHEERNDPSKEGLSCMSPYLHYGQISALEIALRASEHPGP
FT                   GCEAFLEELIIRRELAFNFVFYNRFYDSFEALPRWAREDLEAHEGDKREVLYDDAQLEE
FT                   AKTHDPYWNAAQRELTHKGKMHGYMRMYWGKKILEWSASPREAFERALRLNDRYSLDGR
FT                   DPNGYTGVAWCFGKHDRPWASRPVFGKIRYMNDRGLERKFDIASYVKQVQKSCE"
FT   gene            249013..249726
FT                   /locus_tag="Spirs_0242"
FT   CDS_pept        249013..249726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0242"
FT                   /product="Ureidoglycolate lyase"
FT                   /EC_number="4.3.2.3"
FT                   /note="COGs: COG0179 2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1 7-dioic acid hydratase
FT                   (catechol pathway); InterPro IPR002529; KEGG: sfu:Sfum_0938
FT                   5-carboxymethyl-2-hydroxymuconate delta-isomerase; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase; PRIAM: Ureidoglycolate
FT                   lyase; SPTR: 5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase; PFAM: Fumarylacetoacetate (FAA) hydrolase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79399"
FT                   /db_xref="GOA:E1RAA8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA8"
FT                   /protein_id="ADK79399.1"
FT                   /translation="MVVLPVKGRDESYQVRPSKIVALGLNYHEHVKESVFLTTRKIPLD
FT                   IPSEPVLFPKTPNVLIGDGEAIVIPAYLQGYDFEEVRVDYEAELGFFVGKRCKDVPEEK
FT                   AMDYILGYTCFNDVSQRNFQTEDKSGWFRGKSLDTFGPVGPVVVPASDIPDPQNLHIEC
FT                   RLNGKVVQSGNTSQMIFPIPTIVAFISRHFTLEEGDLIITGTPKGVGRIHHGDVVEVEI
FT                   EGIGTLRNPVREEGR"
FT   gene            249848..250885
FT                   /locus_tag="Spirs_0243"
FT   CDS_pept        249848..250885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0243"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="COGs: COG0618 Exopolyphosphatase-related protein;
FT                   InterPro IPR001667; KEGG: gem:GM21_1931 phosphoesterase
FT                   RecJ domain protein; PFAM: phosphoesterase RecJ domain
FT                   protein; SPTR: Phosphoesterase RecJ domain protein; PFAM:
FT                   DHH family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79400"
FT                   /db_xref="GOA:E1RAA9"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA9"
FT                   /protein_id="ADK79400.1"
FT                   /translation="MENSKDALEKLGSVVSGKKELLILTHTHPDPDAIAAAVALRLLLK
FT                   ELFHVGASIAYSGIIARAENRAMVKKLNLPLKQYSRIKLSRYDGIALVDSQPGAGNNVL
FT                   DASSPCDIVIDHHPRRDDTKGAFVVIEPELGASATMLIEWLDAAGVDLSADIATALAYA
FT                   ISSETQNMYREAARRDIRAYLSVYVRASIRKLAGIINANLPHYYFLQLGDAINNALMFG
FT                   TMITTHLDEIRHPEIVAEMADFLLKHERIGTVLVSGRFRNHLIISIRTRSEGINAGRLI
FT                   KQLPLDPDNVGGHDRTAGGFFDLHGKDRKEVEEINITIRNAFAALLGYENPSWRKLLDQ
FT                   VPRKS"
FT   gene            complement(250896..251363)
FT                   /locus_tag="Spirs_0244"
FT   CDS_pept        complement(250896..251363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0244"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR008254; KEGG: mac:MA2078 flavodoxin;
FT                   SPTR: Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79401"
FT                   /db_xref="GOA:E1RAB0"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB0"
FT                   /protein_id="ADK79401.1"
FT                   /translation="MVKKILIAYSSYFGNCKKAASTLAASCDEEGMETSLYPILESETL
FT                   PEKPDILVLVTPVRVRKIVGPSKKFLRKIGEKDLRYALVVSHGAALDHFFSPVPATKKL
FT                   ERHLERKEMVRITEPLFLQVERQQGPLSKGYEKRLADLAKQLSQAVSEEDR"
FT   gene            251432..251896
FT                   /pseudo
FT                   /locus_tag="Spirs_0245"
FT   gene            complement(251906..252343)
FT                   /locus_tag="Spirs_0246"
FT   CDS_pept        complement(251906..252343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fnu:FN1201 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79402"
FT                   /db_xref="GOA:E1RAB1"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB1"
FT                   /protein_id="ADK79402.1"
FT                   /translation="MKKVDDSNIMEGLEEKREEIIREINEYNRERDQIRAMLGKIGGKS
FT                   YSKTDMIINIVFLTIILLLFILELTTHFLPAFISLEVSVLLVSIKIVWMIHSQHRFNHF
FT                   QFWVLNSIEFRINNMHKMVRGMEKELKQLREDKHNTNAVGP"
FT   gene            complement(252373..253653)
FT                   /locus_tag="Spirs_0247"
FT   CDS_pept        complement(252373..253653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0247"
FT                   /product="protein of unknown function DUF401"
FT                   /note="COGs: COG1906 conserved hypothetical protein;
FT                   InterPro IPR007294; KEGG: dol:Dole_1082 hypothetical
FT                   protein; PFAM: protein of unknown function DUF401; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF401); TIGRFAM: converved hypothetical integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79403"
FT                   /db_xref="GOA:E1RAB2"
FT                   /db_xref="InterPro:IPR007294"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB2"
FT                   /protein_id="ADK79403.1"
FT                   /translation="MTIPLMLKIILSLALILVLNKIVRNLAISVAAGALLIAFWSGQTI
FT                   VTAGVIASKRMLSFDNFALLLLIALVITLSNQMNQTGMMKQLVGGLKARVSQKEALAAL
FT                   PAVIGLLPMPGGALFSAPLLDDCDDRGELSPMQKTKINYWFRHVWEFTWPLYPGVILAS
FT                   DIAHVEVWQIFFLGLPLSLVSITVGYLFYLRPLKLTAERRESNSKSNGPSLVSLLAPIM
FT                   IVVVIYFLIMVFLPAVGTLSKYLPMIIGLLSSILYLQIISPLTRKEWKKIALSHRTLQM
FT                   VLIVLVVRVYGAFIEAPLPNGILLMEQLRLELTAAGVPLRLLVLLIPFISGMTTGVSVG
FT                   FVGACFPIVFSLLGPSPTLASTLSTLALAYPFGFMGTMMSPVHVCLIVTNEHYGTNLGP
FT                   SIGAVIPPAIFVMAGSLLISYIVPFIV"
FT   sig_peptide     complement(253510..253653)
FT                   /locus_tag="Spirs_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            253778..254299
FT                   /locus_tag="Spirs_0248"
FT   CDS_pept        253778..254299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0248"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="COGs: COG0735 Fe2+/Zn2+ uptake regulation protein;
FT                   InterPro IPR002481; KEGG: tye:THEYE_A1865 ferric uptake
FT                   regulation protein; PFAM: ferric-uptake regulator; SPTR:
FT                   Ferric uptake regulation protein; PFAM: Ferric uptake
FT                   regulator family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79404"
FT                   /db_xref="GOA:E1RAB3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB3"
FT                   /protein_id="ADK79404.1"
FT                   /translation="MDYSSRGYGRGFGRGCSRAEGPFQRKGVRMTLTRRVIIEALDRAD
FT                   GYLSAEELFLIVREEYPGIGVATIYRTLQLLEELALVQRVETGEGRARYAMSRDKDAGE
FT                   AGVGNEVVLICDRCGKVIRQPKAAARCSELFDSLSRKAEENYRFHTERQVLQIHGLCAG
FT                   CTGAPSEKSR"
FT   gene            254379..254678
FT                   /locus_tag="Spirs_0249"
FT   CDS_pept        254379..254678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tit:Thit_1682 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79405"
FT                   /db_xref="InterPro:IPR035205"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB4"
FT                   /protein_id="ADK79405.1"
FT                   /translation="MPGRDGRGPIGYGPQTGRGLGMCGGGYGLGSGFGRGGYGRGGCGY
FT                   GAYGRGGYAYPHPVSKEEREAGLAARELALEEELKWIRSMRTEEGEGANKGAEA"
FT   gene            254675..255043
FT                   /locus_tag="Spirs_0250"
FT   CDS_pept        254675..255043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0250"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="COGs: COG1433 conserved hypothetical protein;
FT                   InterPro IPR003731; KEGG: mla:Mlab_1056 hypothetical
FT                   protein; PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; SPTR: Dinitrogenase iron-molybdenum
FT                   cofactor biosynthesis protein; PFAM: Dinitrogenase
FT                   iron-molybdenum cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79406"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB5"
FT                   /protein_id="ADK79406.1"
FT                   /translation="MKVAVAADGTMVSGHFGHCEQFVVADIANGRVESTTPVANPGHTP
FT                   GALPPFVASLGASKIVAGGMGPRAIELFEANGVGCILGISGPISDALEKLAKGELEGGE
FT                   SSCTGSHDHDCDHEEGRI"
FT   gene            255047..255403
FT                   /locus_tag="Spirs_0251"
FT   CDS_pept        255047..255403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0251"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="COGs: COG1433 conserved hypothetical protein;
FT                   InterPro IPR003731; KEGG: mma:MM_0988 hypothetical protein;
FT                   PFAM: Dinitrogenase iron-molybdenum cofactor biosynthesis
FT                   protein; SPTR: Conserved protein; PFAM: Dinitrogenase
FT                   iron-molybdenum cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79407"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB6"
FT                   /protein_id="ADK79407.1"
FT                   /translation="MIICITASGREESSQQDPRFGRCEAFYLFDDTKKEGRFIDNPFKN
FT                   AVGGAGVRAAELIVKEGASRLVSGQIGPNAWDVLKEAGIRVFSSKEANIRAALEAFLAG
FT                   NLSEVEAPGPAGHK"
FT   gene            255400..256272
FT                   /locus_tag="Spirs_0252"
FT   CDS_pept        255400..256272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0252"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="COGs: COG1149 MinD superfamily P-loop ATPase
FT                   containing an inserted ferredoxin domain; InterPro
FT                   IPR002586:IPR001450:IPR017896:IPR017900; KEGG: pth:PTH_0584
FT                   MinD family ATPase; PFAM: Cobyrinic acid ac-diamide
FT                   synthase; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; SPTR: Cobyrinic acid a,c-diamide synthase; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain; 4Fe-4S
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79408"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB7"
FT                   /protein_id="ADK79408.1"
FT                   /translation="MTITVASGKGGTGKTTIATALAMLWPEPVALLDADVEEPNCRFFL
FT                   DTTEGKQREVFLPVPQIDEAICTGCGACSSFCRYGALVRIGKKVMTFPNLCHSCGACMM
FT                   VCPEGAISEKPSFIGTIDSAQFRALDGSLRTHRWGTLKLGAAMAPPLIRELRREKDKEP
FT                   LQLIDSPPGASCPMANAVKNADLVLMVAENTPFGAHDLEKAISTLEEMDLPVLALINRA
FT                   DLGGGEAEAVCRRKGIDIIGRVPFDRKVAESYARGVHPILEVPAFRQAVEQVVGHLIAF
FT                   LQTSIEQKT"
FT   gene            256269..257195
FT                   /locus_tag="Spirs_0253"
FT   CDS_pept        256269..257195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0253"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="COGs: COG1149 MinD superfamily P-loop ATPase
FT                   containing an inserted ferredoxin domain; InterPro
FT                   IPR002586:IPR001450:IPR017896:IPR017900; KEGG:
FT                   mta:Moth_1408 cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: Cobyrinic acid
FT                   a,c-diamide synthase; PFAM: CobQ/CobB/MinD/ParA nucleotide
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79409"
FT                   /db_xref="GOA:E1RAB8"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB8"
FT                   /protein_id="ADK79409.1"
FT                   /translation="MKHEKAKRIVVISGKGGTGKTFFTSAIASLVSGRSVFADCDVDAA
FT                   NLALALGGAAPAASRRQERFFGGERAVVDAGLCTGCGKCISFCRFDAIHMENSVAQVDP
FT                   VGCEGCGVCTLVCPSSAFTLEEEMAGQWFVTDTQDGPLIHAELQAGGENSGKLVHKVRS
FT                   VAEQEAERVGASLILIDGPPGTGCPVLAAASDTDAILLVTEATTTALHDLERAAEVAST
FT                   FGTPIGVLVNKSDLNPEVVKKARILCDEKGYRWIGDFPYDRMAAEASARLLDPFSLLED
FT                   TTADKLRALVANALNMVGLDVVSSAVG"
FT   gene            257236..258060
FT                   /locus_tag="Spirs_0254"
FT   CDS_pept        257236..258060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0254"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="COGs: COG0489 ATPase involved in chromosome
FT                   partitioning; InterPro IPR019591; KEGG: ddf:DEFDS_1268
FT                   ATP-binding protein, CobQ/CobB/MinD/ParA family; PFAM:
FT                   ATPase-like, ParA/MinD; SPTR: Nucleotide-binding protein;
FT                   PFAM: ParA/MinD ATPase like; Anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79410"
FT                   /db_xref="GOA:E1RAB9"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB9"
FT                   /protein_id="ADK79410.1"
FT                   /translation="MAFPPSEEQKAQNERLKKRMSGIKHKVLVMSGKGGVGKSSVSANL
FT                   ALEMASRGVKVGILDTDLHGPNIPKMLGVDDAKLIAYDEGIEPFAVTKNLVAVSLAMAG
FT                   HDVDAPIIWRGPVKIGVIRQFLADVEWGDLDLLVIDTPPGTGDEPLTVAQMIPELDGAI
FT                   VVTTPQEVAILDSRKSVNFAKQLNLPLIGIVENMSGFICPNCGTEHQLFGSGGGERAAK
FT                   EMGVPFLGKIPIDPLLMNAEDSGRSYLSLPDTGPAAAALRSLVDKTAAFIGL"
FT   gene            258190..260424
FT                   /locus_tag="Spirs_0255"
FT   CDS_pept        258190..260424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0255"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR003660:IPR004089; KEGG: dba:Dbac_1917
FT                   methyl-accepting chemotaxis sensory transducer; PFAM:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein; SMART: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SPTR:
FT                   Methyl-accepting chemotaxis sensory transducer; PFAM: HAMP
FT                   domain; Methyl-accepting chemotaxis protein (MCP) signaling
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79411"
FT                   /db_xref="GOA:E1RAC0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC0"
FT                   /protein_id="ADK79411.1"
FT                   /translation="MLKNIRMGVKLVGAFFIVALLVLVVGFVGMIGLRRLNVFISDIGQ
FT                   GRLPAVESLLRMENEVQNIRGSVRTLLSSRLTLDDRQRQYDNIDSARADYGEYRTVYEK
FT                   FPKASEESRKWTEATRLLGELTDLNNSIVDLSKKVEESGIIHPDSFKSTIIELVNDHHV
FT                   LMEQAIAAIGSGTVFTGGDDAESCDLGQFLLTFKTDNPVLLRVLKEVPKYHDAFHEGIS
FT                   EVQDALSRGDRDTAFALYQDKVVRNATRVFELLNQMLGEADRVVQLYDEMNLIAMGDAA
FT                   TVQRSFVDALGWVVSYNSDLAANTVDQAIVNSGQAIRFTIVGMVVASLLALILGLGLTQ
FT                   AITAPMRLGVNFAKAISLGDLGIELSIRQKDEVGQLAEAMREMQIALQDKARVLERIAD
FT                   GDLSVDAKKASEKDGLGESMLRMKKNLNDLLGQVHMAVEQVTAGADQVSQASQSLSQGA
FT                   TEQASSLEEVSSSATEINSQARQNAENATEANALAKKAAADAKNGNSQMMDLKEAMAKI
FT                   NVSSDQIKKVVKVIDDIAFQINLLALNANVEAARAGKYGKGFAVVAEEVRNLAVRSASA
FT                   VQETTSMVEESIRNIELGNAAVGTTAGQLESIVDGAGKVADFLEEIATASREQAQAIDQ
FT                   ISEGLDQIDQVTQSNTASAEESASASEELAGQAQQLQGLIRQFILDERYVSGLRSSGSR
FT                   SLPAPGGRRVPRPSKERTVKEHPREEFETGIAPVSPEDVIKLDDDDFDRF"
FT   gene            260436..260930
FT                   /locus_tag="Spirs_0256"
FT   CDS_pept        260436..260930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0256"
FT                   /product="CheW protein"
FT                   /note="COGs: COG0835 Chemotaxis signal transduction
FT                   protein; InterPro IPR002545; KEGG: cce:Ccel_2314 CheW
FT                   protein; PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; SPTR: CheW protein; PFAM: CheW-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79412"
FT                   /db_xref="GOA:E1RAC1"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC1"
FT                   /protein_id="ADK79412.1"
FT                   /translation="MSDQVSGSGDVMIDEEDDIVANKYLLSKIGNELYGIDIRFVTDII
FT                   EMQKITEVPDMEEYVRGVINLRGQVIPVIDLRLRFGMAFREYDDRTCIIIVNVGESSIG
FT                   FIVDTVSEVIDIPDGSIDPPPEYKSEGGSSRRFVSGLGKVGDSVKLLLDVEAIVSHTTS
FT                   T"
FT   gene            261105..261710
FT                   /locus_tag="Spirs_0257"
FT   CDS_pept        261105..261710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0257"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="COGs: COG0170 Dolichol kinase; InterPro IPR000374;
FT                   KEGG: tde:TDE2717 phosphatidate cytidylyltransferase,
FT                   putative; PFAM: phosphatidate cytidylyltransferase; SPTR:
FT                   Phosphatidate cytidylyltransferase; PFAM:
FT                   Cytidylyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79413"
FT                   /db_xref="GOA:E1RAC2"
FT                   /db_xref="InterPro:IPR032974"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC2"
FT                   /protein_id="ADK79413.1"
FT                   /translation="MRTTFQGDTEKIRTEIIRKSIHMMVAFVPAFARINIGLTMALLAA
FT                   SVVAYSVAELLRVNGKKIFLISTITEAANRNRNNSAFVFGPVTLALGAMMTLLLYPSQV
FT                   AAIAVYALAFGDGFSSLFGRLYGRVRVPFTEGKTFAGSFACLLAVFFSSLSVSGNIEQS
FT                   VLIAIAATLLEISISGDLDNLVLPIGTGFVAWLVGVGI"
FT   sig_peptide     261105..261200
FT                   /locus_tag="Spirs_0257"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(261720..262487)
FT                   /locus_tag="Spirs_0258"
FT   CDS_pept        complement(261720..262487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tde:TDE1445 hypothetical protein; SPTR:
FT                   Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79414"
FT                   /db_xref="GOA:E1RAC3"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC3"
FT                   /protein_id="ADK79414.1"
FT                   /translation="MISRRNSLQIFGLLISILLTGVGVYGILLQFRTGTTVGDELIRQI
FT                   LLLGEGAFAIIGSLFLMLFFRNTPSPGVLFFILAVQATAFGALRPLSAALFSLNYSYQI
FT                   PAAITRAYYFGRFLSILALFISGLFAAGLALQRRTIMFGSAFFMALTLAAVLPVDISEY
FT                   TPQLLFSIGARSSMFLGYGVIAVLSTANYLIAALHQGNRNYYLVACGVFFMIIGKEFVY
FT                   RSIAPEAAAIGLLCMIVGAYLFGSRTHTIYLWL"
FT   sig_peptide     complement(262410..262487)
FT                   /locus_tag="Spirs_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(262520..264109)
FT                   /locus_tag="Spirs_0259"
FT   CDS_pept        complement(262520..264109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0259"
FT                   /product="Glycoside hydrolase family 79"
FT                   /note="InterPro IPR005199; KEGG: mmw:Mmwyl1_1639
FT                   hypothetical protein; PFAM: Glycoside hydrolase family 79;
FT                   SPTR: Putative uncharacterized protein; PFAM: Glycosyl
FT                   hydrolase family 79, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79415"
FT                   /db_xref="GOA:E1RAC4"
FT                   /db_xref="InterPro:IPR005199"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC4"
FT                   /protein_id="ADK79415.1"
FT                   /translation="MNGNYYPVSMSSPRHYTICIGSRKPIRSLPADFLSLTIDSSLLLG
FT                   GHWWGKSRSFAKGVSGEQVAPLDLEHSQLVAYAAQLAPAMLRIGGTEADWVRYKMGKKA
FT                   LRKLRGAKPASHRIGNSNDRPAYELVLKKGVWKRLNRFIKESGFDLLFTLSAGPADRDS
FT                   NGAWRSDNAMRLVAYSVQKGFRVAAWEFGNEVNGFPFLYGPKKRVSASQYSRDFEYFSE
FT                   SVKHIDPQAKIIGPASAIWPIIGEPNPIIKKLCVSPAARHLDAVSWHYYPQQSHHGPIA
FT                   VRRAGTYRMLSPGNLNDIVRWNRNIQRYLKKSREHPTSTENWLTETAHALYGGEPGLSD
FT                   SFVSTLWWLDELGVLARNGVDKVFRQSLIGARYGLLDQESMKPKPDYYASFLWKKLMGN
FT                   LVLETGTTIGTNKKLRYYRHTTGAYFAGSAAEALLLINLNRKTSAHVEITTPDAPFSIG
FT                   HTILLQADGGFTSKSMLVNGVPAEDDLVFSWGTKKVMKKYKISGKKNERITKELSLPPL
FT                   SALFYLFARPEN"
FT   gene            264202..264897
FT                   /locus_tag="Spirs_0260"
FT   CDS_pept        264202..264897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0260"
FT                   /product="Protein of unknown function DUF2259, secreted"
FT                   /note="COGs: COG5497 secreted protein; InterPro IPR018725;
FT                   KEGG: tde:TDE1519 hypothetical protein; PFAM: Protein of
FT                   unknown function DUF2259, secreted; SPTR: Putative
FT                   uncharacterized protein; PFAM: Predicted secreted protein
FT                   (DUF2259)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79416"
FT                   /db_xref="InterPro:IPR018725"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC5"
FT                   /protein_id="ADK79416.1"
FT                   /translation="MHKRALLAAFLLTLACSGAFAGDVAVFENLGFSDDSRYLLFGQYG
FT                   ILSDETRAYAELYAVDVAKNSYLSGGVLKKVYSDEIFPGQDGSGALYMALREFSPIVSK
FT                   YKFNHLATGRMVYLLLNGAEPQDRLEFRDFQRGDSFSVDLIQHRYGEGEGTNLSSSFHI
FT                   SVMITDAAGKSRTYQVGHPDFKRKGVLEYRIKEVFFSPDEKGLVFVVERDEVDGNGNNI
FT                   RYMVETLRW"
FT   sig_peptide     264202..264264
FT                   /locus_tag="Spirs_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            265017..266447
FT                   /locus_tag="Spirs_0261"
FT   CDS_pept        265017..266447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0261"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="COGs: COG0442 Prolyl-tRNA synthetase;
FT                   InterProIPR002316:IPR004499:IPR002314:IPR004154:IPR
FT                   016061:IPR006195; KEGG: paa:Paes_1587 prolyl-tRNA
FT                   synthetase; PFAM: Anticodon-binding domain protein; tRNA
FT                   synthetase class II (G H P and S); Prolyl-tRNA synthetase,
FT                   class II-like; PRIAM: Proline--tRNA ligase; SPTR:
FT                   Prolyl-tRNA synthetase; TIGRFAM: prolyl-tRNA synthetase;
FT                   PFAM: Anticodon binding domain; Prolyl-tRNA synthetase,
FT                   C-terminal; tRNA synthetase class II core domain (G, H, P,
FT                   S and T); TIGRFAM: prolyl-tRNA synthetase, family I"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79417"
FT                   /db_xref="GOA:E1RAC6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC6"
FT                   /protein_id="ADK79417.1"
FT                   /translation="MAEKITPRSENYSQWYVDIILNAKLADYSPVKGSMVIRPHGYALW
FT                   EAIQRNLDDMFKATGHTNAYFPLLIPESFIKKEAEHVEGFSPELAVVTHAGGEELEEPL
FT                   VIRPTSETIIWSMYKKWIQSYRDLPLLINQWANVLRWEKRTRLFLRTSEFLWQEGHTAH
FT                   ATEKEAREETLRMLNVYKEFAEKWMAIPVLTGVKSPSEKFAGAIDTYAIEAMMQDHKAL
FT                   QAGTSHFLGQNFAKAFDVTFQNDTGSLEYVWATSWGVSTRLVGALIMTHSDDKGLVVPP
FT                   KLSPVEAVIIPIFRNKNKEEVVGYARKLYDRMKDEFRVKLDADDSNSPGWKFAEWEMLG
FT                   CPVRIELGPRDMENGKAVLVRRDNGEKEIVDIEAVPARVGELLESIQTTLFQRALENRE
FT                   THTYDVDSYDRFKAIFDGEGGFIRMPWCGDAECEAAIKEETKATIRLIPFEQPELKGAV
FT                   CPRCGKPADKIAVYARSY"
FT   gene            266484..267131
FT                   /locus_tag="Spirs_0262"
FT   CDS_pept        266484..267131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saz:Sama_1067 putative sulfate transporter
FT                   YchM; SPTR: Sulfate permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79418"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC7"
FT                   /protein_id="ADK79418.1"
FT                   /translation="MRSTFHFLALFSILCTVAVSSISASPHMEGVELFGGGIWTGNSRS
FT                   DAGAPSPIYPSLTIGLPLRLGNGPFSFVPALTLYKAWYLYDESEEAAIPAELEQRDITA
FT                   VEIIIDSSFRFDMIKRKSFVTGPELSLSFDLPVPIVVWENEDESSSLVSDLYDSGKFFL
FT                   PGVGWHWTVILHDTHPLLFNLKSYLPLHRFWDGEDLPFYDRLKIALRVGYRF"
FT   sig_peptide     266484..266552
FT                   /locus_tag="Spirs_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(267156..268391)
FT                   /locus_tag="Spirs_0263"
FT   CDS_pept        complement(267156..268391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0263"
FT                   /product="transporter, putative"
FT                   /note="COGs: COG1301 Na+/H+-dicarboxylate symporter;
FT                   InterPro IPR001991; KEGG: tde:TDE1111 transporter,
FT                   putative; SPTR: Putative transporter; PFAM:
FT                   Sodium:dicarboxylate symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79419"
FT                   /db_xref="GOA:E1RAC8"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC8"
FT                   /protein_id="ADK79419.1"
FT                   /translation="MKIWLKYLFAIILGTAAALFLPEPFLAVLSSFLPKAIAIITRIGT
FT                   YLSLPLLFFGMAYAVYKLQYERRFFPVLLKTLLVIVASGLLLTLVGVATVLLFSPDRIP
FT                   VIIESEKAFSLPGAMELLEAAFPPNLFSIFGGESPYLLSFIVLGLLLGFGFTFDRVLTR
FT                   PAVQLFDSLSRIFFHLARLFVELLSIGMLFFAAGYTITIVSTPELALFSQLFLLLTVDT
FT                   IIVLLGIYPLLLFLLTRERNPYRLLYGLTAPMLAAFLSGSDRFSYINLANHVKANLGIP
FT                   RPVGAVTLPLFTLLGKAGTAMVSSVSFIVLLSSYSSLGIEFSEVVWIIFFSFGASFLAA
FT                   SAPQAGVLTVIAMMCTHYGKGIEEAYLILLPALPILMSFSALIDTVTAGLGTVVVAKGE
FT                   SGTKEVPLKDFI"
FT   sig_peptide     complement(268305..268391)
FT                   /locus_tag="Spirs_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(268436..269101)
FT                   /locus_tag="Spirs_0264"
FT   CDS_pept        complement(268436..269101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpi:Cpin_6701 short-chain
FT                   dehydrogenase/reductase SDR; SPTR: Short-chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79420"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC9"
FT                   /protein_id="ADK79420.1"
FT                   /translation="MGKRVLITGKTTKLGNLLVEHYLSQGWQVVATVKQDEEKRNDTEI
FT                   DSNLLIRTWNRRSPLAAKNVLLGGINHFGGIDEAIIIFPVDGENRPLHELPSAAIEAAI
FT                   DGQIKSQLFMVKEVLAYFQKEKRGQLSLIRNNEGADVLPPLEAICSGSFQALSRSLFTF
FT                   YQNEKVYINSFESSTGDAKGFVDFIMKTLDEKARDQHGKMYRFHDKGVLGALGRNLRK"
FT   gene            269233..270891
FT                   /locus_tag="Spirs_0265"
FT   CDS_pept        269233..270891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0265"
FT                   /product="NAD+ synthetase"
FT                   /note="COGs: COG0171 NAD synthase; InterPro
FT                   IPR003694:IPR003010:IPR014445; KEGG: aca:ACP_0671 NAD+
FT                   synthetase; PFAM: NAD synthase; Nitrilase/cyanide hydratase
FT                   and apolipoprotein N-acyltransferase; SPTR: NAD+
FT                   synthetase; TIGRFAM: NAD+ synthetase; PFAM: NAD synthase;
FT                   Carbon-nitrogen hydrolase; TIGRFAM: NAD+ synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79421"
FT                   /db_xref="GOA:E1RAD0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAD0"
FT                   /protein_id="ADK79421.1"
FT                   /translation="MKIALGQMNAVIGDFSGNRKKILDYAEKAAGQGSDLLITPELSLC
FT                   GYPPMDLLDYASFSRENIHSLRILQRDLPKGIAVAVGYVSVNNEAGKGLRNCVSVIRDG
FT                   EVLFSQAKSLLPTYDVFDEARYFEPASTRKVFPFMGRKIGFAICEDIWWETEEAAGTRY
FT                   PVDPVAELLDAGADMIISPSASPYYNGKLGVRYRLLSRIGSMGDVPVVYVNMVGGNDNL
FT                   IFDGASMLVSPDGRLCHISPSWEEDLSFIDPDSSISSSLALPEEGMEAVRRALVLGIRD
FT                   YVEKCGFSRVHLGLSGGIDSALVATLAVEALGREQVRVFAMPSRYSSEGSLSDARKLAD
FT                   NLGISLETIPIEPMFVSSLDSLTPHFAGRQPDVAEENVQARIRGLLMMAYSNKWGSLLL
FT                   TTGNKSELATGYCTLYGDMCGGLSVIGDLFKVEVFALCKHINERSIERGGNEIIPQAII
FT                   SKPPSAELREDQKDEDSLPPYEVLDGILFHYLLKNESADEIARAGFDREQVGQILSLVG
FT                   KNEYKRRQAPPVLKISPRAFGTGRRMPIARKIYEA"
FT   gene            complement(270879..274286)
FT                   /locus_tag="Spirs_0266"
FT   CDS_pept        complement(270879..274286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0266"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase; InterPro
FT                   IPR006589:IPR006047; KEGG: aba:Acid345_1492 alpha amylase;
FT                   PFAM: alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain; SPTR: Alpha amylase; PFAM: Alpha
FT                   amylase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79422"
FT                   /db_xref="GOA:E1RAD1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAD1"
FT                   /protein_id="ADK79422.1"
FT                   /translation="MSVEKYRKGMPISVKAREQFRIADLFPEQKEGRREKEPGTTYAEA
FT                   QEIAQLLNRKNKADRYPEHRVSTASVFALGLIRTFQYIIIKLYSEKNGGEVSLQLLKHL
FT                   AQSPGRKETESTLSSFETEFFKPSHSARTEEEQIEELLLLWLTNQNRAARFMRGLFSDR
FT                   DLERHTSYQEVIASCYLFFSKLQGFGPGNLHLMDMLRSPAINYPDNLLAQLEYIRDHWG
FT                   PLLGSFLELLLRGIDYLKEEQRPFFPPGPGPSRIPIFRKGSEEYERFSSDSHWMPEVVL
FT                   IAKSTLVWLNQLSRFYHREIHRLDQIPDQELDVLAERGFTALWLIGLWERSDASRKIKQ
FT                   WSGNQEAAASAYSLKRYEIAEELGGWEALDNLRERCRQRGIRLASDMVPNHTGLDSDWL
FT                   FEHPEWFIQCSAPPFPGYTYSGESVVDHPDIEVHLEDHYWDRSDAAVTFQYVDRRSGSC
FT                   RYIYHGNDGTSMPWNDTAQLDYLNPHVREVVIQTILHVARNFPIIRFDAAMTLAKKHIQ
FT                   RLWYPQPGHGGDIPSRSRFGIDETEFHERIPEEFWREVVDRVAAEVPDTLLLAEAFWMM
FT                   EGYFVRTLGMHRVYNSAFMNMLKNEENAKYRQTIKNTLEYDPEILKRFVNFMNNPDEDT
FT                   AYAQFGDGDKYFGVCTMMTAMPGLPMFGHGQIEGFREKYGMEFRKAYLSEEPDRMLIER
FT                   HEREIFPLTRIRSLFAEVEHFNFYDFHETEGRVNENVFVWSNKKGEERAIVAYNNCYQS
FT                   STGSFSESVPVNRRRENGRRELVTGFLAANLDFTSDDNWFLIFQEQRSGLWFIRENKNL
FT                   FGEGFGLILAGYQSQLFLNFREVYDSLGIYRYLCEKLGGSGTKDIERMEKELRAAPVRE
FT                   PFRRLLSKERIAQVEDSFRSGDSSLLTLLDDTIEDYRAFLAGCRQVGYGDAITAAEEEY
FT                   RDQMIRLDLLLACKTEEEPSLPSGAEGYLLRGLSIAPEAAVVLYAKALLTPLWRLLDSK
FT                   AEKAGTFALCDAAEAIEELLLPELFDEALLAVGVAEPFLPELRLLISLLPRLENWTRLT
FT                   LQGSPAERLKQILSIPEVARYCGINEYEGIRWYGGESLQQLFWYLAVLAMPDDRALGYE
FT                   IVRRWHVAEEEADYRLDQLFELLENQAS"
FT   gene            complement(274312..274893)
FT                   /locus_tag="Spirs_0267"
FT   CDS_pept        complement(274312..274893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0267"
FT                   /product="protein of unknown function DUF151"
FT                   /note="COGs: COG1259 conserved hypothetical protein;
FT                   InterPro IPR003729:IPR001943; KEGG: srm:SRM_02353
FT                   uncharacterized ACR; PFAM: protein of unknown function
FT                   DUF151; UvrB/UvrC protein; SPTR: Uncharacterized ACR,
FT                   COG1259 family; PFAM: Uncharacterised ACR, COG1259;
FT                   UvrB/uvrC motif"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79423"
FT                   /db_xref="GOA:E1RAD2"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAD2"
FT                   /protein_id="ADK79423.1"
FT                   /translation="MMASMLVEAEIWTVARTDQGNAVLVRPLGSEVAVPIFIGQLETQS
FT                   ILIGLGNVPMPRPLTHDLFITLLKSLSVEIDRVEITNLNEGTFFAQLLLKKEEEEEITL
FT                   DVRPSDALGIAVRTKCPIFISEAVVDEAGIPITSITEQATEGGETAGTENERESLENEL
FT                   KLAVESENYEEAARLRDLLKELDNEQNRNS"
FT   gene            complement(274964..275503)
FT                   /locus_tag="Spirs_0268"
FT   CDS_pept        complement(274964..275503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0268"
FT                   /product="Asparaginase/glutaminase"
FT                   /note="COGs: COG0252 L-asparaginase/ Glu-tRNAGln
FT                   amidotransferase subunit D; InterPro IPR006034:IPR020827;
FT                   KEGG: bba:Bd3633 asparaginase; PFAM:
FT                   Asparaginase/glutaminase; SPTR: Putative uncharacterized
FT                   protein; PFAM: Asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79424"
FT                   /db_xref="GOA:E1RAD3"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAD3"
FT                   /protein_id="ADK79424.1"
FT                   /translation="MKITILTTGGTIDKTYDEHAGSLRNERTVLDTILKSLRLPDLFIR
FT                   HVAVMSKDSLEMVDADRELILREVRAALPVSDAIIIVHGTDTLSKTGECIYQNIQDSTI
FT                   PIILTGAMRPYEFRDSDALQNITEALFAAKVASPGIYAVMHNRLLPFPGVVKDRTSLTF
FT                   RTQEEIEKISTNETKA"
FT   gene            complement(275505..276575)
FT                   /locus_tag="Spirs_0269"
FT   CDS_pept        complement(275505..276575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0269"
FT                   /product="butyrate kinase"
FT                   /EC_number="2.7.2.7"
FT                   /note="COGs: COG3426 Butyrate kinase; InterPro
FT                   IPR000890:IPR011245; KEGG: amt:Amet_4308 butyrate kinase;
FT                   PFAM: acetate and butyrate kinase; SPTR: Butyrate kinase;
FT                   TIGRFAM: butyrate kinase; PFAM: Acetokinase family;
FT                   TIGRFAM: butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79425"
FT                   /db_xref="GOA:E1RAD4"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAD4"
FT                   /protein_id="ADK79425.1"
FT                   /translation="MNKRTLVINPGSSTTKFAVYEGTKTLFSRSMEHTAEELAPFEAIT
FT                   DQFEFRTNLILSVLREEGIDPAGFDAVIGRGGLLKPIRGGVWAVNELMLRDLQIGVSGQ
FT                   HACNLGGIMAFEMAKKSKAPAFIADPVVVDEMCDEARISGHPEFPRRSIFHALNQKATA
FT                   RRAAGEMGKKYEECRLIVAHIGGGISVGSHVEGRVIDVNNALNGEGPFSTERSGGLPVG
FT                   QLVDLCFSGTKTKQEIQKMIKGGGGFQAYLGTSNGKEVANRAAAGDAKANLLFRTLAYQ
FT                   VAKEIGAHATVLEGRIDGIVLTGGLANDKWLMEILHKRISFLGRIFIYPGEDELEALRD
FT                   AGLRALTGESEVQQYQ"
FT   gene            complement(276644..277225)
FT                   /locus_tag="Spirs_0270"
FT   CDS_pept        complement(276644..277225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0270"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="COGs: COG0193 Peptidyl-tRNA hydrolase; InterPro
FT                   IPR001328:IPR018171; KEGG: scl:sce6936 hypothetical
FT                   protein; PFAM: peptidyl-tRNA hydrolase; PRIAM:
FT                   Aminoacyl-tRNA hydrolase; SPTR: Peptidyl-tRNA hydrolase;
FT                   TIGRFAM: peptidyl-tRNA hydrolase; PFAM: Peptidyl-tRNA
FT                   hydrolase; TIGRFAM: peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79426"
FT                   /db_xref="GOA:E1RAD5"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAD5"
FT                   /protein_id="ADK79426.1"
FT                   /translation="MSTINLTVFLGNPGKMYAKTRHNLAWMAAEAIPSIVDLRFQKKFH
FT                   GRWADIKTGTYREVLLFPETYMNKSGDSVSSACSFFKIDPKKEGSNLLVVHDEIELPFG
FT                   TIELKRGGGTAGHNGLRSINQQTGSSDFLRLRLGVGRPPRGTVSSWVLSRFSEDEELLL
FT                   PKYLKRTAPFLEKLFTEGHASISAFKEQLL"
FT   gene            277266..278453
FT                   /locus_tag="Spirs_0271"
FT   CDS_pept        277266..278453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0271"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="COGs: COG1075 acetyltransferase and hydrolase with
FT                   the alpha/beta hydrolase fold; InterPro IPR012908; KEGG:
FT                   cno:NT01CX_0630 lipase; PFAM: PGAP1 family protein; PRIAM:
FT                   Triacylglycerol lipase; SPTR: Lipase; PFAM: PGAP1-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79427"
FT                   /db_xref="GOA:E1RAD6"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAD6"
FT                   /protein_id="ADK79427.1"
FT                   /translation="MEMRASGRPIRNNFPIVLVYGFMGYVELPFSGFHHWGGTIDLAEE
FT                   LRKAGYTVYVAPIGPVSSLHDRACELYSFIKGGRVDYGAAHSAAAGHNRWGRNYPGVFP
FT                   QWGEFDPNSGSPRKVHLICHSMGGQTARVLAHLLGDREWIASVFTISTPHDGTTLTYRY
FT                   HDPGRMIKLFASLLVLQSDKQDDPVFDMQLEHWKGATEPGETLSAFLERVIKDDAWLGT
FT                   KDFGFYDLTPKGAAEINRETPALPGIYYFSLATSRTQYDEKRDRWIPAPGMLLPLRSTA
FT                   RSIGSCIPESGKDSLWEGTDASWRENDGLVNTISMDGPSLSSCDPIRRWSLDRMEVPDV
FT                   GVWNFLGTLGLDHWQVHLQLPVGSTCPEGYDSLLDYYIDICSFLRALPPVPIIGG"
FT   gene            complement(278450..279064)
FT                   /locus_tag="Spirs_0272"
FT   CDS_pept        complement(278450..279064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0272"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="COGs: COG1739 conserved hypothetical protein;
FT                   InterPro IPR015796:IPR001498:IPR020569; KEGG: tde:TDE1321
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   UPF0029; SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterized protein family UPF0029; TIGRFAM: conserved
FT                   hypothetical protein TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79428"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAD7"
FT                   /protein_id="ADK79428.1"
FT                   /translation="MLEPKEAAEAEIEIKKSRFIALAQRVSGAEEVRRRIKETRELHPG
FT                   ANHVVHAFVTSGGDIFGMSDDREPKGTAGRPVLEVVRGSGIDNLLVMVVRYFGGTKLGT
FT                   GGLVKAYTEAAQAVLKVLPTRPLIESISFRVVLSYDQYEPIKKELGPLLLEPPKETFME
FT                   QVIITGKIASKDADWAAGVVSEISAGRSTLEILDKDSSGSA"
FT   gene            complement(279057..280016)
FT                   /locus_tag="Spirs_0273"
FT   CDS_pept        complement(279057..280016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0273"
FT                   /product="aldo/keto reductase"
FT                   /note="COGs: COG0667 oxidoreductase (related to
FT                   aryl-alcohol dehydrogenase); InterPro IPR020471:IPR001395;
FT                   KEGG: kcr:Kcr_0281 aldo/keto reductase; PFAM: aldo/keto
FT                   reductase; SPTR: Aldo/keto reductase; PFAM: Aldo/keto
FT                   reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79429"
FT                   /db_xref="GOA:E1RAD8"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAD8"
FT                   /protein_id="ADK79429.1"
FT                   /translation="MGEKCKIPGGLGIGTWQFGDDPYWPGQQRKESLKAIDAALRAGII
FT                   HFDTAQVYGNGRAEQLIGQRLRKRNDELFLATKLFPCPPSSVEKRIALSRRRLFRESID
FT                   LLYIHWPKEGEDPRPMMEALESERRKGSIAGIGLSNFTVEQADKVLTVGKIDACQIGHS
FT                   LLWRHAEGGIIPWCREHNIPVIAYAPLAQGLLAGSFEKIHSNKDDRRNKLLPMDPILSG
FT                   ALSRFLESFEHEADNIGVPPAGLALAWSLSRPFLQAVVVGARNRKQVEEAAAARSFMLP
FT                   PQTEANLETISLRFRKACEELADFSAQDNIFGHGRKHA"
FT   gene            280222..280914
FT                   /locus_tag="Spirs_0274"
FT   CDS_pept        280222..280914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0274"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="InterPro IPR008258; KEGG: lhk:LHK_00755 Slt; PFAM:
FT                   Lytic transglycosylase catalytic; SPTR: Slt; PFAM:
FT                   Transglycosylase SLT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79430"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAD9"
FT                   /protein_id="ADK79430.1"
FT                   /translation="MVPITLTCAHIVSRNEMPPEPVADLVDVEAVSGAADEMSYSIDVA
FT                   ADDDIVLALYGNPMFHQQVKDFFTAETGSQRIADIVLQEAEENDIPPTLAFALAWVESR
FT                   YRTDAVNRNSGSVDRGLFQLNSRSFPNLSEEQFFDPVTNAKEGLHYLRYCLDVGENRVV
FT                   ALAMYNAGRSRVTGKGTPKMTLDYISRILDYQEELNERFAHLHLREKSAVKEAGKVRYV
FT                   LDRGKGSK"
FT   gene            280924..282813
FT                   /locus_tag="Spirs_0275"
FT   CDS_pept        280924..282813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0275"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /EC_number="4.2.1.51"
FT                   /note="COGs: COG2876 3-deoxy-D-arabino-heptulosonate
FT                   7-phosphate (DAHP) synthase; InterPro
FT                   IPR006268:IPR006218:IPR001086:IPR002912; KEGG:
FT                   sfu:Sfum_3724 phospho-2-dehydro-3-deoxyheptonate aldolase;
FT                   PFAM: DAHP synthetase I/KDSA; prephenate dehydratase; amino
FT                   acid-binding ACT domain protein; PRIAM:
FT                   3-deoxy-7-phosphoheptulonate synthase., Prephenate
FT                   dehydratase; SPTR: Prephenate dehydratase; TIGRFAM:
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM:
FT                   Prephenate dehydratase; ACT domain; DAHP synthetase I
FT                   family; TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79431"
FT                   /db_xref="GOA:E1RAE0"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAE0"
FT                   /protein_id="ADK79431.1"
FT                   /translation="MIVVLKQNISPENKEHARQFLSRKGFSVREIVGEEETILGAVGKA
FT                   RIDQREVELLPGVDRVIPISKPYKLASRELKKQDTIVPVGRVRIGGNRVVVIAGPCAVE
FT                   SREQIMEAAQAVREGGAVLLRGGAFKPRTSPYSFQGLGEEGLKLLKEAGEKYDLPIVTE
FT                   IVGTDYADLMNDYVDVFQIGARNMQNFELLKRVGSLGKPVILKRGLSATIEEWLMAAEY
FT                   LMAHGSDNVILCERGIRTFETYTRNTLDLSAIPVVKKLSHLPVLVDPSHGTGLREKVHP
FT                   MALAAVAAGADGLMVEVHPHPEQALSDGPQSLLPDQFEKLMRDLQALSPVIEREIERVP
FT                   VSIASPTVSVNGKSSGKIAFQGMHGAYSERAIVRYFGEEASTLPCPSFRSVFETVLSGQ
FT                   VRFGVVPIENSLAGTIYENIDLLQQYPDITIVGEQKVRIIHNLIGQKGADIAEVRKVFS
FT                   HPQGLAQCSAFFDRHPEMERVPFYDTAGAVATVSQMNDPQCAAIAGEEAAKTYNMEILQ
FT                   KGIETNPRNYTRFFVVTRSDDPITALRERVNMAAVSFATPDQPGALFACLKVFADNGLN
FT                   MKKLESRPIEGKPWQYRFFVALEVTDEEVLKKSLTALEPVSDDLRFLGVYESR"
FT   gene            complement(282818..284236)
FT                   /locus_tag="Spirs_0276"
FT   CDS_pept        complement(282818..284236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tde:TDE2048 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79432"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAE1"
FT                   /protein_id="ADK79432.1"
FT                   /translation="MEGTDGFLEQLEEAILSYRNHLEGNELPKLKDASRSYYASFQAFY
FT                   NVMLRKSLVHEDPYKHDMKISEVEAPESGPIIESEKADRMSQRLSMFDSQLDFLNHYYQ
FT                   FSADFLTMPRIKRIKELITYIHWESLAESSSNMTTRIIAELLGRMRQGSDPISSGVIND
FT                   SVLQMAKATKQILTVLKKTTIYQRERYKLELRRNLLATMELKTEAIRERREEVIKAIKR
FT                   KFPQVLGDTPYFPELVEEILDEDAAYDFEKRRKELIDKLQIRREKQHNKAQQSFKPHLL
FT                   DGCRILSTASTPVEQAVRKLNHNAMILAEQPVTMGERFKRWVRSLVMKEDEKRIYEIEL
FT                   FDQNTGTSRTVKLDFDLFVEETQKLARMLAVMGNKMGPTYKRLEGFSEEKLFEFLSSKI
FT                   DEIIKLNNKLPALDTYFKSEVPRLQRQMIRGIKLEITAIKNSVVKANQKRHEYVSQKEE
FT                   IEQLKKLGVQPDLE"
FT   gene            284295..284837
FT                   /locus_tag="Spirs_0277"
FT   CDS_pept        284295..284837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0277"
FT                   /product="GTP-binding protein"
FT                   /note="KEGG: dba:Dbac_2899 GTP-binding protein; SPTR:
FT                   GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79433"
FT                   /db_xref="InterPro:IPR025529"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAE2"
FT                   /protein_id="ADK79433.1"
FT                   /translation="MGTITDFMPEKLIIGVLSSLPDRFVRVEPQLREEFGAIDYSSEEL
FT                   PFTYTTYYDNEMGTPIFRRFYAFREPIDPQRLASVKRRSNKLEGVWGEAGHRRINLDPG
FT                   LLGLGRLILASTKGPGHRIPLSEGIYAEVTLFFRAGSYQALPWTYPDFRSEAYQKILKD
FT                   IRDIYHRQLKELGFSVS"
FT   gene            284883..285662
FT                   /locus_tag="Spirs_0278"
FT   CDS_pept        284883..285662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0278"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ele:Elen_1101 major facilitator superfamily
FT                   MFS_1; SPTR: Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79434"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAE3"
FT                   /protein_id="ADK79434.1"
FT                   /translation="MRCLRFLVFAFLVLGFSSCTFFSGDVSLLVRLPDAEGWEVYFPDC
FT                   NEIVRSAAVPAGVSSIRLAICRGVLQPVWACSPNRPWLEAGGILWRGGCGPSGEPPFWR
FT                   FSGDDNPDASPELSLCREGAVVADIMLTLWKRRQDFEDLNIERLYVRMVAVSGGEMRAI
FT                   DCRRIQCDLLFRCFSAYSVRLLPRFDTILYLPAFLSSNIDSALDPLDASSCVAATLLVD
FT                   GTLILKDIYKGRHYFRLPECILIIDCDGSECVWGVLH"
FT   sig_peptide     284883..284951
FT                   /locus_tag="Spirs_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(285797..287329)
FT                   /locus_tag="Spirs_0279"
FT   CDS_pept        complement(285797..287329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0279"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit; InterPro
FT                   IPR013027:IPR003953; KEGG: shi:Shel_26410 succinate
FT                   dehydrogenase/fumarate reductase flavoprotein subunit;
FT                   PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; SPTR: Succinate
FT                   dehydrogenase/fumarate reductase flavoprotein subunit;
FT                   PFAM: FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79435"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAE4"
FT                   /protein_id="ADK79435.1"
FT                   /translation="MKSSSKKIVVSLLILLTMLSCSKTENVATLNHPDLHADLVVVGAG
FT                   GAGLSAAIQARQLGLDVVLLEKNGYPGGSTIMAEGMFAVGSHFQKEAGVKTSSRDVLKS
FT                   VEEYHHWIPDSTLLKKFFESSAETIDWLESLGVKFTGVSFMGDSVQTWHLFKGKGEEYV
FT                   SSLHKAAIEAGVNLMLETPGKELVMEKGKVKGIIAEKKDGTKLSIEAPAVILATGGYSD
FT                   NPEMMRKYAGINPENAVQIGMPGRTGDGINMGIDVGAATSNLGTVVFYGGNLKGVPYGT
FT                   HLYTASAFQPTMVWVNQDGVRFADESIAGRNFSYSGNAIKSQDKVYSIMNKANLDYLVE
FT                   KGCIFGTGEYTVTGTKLTDLYKEMNEQLSKSDSGIFIADSLEKLAALIHVDKNALLTTM
FT                   NNYNSYCEAGNDEEFDKAPTFLVSMSEGPYYAFALEVGYFTTVGGLTVNKDAQVLDLDG
FT                   KVIPGLYAAGSDAGGLYGDSYDVVYCAGSQQGWAVNSGRFAAKDAAIFLGKE"
FT   sig_peptide     complement(287264..287329)
FT                   /locus_tag="Spirs_0279"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            287552..288463
FT                   /locus_tag="Spirs_0280"
FT   CDS_pept        287552..288463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0280"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847:IPR005119:IPR003006; KEGG: dhd:Dhaf_1104
FT                   transcriptional regulator, LysR family; PFAM: LysR
FT                   substrate-binding; regulatory protein LysR; SPTR:
FT                   Transcriptional regulator, LysR family; PFAM: LysR
FT                   substrate binding domain; Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79436"
FT                   /db_xref="GOA:E1RAE5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAE5"
FT                   /protein_id="ADK79436.1"
FT                   /translation="MDIHRIRCFLSLAELMNFTRAAEKQCITQSSMSQQIQGLENEIGV
FT                   QLFVRNKRNVMLTPAGEFLKQEFLELIEKYEAVLAQTRRIANRENNHLSICYHGPPNWA
FT                   FLLPIIQKFQKENEDFQLELSVENWGEMPNGLITRQFDVAFVEGAEIVHNNQIESFYLY
FT                   RDYTCFAMHTSHPLARKTKLTEEDIKGEQIVMVDQHVGAKSMHGVHERLFRSGVDMSKV
FT                   TLVKKFENCMAMVSSGMAIVPMPRSFREPDQSKIVYIDYDRKETYTDIYIAWLKCNTTP
FT                   SLFAFIEFIKDSIRGLLPSLSF"
FT   gene            288534..290120
FT                   /locus_tag="Spirs_0281"
FT   CDS_pept        288534..290120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0281"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="COGs: COG2114 Adenylate cyclase family 3 (some
FT                   protein contain HAMP domain); InterPro IPR000014:IPR001054;
FT                   KEGG: scl:sce7616 adenylate cyclase; PFAM: adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; SMART: adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; PAS domain containing protein;
FT                   SPTR: Adenylate cyclase; TIGRFAM: PAS sensor protein; PFAM:
FT                   Adenylate and Guanylate cyclase catalytic domain; TIGRFAM:
FT                   PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79437"
FT                   /db_xref="GOA:E1RAE6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAE6"
FT                   /protein_id="ADK79437.1"
FT                   /translation="MTKSHVFGELVRAGSRLSDETRYTSQISILVEQAIDVSRSSVAAL
FT                   FAYSDPENPSALLRNVYQRGDYEIPNSIDRTSESVAFVEECGESLILHDRDRPFFSDAF
FT                   LHPDMRSGIILPLFTPRSKLALLYLNSIHPRHYMQDRFLFLDSLSTLAGGMLHSSLLYR
FT                   ELDRQLKYTEALERYQESIFSSMTDLLITTDESGAIHYFNRAAVERFGLDESAYGKSVR
FT                   DLFSSNLSKAVLSAIAESDRDGKERPGIQGIAKGIIMGDGRKEDIDFALTIAPLRGKRG
FT                   RKEGLTLLFTDQSRERKLQDDMKVAVEERRVIKNMFSRYLSRDIVQALTEHPELVRPGG
FT                   AKKIATVFFADIRGYTSFSESKEPEYIIEVLNEYFSQAVEVVIKHRGYIDKFIGDCIMA
FT                   AWGVPVYSDEQDAISAVSCAVEIQELVKSKKRTFFTGAASKLSIGIGMHTGRLVAGNLG
FT                   SSRRMDYSVIGDTVNVAARLEGVAGKGEVIITEDTRSLIGERFKLKELEPVKVKGKEKP
FT                   IHIFNVLKQVS"
FT   gene            290131..292629
FT                   /locus_tag="Spirs_0282"
FT   CDS_pept        290131..292629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0282"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="COGs: COG1413 FOG: HEAT repeat; InterPro IPR004155;
FT                   KEGG: ter:Tery_1841 peptidase C14, caspase catalytic
FT                   subunit P20; PFAM: PBS lyase HEAT domain protein
FT                   repeat-containing protein; SPTR: Peptidase C14, caspase
FT                   catalytic subunit p20"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79438"
FT                   /db_xref="GOA:E1RAE7"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAE7"
FT                   /protein_id="ADK79438.1"
FT                   /translation="MNSDFLSIRVGNFPVWTIAAAVLAVIVCIVVIFLAMKRRSAEKSV
FT                   KERIDSFLRRPAKKTALWILEEAPDTGLFSVFLAALGNEKIATVLRAWIEASDDLFVFR
FT                   RIALTGRGESFDGTEAFRFFSQQLDRIREMTGDPEWPARYMAVKTLLADDEERSRRALI
FT                   ELFHDPHPLIRRTLIAEFQPKDDQEKDEFYNRLIVFLTDDTAFEVRSEAKKRLLSSFPD
FT                   RYVIDFSDLSPAAVLHVVEQFDLSSAEDRKKAFALLEHKDLEIRFAAAQFLQESGSLDA
FT                   LFTEADGEDVEGLKRVEMLLGNAVEVNVVGFLNSLPSSESRVSLQIAADLLQDSGDRGL
FT                   IADLLRKVFPLVGAIREENGVFRADDPDLFRLFSSSLTAVWERGTESSVSMVVEELDRR
FT                   CRLSDAGAILILDALPPGFPHLVLPELLKILEENLCDEKNRNALHDAFLRYSPSLYLDR
FT                   LMDILKSGREGYVHAVRISALVLLGKLKVPYCMQFLLEQMPVLPFDEARDFSLHLKEYA
FT                   GTLFQQRVLDTLEKDDGKVRAALISAIPATGVKDFLIPIRDAVGDADPEVRRAAVWALL
FT                   EYGDQKSIKSSFDLLRDPVERVRMEAARALGSKASDSMLGNFEDLIADENEVESVKLAA
FT                   IKGLSQSTGQRAVDILVKFLKDPSDDLADPLIEALSKLREKKQVKQLIEKMKDAGPELR
FT                   ERITVAFGRMGKEAEGPLLALLSEEIGSLTPLITEVLEATGYVEHAIRKLNHRDPRVRR
FT                   EAAETLSKIGTLAAFRGIVLAGRDPDQEVRVMVTKALEKLGTESGREILEALKEDPDKK
FT                   IRKYTLWALERVEARSGDAK"
FT   gene            complement(292677..295097)
FT                   /locus_tag="Spirs_0283"
FT   CDS_pept        complement(292677..295097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0283"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="COGs: COG0495 Leucyl-tRNA synthetase; InterPro
FT                   IPR002302:IPR002300:IPR013155:IPR001412; KEGG:
FT                   gwc:GWCH70_2764 leucyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ia; tRNA synthetase
FT                   valyl/leucyl anticodon-binding; SPTR: Leucine--tRNA ligase;
FT                   TIGRFAM: leucyl-tRNA synthetase; PFAM: tRNA synthetases
FT                   class I (I, L, M and V); Anticodon-binding domain; TIGRFAM:
FT                   leucyl-tRNA synthetase, eubacterial and mitochondrial
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79439"
FT                   /db_xref="GOA:E1RAE8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAE8"
FT                   /protein_id="ADK79439.1"
FT                   /translation="MTIMSKYPFADIEKKWQDYWERNKSFHVVEDPAIPPEKRVYVLDM
FT                   FPYPSSQGLHVGHPEGYTATDIYCRYLRMNGYNVLHPMGFDSFGLPAENYAIKTGTHPK
FT                   ATTESNIDMFRSQIKRLGFSYDWDREISTHKIEYYRWTQWIFLQLFKKGLAYESQTPIN
FT                   WCPSCKTGLANEEVKEGKCERCGAQVTRKNIRQWILKITTYADQLLEGLEDLNWSEAIK
FT                   TMQRNWIGRSEGADVVFTVEGTEDEITVYTTRPDTLFGATYMVLAPEHPLVAKITTEGQ
FT                   KAAVQAYLDEAAKKSDLERTDLAKDKTGVFSGAYAVNPVNGEKIPVWIADYVLISYGSG
FT                   AIMAVPAHDQRDWEFAKKFDIPIIRVLEGGDIESEAYTGDGVHVNSGFLDGLGKEEAIA
FT                   KMLDWLEERKLGKRSINYKLRDWIFSRQRYWGEPIPIVHCEKCGVVPLAEEDLPLTLPE
FT                   VESYAPTGTGESPLAAINEWVNTTCPKCGGPAKRETNTMPQWAGSCWYYLRYLDPHNDK
FT                   KFASRDKIDYWMPVDLYVGGAEHAVLHLLYSRFWHKVLHEIGAVNTTEPFQRLVNQGMI
FT                   LGEGGVKMSKSLGNVINPDDIIKEYGADSMRVYEMFMGPLQVSKPWSTNGLAGVHRFLD
FT                   RVWRLGERDVIDGPAPDDQKKILHQTIRKVSQDTAALEFNTAIAQMMIFINEMFKSEKL
FT                   YREIWEPFVLIIAPYAPHLAEELWDRLGHNETLAYEPWPQWDEALCQENETEVVFQVNG
FT                   KVRAKCMLPVGMAKEELEKQAMANERIQELIDGKRVMKVIAVPDKLVNIVIGK"
FT   gene            complement(295144..296406)
FT                   /locus_tag="Spirs_0284"
FT   CDS_pept        complement(295144..296406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0284"
FT                   /product="protein of unknown function DUF21"
FT                   /note="COGs: COG1253 Hemolysins and related protein
FT                   containing CBS domains; InterPro
FT                   IPR000644:IPR002550:IPR005170; KEGG: bbz:BbuZS7_0204
FT                   putative hemolysin; PFAM: protein of unknown function
FT                   DUF21; CBS domain containing protein;
FT                   transporter-associated region; SMART: CBS domain containing
FT                   protein; SPTR: Hemolysin, putative; PFAM: CBS domain;
FT                   Domain of unknown function DUF21; Transporter associated
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79440"
FT                   /db_xref="GOA:E1RAE9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAE9"
FT                   /protein_id="ADK79440.1"
FT                   /translation="MVVPLFTLIVLIFLSAVFSSTETAFTSLSIVQLQILSSRQGKTGK
FT                   LVAHLSKRPDTLLTTILFGNNLVNIAASALATQLTIKTFGSAAVGIMTGVLTLVILIFA
FT                   EVTPKQIAIIHNERICLAMAYPIRILSIILLPFIAMIGTISMAITKLFTPKERSSKISL
FT                   EGILHMVSLAEHEGVVEDYETRMVRGVFRFNDITVGSIMTHRTDLFLVDQEATIEVLLP
FT                   KIIENGFSRIPVYQEDPEHIVGILLYRNIMEALAEGADKARKRKAKELMVEPIFVFENR
FT                   KVSELFFQFKKEKLNLAVVMDEYGGLAGVVTLEDIAEELFGELYDENEIKGFEKITQIE
FT                   PGRFRIMGDTSLLQVTDRFEVVLPHSKYVQTIAGFLTEYLGIIPEKGQRIDTGAGCFTI
FT                   ESRSGNRIESLIFEPADKEEE"
FT   sig_peptide     complement(296335..296406)
FT                   /locus_tag="Spirs_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            296529..298400
FT                   /locus_tag="Spirs_0285"
FT   CDS_pept        296529..298400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0285"
FT                   /product="Heat shock protein Hsp90"
FT                   /note="COGs: COG0326 Molecular chaperone HSP90 family;
FT                   InterProIPR020575:IPR003594:IPR020576:IPR001404:IPR 019805;
FT                   KEGG: tde:TDE2480 heat shock protein 90; PFAM: Heat shock
FT                   protein Hsp90-like; ATP-binding region ATPase domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   SPTR: Chaperone protein HtpG; PFAM: Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; Hsp90 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79441"
FT                   /db_xref="GOA:E1RAF0"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAF0"
FT                   /protein_id="ADK79441.1"
FT                   /translation="MSKHTFKTEVSQLLHLIIHSLYSHKEIFLRELVSNASDALDKLKY
FT                   LTLTDDAYKEIAFDPKIDISFRESPSKTITISDDGIGMNKEDLTNQLGTIARSGTKAFI
FT                   DQLSGDAKKDANLIGQFGVGFYSCFMVADRVEVLTRKAGEEQAWLWKSDGKSNFTIEEG
FT                   QREEPGTTITLFLNDEGAEYASRWEIDQLVKKYSNHIPFPIFLSYDQKKYDDKGKETGE
FT                   IEHKREQINSAAALWKRPKNELTDEDYHEFYKSIGHDSEEPLLYIHTKAEGTLEYTTLF
FT                   FVPKHAPFDLYQADYRPGVKLYVKRVFITDDEKELMPTYLRFLRGVIDSEDLPLNVSRE
FT                   ILQQNRVLNSIRTASVKKVLGEFKSLAENNPETYNEFITEYNRPLKEGLYSDFANRDLL
FT                   LELVRFKSTSQEGFTSLAAYKERMKEDQKAIYYITGGDEETLRNSPLLEAYKGKGVEVL
FT                   VMNDEIDEIVVPSIGKFNDVELKAVNRTGAADDLKSDDDKKTEESAKPLMEKLKKALGD
FT                   RVKDVVASTRLSDSPSCIVADEDDPTAQLQQMLKAMGQKNMPEFKPILEVNPTHPIVKG
FT                   LESSGDDALIDDVAQLLLDQALLIEGVELKKPAEFVRHLNRILEKAL"
FT   gene            298420..298812
FT                   /locus_tag="Spirs_0286"
FT   CDS_pept        298420..298812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0286"
FT                   /product="protein of unknown function DUF1312"
FT                   /note="COGs: COG5341 conserved hypothetical protein;
FT                   InterPro IPR010739; KEGG: tpp:TPASS_1032 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1312; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1312)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79442"
FT                   /db_xref="GOA:E1RAF1"
FT                   /db_xref="InterPro:IPR024045"
FT                   /db_xref="InterPro:IPR038690"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAF1"
FT                   /protein_id="ADK79442.1"
FT                   /translation="MNTTRLKRWPRPLDAVIIIIAVLVIVLISIEVYGGRGSAARLLVQ
FT                   SEGRTFVYPLDQDRILEVKGPLGITTIEIRDGRARFVDSPCRDKICVAYGWLENPGEWT
FT                   ACLPNKVLAAIEDNSSKEASIDFLSY"
FT   gene            298829..299461
FT                   /locus_tag="Spirs_0287"
FT   CDS_pept        298829..299461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2194 cytochrome c assembly protein;
FT                   SPTR: Cytochrome c assembly protein; PFAM: ResB-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79443"
FT                   /db_xref="GOA:E1RAF2"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAF2"
FT                   /protein_id="ADK79443.1"
FT                   /translation="MKLALILIIFLALYAAVSGITGKGSEAFRSPFFLFPLGLFALNLI
FT                   SCTAYRLYREISGRQVWHIGPDLVHIALILMIISGLISLFGRWEGQVALSPGEAARLDE
FT                   TYVVVLEEFRIEHYENGAPKEWVSVLAVSSQEGEIKHAEVRVNHPAHVGPYLVYQSSWQ
FT                   EREQGVVSVLLAVKDPSSPLVFVSIAFMVIGLGMTYVPKLRSLLEAS"
FT   sig_peptide     298829..298873
FT                   /locus_tag="Spirs_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            299458..300246
FT                   /locus_tag="Spirs_0288"
FT   CDS_pept        299458..300246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0288"
FT                   /product="cytochrome c assembly protein"
FT                   /note="COGs: COG0755 ABC-type transport system involved in
FT                   cytochrome c biogenesis permease component; InterPro
FT                   IPR002541; KEGG: gsu:GSU3283 CcmF/CcyK/CcsA family
FT                   cytochrome c biogenesis protein; PFAM: cytochrome c
FT                   assembly protein; SPTR: Cytochrome c biogenesis protein,
FT                   CcmF/CcyK/CcsA family; PFAM: Cytochrome C assembly protein;
FT                   TIGRFAM: cytochrome c-type biogenesis protein CcsB"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79444"
FT                   /db_xref="GOA:E1RAF3"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAF3"
FT                   /protein_id="ADK79444.1"
FT                   /translation="MNATLSFFLFLAATAVSACSLFTKRATSFCDLIARILAAIAVIWL
FT                   FILLLWRSFSIGFPALTGMYEGLTFFSGAVGGLTLCMIRKGEQASRMIRLWGFLVAAIL
FT                   LALASSPLAPSSLSYPVPALRSGWLVLHVSFSFLGEAAFTVSFAAAITWFLARQPETKN
FT                   RAEAVASAAVALGYPVYTLGALLFGAIWAQYAWGRFWGWDPKEIWALVTWLVYTLYLHV
FT                   RLGKKRRGAFPMAVLVLGFALTLFTFLGVNFLASGLHSYR"
FT   sig_peptide     299458..299511
FT                   /locus_tag="Spirs_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            300297..300707
FT                   /locus_tag="Spirs_0289"
FT   CDS_pept        300297..300707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0289"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789; KEGG: gur:Gura_3391 two component,
FT                   sigma-54 specific, fis family transcriptional regulator;
FT                   PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; SPTR: Two component, sigma54 specific,
FT                   transcriptional regulator, Fis family; PFAM: Response
FT                   regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79445"
FT                   /db_xref="GOA:E1RAF4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAF4"
FT                   /protein_id="ADK79445.1"
FT                   /translation="MAQVEGIGTDKRRLILLCDDELILRKVARKMIIACGYDAEVFDTG
FT                   RDLIDYVEKKQGKEASAVIIDLQMPDMDGVALFRYFRRTFPLLPVIISTGHVDEESISS
FT                   AKAVGVFYLLYKPYSILELSRVLNLALASTEH"
FT   gene            300712..301980
FT                   /locus_tag="Spirs_0290"
FT   CDS_pept        300712..301980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0290"
FT                   /product="response regulator receiver modulated serine
FT                   phosphatase"
FT                   /note="COGs: COG2208 Serine phosphatase RsbU regulator of
FT                   sigma subunit; InterPro IPR001932:IPR010822:IPR001789;
FT                   KEGG: rru:Rru_A0553 response regulator receiver signal
FT                   transduction histidine kinase; PFAM: Stage II sporulation E
FT                   family protein; SMART: protein phosphatase 2C domain
FT                   protein; SPTR: Sensor protein; PFAM: Stage II sporulation
FT                   protein E (SpoIIE)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79446"
FT                   /db_xref="GOA:E1RAF5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAF5"
FT                   /protein_id="ADK79446.1"
FT                   /translation="MSGNSKSPWKILIVDDEEEVHIVTRMVLKGLEFRDKPLELISAHT
FT                   AEEAFDICERQRDIAVALVDVVLERDDAGLTFVRAVRDKLHDKLMRVILRTGQPGQAPE
FT                   ARVVIDYDINDYKEKVDLTSQKLITSVIAAIRSYADLLTIADLNRELEQKVADRTRALN
FT                   DANLKLRSYIAKLESDHAAGGRMQQRLLPDQDRRFGDYTFSSRLFSSMSLSGDFLDYYE
FT                   IDDQHIGFYIADVSGHGIGSAIVTVLLKNFMDTYLELYKEEGVDLVLRPLDLASRINSE
FT                   LLRENLGKYLTIFLGVLDTNSGRIDYCNCGQFPYPMRIAGGRQETLEESGTPVGLFSAP
FT                   DFIEAGTVLPEGGSLLIISDGILEFMKEGSIEEKQQKLLTLFGEHEPDIGDALQKLGLA
FT                   MPAALPDDITLLLVRREVPLGAR"
FT   gene            301967..302473
FT                   /locus_tag="Spirs_0291"
FT   CDS_pept        301967..302473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0291"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="InterPro IPR002645; KEGG: nhl:Nhal_3172 sulfate
FT                   transporter/antisigma-factor antagonist STAS; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; SPTR: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; PFAM: STAS
FT                   domain; TIGRFAM: anti-anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79447"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAF6"
FT                   /protein_id="ADK79447.1"
FT                   /translation="MERGRYFVAEREGITFIRMVGNLKYTGSSGFDMFLDDFLSQEYRD
FT                   VVVDLSDAVFIDSTNLGLLARIAERSRRMGKPPVTLISPHNDINRILRSVRFDRIFHIV
FT                   SSLDTPESLEELEVGGSHTASQQNDNLNMILRAHKALINLDDANRHEFQDVVDLLEQHQ
FT                   QKQNG"
FT   gene            302620..303213
FT                   /locus_tag="Spirs_0292"
FT   CDS_pept        302620..303213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0292"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="COGs: COG1695 transcriptional regulator protein;
FT                   InterPro IPR005149; KEGG: gvi:glr4157 hypothetical protein;
FT                   PFAM: transcriptional regulator PadR family protein; SPTR:
FT                   Glr4157 protein; PFAM: Transcriptional regulator PadR-like
FT                   family; Virulence activator alpha C-term"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79448"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAF7"
FT                   /protein_id="ADK79448.1"
FT                   /translation="MARTNKTQYAILGMLNYQPMSGYDIKKISDHSIGHFWNENYGNIY
FT                   PVLKRMMREGLVTMDIQQGGSAPPRKVYTITAKGRQFFLDWLAGSPERQILREELLLQL
FT                   FFGQWISPNIIEDKLHNESAFCSAMIKNLQQIKAHLEEDHGKNLPEQSVGTFAAGRPYW
FT                   KMTVEFGLRYYQGIREWCDASLHELSQIDKGEKR"
FT   gene            303210..304667
FT                   /locus_tag="Spirs_0293"
FT   CDS_pept        303210..304667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0293"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="KEGG: mbn:Mboo_2182 NAD(P)H dehydrogenase (quinone);
FT                   SPTR: NAD(P)H dehydrogenase (Quinone); PFAM:
FT                   NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79449"
FT                   /db_xref="GOA:E1RAF8"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAF8"
FT                   /protein_id="ADK79449.1"
FT                   /translation="MKMIVLGGSPKGEISVTMQYVHYLEIQYPEIIFQKRFPAHDIRRL
FT                   EENEEAFEQLIEDIRRADAILWAFPLYILCVCSQYLRFVELVEERGVVEAFAGKPAASL
FT                   STSIHFFDHIAHDYIKAVCEDWKMNFIAMHSPAMDDLTKAEGRQALEHFFSFFLHLAGQ
FT                   KHPACQQFPSIPPQKPRYHSVSTPVSIHSVEACNITVIADSTEGSLGNMIERFASCFSG
FT                   GVEIVDLNRIKMLSGCMGCLHCGPKNMCRYDKADEVRRIYEEKIHPADVLVIAGTIRGR
FT                   WVSSLLKAFIDRGFFHTHQPFLTGKQVALFLDGSLTSNPVLHSGLSDYIACQGGSLIDT
FT                   ICDETEDCSFIDGCIDTLAEKIDTAQEYSYRKSQTFPAIAGMNLFRDEVYMHLRMVFHG
FT                   DHRFYHRNKIYKTLPHKRPLALLGYRLIGGITSLPPVQRKMVRNMKTFMLTPYKPVLAS
FT                   AAREARRGQKENGPEATDERCTKRKGP"
FT   gene            complement(304717..305328)
FT                   /locus_tag="Spirs_0294"
FT   CDS_pept        complement(304717..305328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0294"
FT                   /product="flavoprotein WrbA"
FT                   /note="COGs: COG0655 Multimeric flavodoxin WrbA; InterPro
FT                   IPR010089:IPR008254; KEGG: geo:Geob_3294 TrpR binding
FT                   protein WrbA; PFAM: flavodoxin/nitric oxide synthase; SPTR:
FT                   Flavoprotein wrbA; TIGRFAM: flavoprotein WrbA; PFAM:
FT                   NADPH-dependent FMN reductase; TIGRFAM: NAD(P)H:quinone
FT                   oxidoreductase, type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79450"
FT                   /db_xref="GOA:E1RAF9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAF9"
FT                   /protein_id="ADK79450.1"
FT                   /translation="MKIAVVFYSMYGHMHAMAEAALEGAVTVPGTEGGLYRFPETLDPK
FT                   VLEMLGATEVQKKLSSIPEVTLDVIKDADGIIFGIPTRFGNMPGQARAFFDTTGQLWAQ
FT                   GALIGKVGSVMSSSSTQHGGQESTILTSIVTLMHHGMVIVGLPYSFQGQMTIDEISGSS
FT                   PYGASTITGGKGERMPSENELSAARFQGEYVAEIAKKLST"
FT   gene            complement(305325..305783)
FT                   /locus_tag="Spirs_0295"
FT   CDS_pept        complement(305325..305783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0295"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="InterPro IPR000835; KEGG: lbf:LBF_0068
FT                   transcriptional regulator; PFAM: regulatory protein MarR;
FT                   SMART: regulatory protein MarR; SPTR: HTH-type
FT                   transcriptional regulator, MarR family; PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79451"
FT                   /db_xref="GOA:E1RAG0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAG0"
FT                   /protein_id="ADK79451.1"
FT                   /translation="MSTHYIGSEKERVALDTFIKLNRALQDLSDRTFAKAPLPASLSPV
FT                   RFGILETLYHLGPLYQNELREKLLKSKGTVSISVEQLERAGLVSRSEGNEDRRFRKVAI
FT                   TEEGTGLISAYFPQYTAALTKEMESLTIEEQRLLGNLAKKLGKKEEQK"
FT   gene            complement(306038..306748)
FT                   /locus_tag="Spirs_0296"
FT   CDS_pept        complement(306038..306748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0296"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: mxa:MXAN_3470 putative lipoprotein; SPTR:
FT                   Putative lipoprotein; PFAM: NlpC/P60 family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79452"
FT                   /db_xref="GOA:E1RAG1"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAG1"
FT                   /protein_id="ADK79452.1"
FT                   /translation="MGDAKIAARGSTLLFLVLGTYTALIFSSCASLSPVGSSRTSPSAA
FT                   GNMLTGPAAKTQQALIDSAYTLLGKKRLAVRGKNFRLDCTGVVQAVYWGAGIDLVAPLS
FT                   RYTGNGVSRLYAYLNDQGLLEEASTPSPGDLIFWDDTYDRNGNGKVDDSLTHIGMVVNV
FT                   WENGDLEYIHHNYRKGIVLEKMNHKTPSLYTRKENGKTIIVNSPMRMRGSPAYDKTLSG
FT                   ELVHAWGHAYLLAY"
FT   gene            complement(306741..307352)
FT                   /locus_tag="Spirs_0297"
FT   CDS_pept        complement(306741..307352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0297"
FT                   /product="ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /note="COGs: COG0293 23S rRNA methylase; InterPro
FT                   IPR002877:IPR016448; KEGG: tde:TDE1968 cell division
FT                   protein FtsJ; PFAM: ribosomal RNA methyltransferase
FT                   RrmJ/FtsJ; SPTR: Ribosomal RNA large subunit
FT                   methyltransferase E; manually curated; PFAM: FtsJ-like
FT                   methyltransferase; TIGRFAM: cell division protein FtsJ"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79453"
FT                   /db_xref="GOA:E1RAG2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAG2"
FT                   /protein_id="ADK79453.1"
FT                   /translation="MASNKRATADYYSQLAKKEGYPARSIYKLEEIEKRFGVINTELPI
FT                   LDVGAAPGSWSLFISRLIKAKGLQPTIVSVDLKEMTVSKKSGITVITGDAFAGDAYQSI
FT                   RGMGPYGTIVSDAAPATTGNRIVDTGRSFSLASSVITLAEELLAPGGNLVVKIFQGGDE
FT                   QELMEMVRSRFSQLKTLKPKACRKDSFETYLIGLRKKHNG"
FT   gene            307502..308146
FT                   /locus_tag="Spirs_0298"
FT   CDS_pept        307502..308146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0298"
FT                   /product="Rhomboid family protein"
FT                   /note="COGs: COG0705 membrane protein; InterPro IPR002610;
FT                   KEGG: tde:TDE0124 rhomboid family protein; PFAM: Rhomboid
FT                   family protein; SPTR: Rhomboid family protein; PFAM:
FT                   Rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79454"
FT                   /db_xref="GOA:E1RAG3"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAG3"
FT                   /protein_id="ADK79454.1"
FT                   /translation="MDNRSIIRRPFRYRYYNAAFGIIIVNIVFFVFNTISPQSRYYTAL
FT                   IPGLIIGKGFYWQFFTYMFTHANISHIFFNMLGLFFFGTQVERRIGSSEFLLFYLLTGF
FT                   LAGLFSFIVYTLTGMYGAVLLGASGAIFAVLLAFAVYFPYANIYIMGIIPVKAPLLVIG
FT                   YTAIELFSQLLSINSGVAHLTHLAGFVFAFFYFLIRLNINPIEVFRGGRRR"
FT   gene            308143..308889
FT                   /locus_tag="Spirs_0299"
FT   CDS_pept        308143..308889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tde:TDE0123 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79455"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAG4"
FT                   /protein_id="ADK79455.1"
FT                   /translation="MRIGFSLKRIGWPLLFFFLVVPLWAYDGQVDFLTAELWVELTPSV
FT                   SIPTTDKGDSQESKSQKPEILPIAPVPLKREEAIHRLLEEAQFVISGMIYGYRLEYTPL
FT                   DRSRGVSEVFHADPVATIPWGDPALRVLDTWMRGNKFFARIRYDLSSDQMLRLRFWNSG
FT                   VHASASASAEAALSLGYLGRIEAHRQAIKQAFRDYLRSIEPNKPRVATGRAVLTEAPIS
FT                   AVSAGGYRSTVRIRIDLEDLHPYGAF"
FT   sig_peptide     308143..308217
FT                   /locus_tag="Spirs_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(308904..310010)
FT                   /locus_tag="Spirs_0300"
FT   CDS_pept        complement(308904..310010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0300"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="COGs: COG1816 Adenosine deaminase; InterPro
FT                   IPR006330:IPR001365; KEGG: cts:Ctha_0358 adenosine
FT                   deaminase; PFAM: adenosine/AMP deaminase; PRIAM: Adenosine
FT                   deaminase; SPTR: Adenosine deaminase; TIGRFAM: adenosine
FT                   deaminase; manually curated; PFAM: Adenosine/AMP deaminase;
FT                   TIGRFAM: adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79456"
FT                   /db_xref="GOA:E1RAG5"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028893"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAG5"
FT                   /protein_id="ADK79456.1"
FT                   /translation="MNYNISMVTKEMIRQIPKVELHDHLDGGLRPETIVELADEYGIAL
FT                   PEKDPERLAQWLHRGSDRKSLPLYLESFGVTVAVLQKAEALERAAYEAILDVAKEHVVY
FT                   IEIRFSPVLHLKEGLNVEAVVESVLKGLERGRRETGTEYGLILCAMRDQSVAISLEIAE
FT                   LAVAFSDRGVVGFDIAGDENGHPPKKHLEAFQYIRNRNFNITIHAGEAFGLESIWQAIQ
FT                   ICGAHRIGHATRLIEDMSVHGTRIEKMGTLAHFIRDKRIPLEVCLSSNIQTGAAPNFDD
FT                   HPFHIYFRNGFRVFLNTDNRLMSNTTLSKEMELAVKHYNLSLKDLERLTINAMKSSFAH
FT                   YDERIKIIYDVLKPGYAEVEKTSGYNGH"
FT   gene            310099..311700
FT                   /locus_tag="Spirs_0301"
FT   CDS_pept        310099..311700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0301"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1032 Fe-S oxidoreductase; InterPro
FT                   IPR006638:IPR006158:IPR007197:IPR000385; KEGG:
FT                   pca:Pcar_2487 Fe-S oxidoreductase; PFAM: Radical SAM domain
FT                   protein; cobalamin B12-binding domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB; SPTR: Fe-S oxidoreductase;
FT                   PFAM: Radical SAM superfamily; B12 binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79457"
FT                   /db_xref="GOA:E1RAG6"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAG6"
FT                   /protein_id="ADK79457.1"
FT                   /translation="MVSIHIDRGSRAVPLGAASVAALVHARHGDRVKPIILDCFLDQDI
FT                   AFCVAAIKELRPDILAFSIYLWNRRKSIEIARQIKKELPDLPIFAGGPEVTADWHRLGE
FT                   TYPGCFDLFLPGEGEGSILQGLDMLLAGRPSTSVLFPQSVDLTVLPSPYLDGMLDPAAY
FT                   TGLLWELSRGCPFRCHFCFESKGSEQVRYFSMERITRELELFARSGVRELFILDPTFNH
FT                   NRTRAKKLLRLMQEVAPDIHYNIEVRSEFLDQELAELFSCLSCSLQIGLQSADPKVLRN
FT                   INRSIKQDDFRRKVLFLHEAEVVYGFDLIYGLPGDSLEGFLASIDFAFSMVPNHIDIFP
FT                   LAVLPGTVLFDNADSFGLVRDSDDPYLVRSSSGFHSEDMAVASRIASAIDLFYNQGNAV
FT                   PWFDIIIERLGITPSRFFLDFSLWLEGRISDEPDQAMSEVQQIYLLKLFIDRGLQAEGE
FT                   IVHDIIEIFALWDRIDEAASGNVSELSGFFYFSPSQLFEYLEEGVRDLGELAFFLPRLE
FT                   KTILVSSSEGVLLFQE"
FT   gene            complement(311691..313166)
FT                   /locus_tag="Spirs_0302"
FT   CDS_pept        complement(311691..313166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0302"
FT                   /product="Carbohydrate kinase, FGGY"
FT                   /note="COGs: COG1070 Sugar (pentulose and hexulose) kinase;
FT                   InterPro IPR018484:IPR018485:IPR001589; KEGG: ate:Athe_1997
FT                   carbohydrate kinase FGGY; PFAM: Carbohydrate kinase,
FT                   FGGY-like; SPTR: Carbohydrate kinase FGGY; PFAM: FGGY
FT                   family of carbohydrate kinases, N-terminal domain; FGGY
FT                   family of carbohydrate kinases, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79458"
FT                   /db_xref="GOA:E1RAG7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAG7"
FT                   /protein_id="ADK79458.1"
FT                   /translation="MILIIDAGTTSIRGILYDEEGNAAFISQHHSSPQFLTDGRVEQNP
FT                   LIWKRLLETALKEAVAHLDQHHLPLEAIGLTAFRSPVFPIDKNGKPLLPAIMWQDKRTD
FT                   CLLERFSSHNLDIYLRSGLPVSSVFSAIKMYWIQQYKPEEYKQSWKLIGIYEYLLFLLT
FT                   GRMVTDHSVASRTNLFNLQAKDWDDTLISYFGIDKAKLAELVSPGSVCGELCKEIRKEL
FT                   SISGSIPVVAAGGDQQCSVLGFGITTPGTITVNTGTGAYVLTISPRPVRNEACSIYSNV
FT                   AAAGAYLIESSLSTAGTVYRWFAELSIETTTTEKKKFSLLDREIAQSPPGANGVMLIPR
FT                   FKGPSDSTGQTFSKGAFLNLDLSTKRGDMARAILEGIAFELHDRIIEIESQTNTHNRIF
FT                   ASGGMTRFPLYNQILADIFQRPVTSMKNGEATAFGAWLNTNRAFTASQTGVKFSDSMKA
FT                   AEADIYLPHKKHSALYRSILERRKQTMKALGYS"
FT   gene            complement(313177..313878)
FT                   /locus_tag="Spirs_0303"
FT   CDS_pept        complement(313177..313878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0303"
FT                   /product="class II aldolase/adducin family protein"
FT                   /EC_number="5.1.3.4"
FT                   /note="COGs: COG0235 Ribulose-5-phosphate 4-epimerase and
FT                   related epimerase and aldolase; InterPro IPR001303; KEGG:
FT                   hsm:HSM_1240 L-ribulose-5-phosphate 4-epimerase; PFAM:
FT                   class II aldolase/adducin family protein; SPTR:
FT                   L-ribulose-5-phosphate 4-epimerase; PFAM: Class II Aldolase
FT                   and Adducin N-terminal domain; TIGRFAM:
FT                   L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79459"
FT                   /db_xref="GOA:E1RAG8"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAG8"
FT                   /protein_id="ADK79459.1"
FT                   /translation="MSKHIDTLIEAVFKANLELPVRGLVTFTWGNVSAVDRKQGWIVIK
FT                   PSGVPYEKLQVEDMVVTDMDGNIVHGTKRPSSDLATHIALYKGFPGCGSIVHTHARNST
FT                   AWAQSCTDLPPLGTTHADYFFGAVPCTRKMTDDEIQENYELETGNVIVETFRTRAIDPE
FT                   AVPAALVAAHGPFSWGKTPEEALYHAVVLEEIAYMAMATMSIRPAISHMQQTLLDKHFL
FT                   RKHGKNAYYGQ"
FT   gene            complement(313871..314740)
FT                   /locus_tag="Spirs_0304"
FT   CDS_pept        complement(313871..314740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0304"
FT                   /product="hexulose-6-phosphate isomerase"
FT                   /EC_number="5.1.3.22"
FT                   /note="COGs: COG3623 Putative L-xylulose-5-phosphate
FT                   3-epimerase; InterPro IPR004560:IPR012307; KEGG:
FT                   spe:Spro_3938 putative L-xylulose 5-phosphate 3-epimerase;
FT                   PFAM: Xylose isomerase domain protein TIM barrel; PRIAM:
FT                   L-ribulose-5-phosphate 3-epimerase; SPTR: Putative
FT                   uncharacterized protein; TIGRFAM: hexulose-6-phosphate
FT                   isomerase; PFAM: Xylose isomerase-like TIM barrel; TIGRFAM:
FT                   hexulose-6-phosphate isomerase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79460"
FT                   /db_xref="GOA:E1RAG9"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAG9"
FT                   /protein_id="ADK79460.1"
FT                   /translation="MTLQDVKFGIYEKALPETASWPEKLDLAKRLDFSFVEMSIDESDR
FT                   RLARLEWTRDERKAFMNCVFDSGISVPSICLSGHRRFPLGSHNPDIRARARKILHDAIN
FT                   FSAEVGIRTIQLAGYDVYYEAGDDDTWRWFIDGLNEGVQTAAKEHVMLSMEIMDTHRMS
FT                   SIVRFMNLKRMIMNPWFTVYPDLGNLTAWGNDVVQELELGKNLITAIHLKDTLAVTKTF
FT                   PGQFRDVPFGDGCVDFVAAFRALKRLHFTGPFLMEMWSGKGNDPVKEIEEARKWIIARM
FT                   KEGAYINE"
FT   gene            complement(314737..315393)
FT                   /locus_tag="Spirs_0305"
FT   CDS_pept        complement(314737..315393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0305"
FT                   /product="Orotidine 5'-phosphate decarboxylase"
FT                   /note="COGs: COG0269 3-hexulose-6-phosphate synthase and
FT                   related protein; InterPro IPR001754; KEGG: spe:Spro_3937
FT                   3-keto-L-gulonate-6-phosphate decarboxylase; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase; SPTR:
FT                   3-keto-L-gulonate-6-phosphate decarboxylase ulaD; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase / HUMPS family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79461"
FT                   /db_xref="GOA:E1RAH0"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAH0"
FT                   /protein_id="ADK79461.1"
FT                   /translation="MNRPLLQIALDHTDLKAALESAGKVAEEVDVIEAGTILCYAEGAK
FT                   AVKQIHGAYPDHTIVADLKAADAGEVVANLVFSRGANWMTCICNAPLATMEAAKKVADT
FT                   YSGEIQVELYGAWSFDLAAKWLDIGIHQAIYHRGRDAAAAGQNWSDEDIQKIRHLGKMG
FT                   FAVSVTGGLAPQDLSLFRGIPVKCFISGRSLYEAKDPIAAARAFKQAIRDNWNQE"
FT   gene            315666..316730
FT                   /locus_tag="Spirs_0306"
FT   CDS_pept        315666..316730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0306"
FT                   /product="putative L-ascorbate 6-phosphate lactonase"
FT                   /note="COGs: COG2220 Zn-dependent hydrolase of the
FT                   beta-lactamase fold; KEGG: str:Sterm_0141 putative
FT                   L-ascorbate 6-phosphate lactonase; SPTR: Putative
FT                   L-ascorbate 6-phosphate lactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79462"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAH1"
FT                   /protein_id="ADK79462.1"
FT                   /translation="MSKIDTITRESWILSTFPEWGTWLNEEIDEENVRPGTFAMWWLGC
FT                   TGIWVKSEGNTNICIDLWTKSGKRTKQNPLMKEQHQHQRMIGCRKLQPNLRNVPCVIDP
FT                   FAIRKVEAILATHDHGDHIDENVAAAVLQNISAEVPFVGPQACVDLWTSWGVPKERCRV
FT                   VRPGDSLQIGDVQIIVLDSFDRTELVTAPKGVVLKGKMPQDMDRLAVNYLIKTPGGTIY
FT                   HSGDSHYSNYYAKHGNDHEIDVALGSYGENPRGMTDKMTSVDILRMAESLRTKVVIPFH
FT                   HDIWTNFQADPMEILVLWNMRKDRLQYRFKPFIWQVGGKFVYPDDKELLEYHYPRGFDD
FT                   AFSIEPDLPFKSLL"
FT   gene            316826..318184
FT                   /locus_tag="Spirs_0307"
FT   CDS_pept        316826..318184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0307"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   tpp:TPASS_0074 sugar ABC transporter, periplasmic binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   1; SPTR: Sugar ABC transporter, periplasmic binding protein
FT                   (Y4oP); PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79463"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAH2"
FT                   /protein_id="ADK79463.1"
FT                   /translation="MRRFVVVLLLIFTSSFVFSNGQQDAAGSSPKSVSGEFNWRQCEGE
FT                   TIVTCFPNHVTYNALMPLIPEFEELTGIKVEVDLLQYMKMHDKQVLEMSKPSGDYDLIS
FT                   MVCMWKSEYAAAGMLKELEPFFNDPSLAYPDYDFDDLVPAYVENTGYVGGKKIYLGGPG
FT                   AKLYGVPFGAETSILIYRKDIFDKYNLKVPETYDEVLETAKFIYENVDGMYGMTSRGAS
FT                   GHQANAAYLLHASPFGARVFDENWEPVVNSPESIKTLEWMKKMFSYGPPGMTSFAQDGE
FT                   FQAFLQGDVAMYLDASVFAGKARDPKQSKVYDKLGYAMHPKQENRLSESGGFGLAIPAN
FT                   ASHPEAAFLFLQWITSKETERKVIENGGAPFRTSSVNDPILQDEYPEFKALALQLPHVN
FT                   PDWRPIIPEWGEIDNIMGIAVNQVLTGEKEPQEAMDGIMAPIREIMVRAGYIK"
FT   sig_peptide     316826..316882
FT                   /locus_tag="Spirs_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            318256..319140
FT                   /locus_tag="Spirs_0308"
FT   CDS_pept        318256..319140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0308"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG:
FT                   tpp:TPASS_0075 sugar ABC transporter, permease protein;
FT                   PFAM: binding-protein-dependent transport systems inner
FT                   membrane component; SPTR: Sugar ABC transporter, permease
FT                   protein (Y4oQ); PFAM: Binding-protein-dependent transport
FT                   system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79464"
FT                   /db_xref="GOA:E1RAH3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAH3"
FT                   /protein_id="ADK79464.1"
FT                   /translation="MFNNGVMKRNKSPYLFALPAIAVLLLVMVVPVVSGIRLSFFEWFL
FT                   RDIRKEPVFVGLRNFIDLFGSENFQTSIRVTLVFTISVVCLELFVGLVLALLLEDGLPG
FT                   LRFFRTVFILPVMIAPVVVGVIWKFLYNPSYGKINYFLSVLGLKEVGWLSDPHMALISI
FT                   IITDIWQWTPFVFLLLLAGLQGIPSDLSDAARVDGANYLQNLIHIKLPCISGVIGITAV
FT                   LRLIDAFRGLVVMFIMTNGGPGVSTEILSLHLYKTAFTDQRLGKASAVAVILLGIITLL
FT                   SIIFITKNMKDET"
FT   sig_peptide     318256..318357
FT                   /locus_tag="Spirs_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            319155..319988
FT                   /locus_tag="Spirs_0309"
FT   CDS_pept        319155..319988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0309"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG:
FT                   tpp:TPASS_0076 sugar ABC transporter, permease protein;
FT                   PFAM: binding-protein-dependent transport systems inner
FT                   membrane component; SPTR: Sugar ABC transporter, permease
FT                   protein; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79465"
FT                   /db_xref="GOA:E1RAH4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAH4"
FT                   /protein_id="ADK79465.1"
FT                   /translation="MTFKNRKRLNRFIVLMIVLVGMVICLFPIYEMVSTSLKYEVDAFS
FT                   LPPKWIFRPTFENYRNVLLSNGFGRYFFNSVIVALSTTFFSVCTGALAGYSFSRFKYKG
FT                   KKLLIVFTLLLRMIPPVILVIPVFVIWNSLGLANTRIGLVLVYIGLNLPFNIWVLKTFI
FT                   SEIPRSLDESATIDGCSDWMVFSRIILPLIAPGLSVAGIFTFRIAWNEYILSLVLTNRF
FT                   TRTLPVAVSLFLTDAGTEWGKITAIATITAIPAFIFTFTAAKKLIMGMTAGAVKG"
FT   sig_peptide     319155..319253
FT                   /locus_tag="Spirs_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            320000..321142
FT                   /locus_tag="Spirs_0310"
FT   CDS_pept        320000..321142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG0407 Uroporphyrinogen-III decarboxylase;
FT                   InterPro IPR018039; KEGG: dsy:DSY4756 hypothetical protein;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79466"
FT                   /db_xref="GOA:E1RAH5"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAH5"
FT                   /protein_id="ADK79466.1"
FT                   /translation="MNSTERTFLALDHKEADRVPVDFGGHLISGIHIDAYRKLLEYLGM
FT                   RFDQLRIERYRQRTAVIDEAVHQLFHTDFRPLVPPVPQLVWSDDGSRETYRDEWGVGWE
FT                   RQKDDGDYFECRTPRFSEMPDEEMLRDVHWPDYSKPSRLAGLAHRARTICKEEKVPILD
FT                   LPLGLELFDAGFNLCGSANFYMMLALDPKAAEYIMDRQLEQQLAWWTQAFQSIPDLSLI
FT                   RIGDDLGAQDSMLISPEMYRNLVLPRHKKLFAGIKTASRGRAKIIMHSDGAILPVIPDL
FT                   IEAGIDCLNPVQYTVPGIDPVLLKKEFGKDITFWGGGIDTQSILPNASPSQVKEEVRRQ
FT                   IDILAPGGGFIFSQVHIIQKDVPPENIVAMFEAVRESGIY"
FT   gene            321241..322020
FT                   /locus_tag="Spirs_0311"
FT   CDS_pept        321241..322020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0311"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="COGs: COG1349 Transcriptional regulators of sugar
FT                   metabolism; InterPro IPR001034:IPR014036:IPR018356; KEGG:
FT                   pca:Pcar_0940 putative DeoR-type transcriptional regulator;
FT                   PFAM: regulatory protein DeoR; SMART: regulatory protein
FT                   DeoR; SPTR: Putative uncharacterized protein; PFAM:
FT                   Bacterial regulatory proteins, deoR family; DeoR-like
FT                   helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79467"
FT                   /db_xref="GOA:E1RAH6"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAH6"
FT                   /protein_id="ADK79467.1"
FT                   /translation="MSESSIVANRHLKLLDILNRKGFVRVDQLSMHLNVSQGTIRRDLE
FT                   YLSQKGLLERRHGGARIASSPLNSLPERDFMEKGLINTEEKKAIAKKALELVHDNDIIF
FT                   LNSGSTTLHFLEALRDARVRVFTNNAWAVSCKKGPELELMILGGEYREQSRSFIGIMTL
FT                   EAIKNINSNITFLGTNGISLEKGLTTAVHQECSINQAMIENTNGKVVVLADHSKIGRVS
FT                   NFVSTALNEIDILITDKSAPSETLEKFKHMGVDVIIA"
FT   gene            complement(322127..323911)
FT                   /locus_tag="Spirs_0312"
FT   CDS_pept        complement(322127..323911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0312"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="COGs: COG0173 Aspartyl-tRNA synthetase;
FT                   InterProIPR002312:IPR004365:IPR004364:IPR004115:IPR
FT                   006195:IPR004524; KEGG: tde:TDE1587 aspartyl-tRNA
FT                   synthetase; PFAM: tRNA synthetase class II (D K and N);
FT                   nucleic acid binding OB-fold tRNA/helicase-type; GAD domain
FT                   protein; SPTR: Aspartyl-tRNA synthetase; TIGRFAM:
FT                   aspartyl-tRNA synthetase; PFAM: GAD domain; tRNA
FT                   synthetases class II (D, K and N); OB-fold nucleic acid
FT                   binding domain; TIGRFAM: aspartyl-tRNA synthetase,
FT                   bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79468"
FT                   /db_xref="GOA:E1RAH7"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAH7"
FT                   /protein_id="ADK79468.1"
FT                   /translation="MENMKRTATCGELNSSRVGETVTLNGWVHRNRDHGGILFINLRDR
FT                   YGITQVVIDEDASAPLKEKAKELKFEYCIAVVGIVRRRPDEMVNKDMNTGEIEVAASQI
FT                   EILTKCDVLPFMIDEKSDAKEDLRLKYRYLDLRSFSMQRKIRLRTDVTFAAREFLIGKG
FT                   FMEIETPTMIKSTPEGARDFLVPSRIHAGKFYALPQSPQLYKQILMVSGFDRYFQIAHC
FT                   FRDEDARGDRQPEHTQIDMEMSFVSKDDVFEVVEGMMSHIFDKTLGVKLEIPFQRLPYD
FT                   DALNRFGSDKPDLRFGLEMKTVDELASKSGFNAFKSVIAEGGCVKALVASGCAGYSRKQ
FT                   ISELEDAAKVYGAKGLAWMKVGESGIEGGVSKFFDGIADELLASLEAQEGDLILMVGDK
FT                   WNVACTSLGAVRSKLGKDLGLIEAGTFRFCWIVDFPLFEYNEEEQRWEAAHHMFTMPQE
FT                   QYLDTLEENPGAVKGDLYDLVCNGFELASGSIRIHDPEIQKRIFNIVGFSSEEAENRFG
FT                   FLLNAFRYGPPPHGGIAPGLDRLVMIMAGENSIKEVIAFPKNNQAYSPMDDSPSLVDED
FT                   QLKMLHIKLDMPEKEEES"
FT   gene            323929..324651
FT                   /locus_tag="Spirs_0313"
FT   CDS_pept        323929..324651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0313"
FT                   /product="protein of unknown function DUF218"
FT                   /note="COGs: COG2949 Uncharacterized membrane protein;
FT                   InterPro IPR003848; KEGG: asa:ASA_3722 SanA protein; PFAM:
FT                   protein of unknown function DUF218; SPTR: SanA protein;
FT                   PFAM: DUF218 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79469"
FT                   /db_xref="GOA:E1RAH8"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAH8"
FT                   /protein_id="ADK79469.1"
FT                   /translation="MNVPFSSCHCQRLEVQAILIFRFMKRKSFIVVGIAIICVFFLLLI
FT                   LMLFIDRSISVVARERLYDSISEVPSVKTALVLGTSRYRPGGKTNLYFRYRIEAAKALF
FT                   DAGKVRYLLVSGDNARKSYNEPVEMRQALVEMGVPIDRIVLDYAGFRTLDSVVRCQEVF
FT                   GQDHFIIVSQRFHNERALYIARHFGIDAVAFNAKDVGGYSGRRIRGREYFARVKALLDL
FT                   HFFHTGPRFLGETVEIPE"
FT   gene            complement(324710..325132)
FT                   /locus_tag="Spirs_0314"
FT   CDS_pept        complement(324710..325132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tde:TDE0199 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79470"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAH9"
FT                   /protein_id="ADK79470.1"
FT                   /translation="MVELAIGAVSAVVVAALVILLLGSGKGGHSKKTQTKLTHPQPKRE
FT                   RQCPLCSADLAKGQNIKSVLYPKSPGAPDRLMEIKGCPYCYPAPGKRKRICPVCGKEVP
FT                   YDGDIIARVFDSGERRHVHVLGCSDCYRRKKDAEKN"
FT   gene            325215..325895
FT                   /locus_tag="Spirs_0315"
FT   CDS_pept        325215..325895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0315"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="COGs: COG0313 methyltransferase; InterPro
FT                   IPR000878:IPR018063:IPR008189; KEGG: tde:TDE0200
FT                   tetrapyrrole methylase family protein; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; SPTR: Tetrapyrrole methylase family
FT                   protein; PFAM: Tetrapyrrole (Corrin/Porphyrin) Methylases;
FT                   TIGRFAM: conserved hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79471"
FT                   /db_xref="GOA:E1RAI0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAI0"
FT                   /protein_id="ADK79471.1"
FT                   /translation="MGTLYIVATPIGNLADITFRALKTLKEADVIACEDTRQTLKLLNH
FT                   YEIQKPLVSCRSHNESIAADRIIELLQEDKTVAYVSDAGTPGLSDPGGALVHAVREAGF
FT                   EAVPIPGVSAFAALMSVGSFPGRSVLFDGFLSPKAGKRKKRLEELLERGESFVLYESPH
FT                   RIIKLLTDIADVDPERLVLIGREMTKFHEEYLQGSAQELLNDFSGRESIKGEFSVLVSG
FT                   KKKR"
FT   gene            325944..326231
FT                   /locus_tag="Spirs_0316"
FT   CDS_pept        325944..326231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0316"
FT                   /product="Anti-sigma-28 factor FlgM family protein"
FT                   /note="InterPro IPR007412; KEGG: tde:TDE0201 hypothetical
FT                   protein; PFAM: Anti-sigma-28 factor FlgM family protein;
FT                   SPTR: Putative uncharacterized protein; PFAM: Anti-sigma-28
FT                   factor, FlgM"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79472"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAI1"
FT                   /protein_id="ADK79472.1"
FT                   /translation="MNIERLGPVDPVNKLGKTNKTSKPIKPGEKDSISISNDAKTMAEV
FT                   YKAVETVKASPDIRADRVEEVRRKLEDPSYINDKLLGDVADSIMDMFGIS"
FT   gene            326353..327498
FT                   /locus_tag="Spirs_0317"
FT   CDS_pept        326353..327498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0317"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="COGs: COG1454 Alcohol dehydrogenase class IV;
FT                   InterPro IPR001670; KEGG: tde:TDE0051 alcohol
FT                   dehydrogenase, iron-containing; PFAM: iron-containing
FT                   alcohol dehydrogenase; SPTR: Alcohol dehydrogenase,
FT                   iron-containing; PFAM: Iron-containing alcohol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79473"
FT                   /db_xref="GOA:E1RAI2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAI2"
FT                   /protein_id="ADK79473.1"
FT                   /translation="MQDLSLYMPTRIFCSAGSLLRLAETIGLLGNRFLLVTERALSERE
FT                   EVDRIRSLIEREGGEVMIFTDLPARADSRSAEAASELAKVSRLHAVIGFGGLRALGIAR
FT                   MTALAANSDKRVDDILSGSTVSAPPLPYIEIPGTLRSPFMCSDRFFIVDARNRTPRLVN
FT                   AEGFFPFAAVIDPELSGGLSPKYRVALLLDTLLLSVEGYLSGRNTFFSETAFLKAVALA
FT                   VDAVAGMEVGKVERAGLFAAQAAFFNALGTVSGSPGAGTALSWSISAHRSVPKAVASTI
FT                   LLPYILEYGLRSAPEKVARMGNILGENLKGLSVVAAADRTVERLRSSIGSHEFPGRLSE
FT                   LDLERDAFPEVVGKARELPFIADLPGPLSYDDLMQLLQQAW"
FT   gene            327508..328377
FT                   /locus_tag="Spirs_0318"
FT   CDS_pept        327508..328377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0318"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="COGs: COG0566 rRNA methylase; InterPro IPR001537;
FT                   KEGG: tde:TDE0050 RNA methyltransferase; PFAM: tRNA/rRNA
FT                   methyltransferase (SpoU); SPTR: RNA methyltransferase, TrmH
FT                   family; PFAM: SpoU rRNA Methylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79474"
FT                   /db_xref="GOA:E1RAU4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAU4"
FT                   /protein_id="ADK79474.1"
FT                   /translation="MITIKKLAGLPASTRIRKYPRLMRFFEESLRNDVPIDTTYLRDLF
FT                   SLIAGDPFVTSAVREKVSILNLQCIDKNDVLRSCNGLRHLLLEQLGASPADWDLLPPKP
FT                   LEEGGCEQVRKIIELDLYLDDIRSPFNVGSIFRAAESFGVRKIFLSPGSADPRHPRAQR
FT                   SAMGCVDIVPWCRSSFEEMQTHTTSNKIVALETGGCPLHEFHFPAGGILVIGSEELGVS
FT                   PALMEQASRSGGAVSIETGGRKGSLNVSVATGIVLHAWFSQFRAVEPGVRRHETTISDG
FT                   EPVLSPTD"
FT   gene            complement(328340..328570)
FT                   /locus_tag="Spirs_0319"
FT   CDS_pept        complement(328340..328570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0319"
FT                   /product="glutaredoxin-like protein, YruB-family"
FT                   /note="COGs: COG0695 Glutaredoxin and related protein;
FT                   InterPro IPR002109:IPR011911; KEGG: dtu:Dtur_0034
FT                   glutaredoxin-like protein, YruB-family; PFAM: glutaredoxin;
FT                   SPTR: Glutaredoxin-like protein, YruB-family; TIGRFAM:
FT                   glutaredoxin-like protein, YruB-family; PFAM: Glutaredoxin;
FT                   TIGRFAM: Glutaredoxin-like protein, YruB-family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79475"
FT                   /db_xref="GOA:E1RAU5"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011911"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAU5"
FT                   /protein_id="ADK79475.1"
FT                   /translation="MAITIYTTPSCGYCVKAKEYFRGRGVNFTEYNVAQNMQKAEEMVK
FT                   KSGQMGVPVIDINGRIIIGFNQSEIERALHR"
FT   gene            complement(328769..330250)
FT                   /locus_tag="Spirs_0320"
FT   CDS_pept        complement(328769..330250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0320"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG1639 signal transduction protein; InterPro
FT                   IPR003607:IPR013976:IPR006675; KEGG: tde:TDE2279 HD
FT                   domain-containing protein; PFAM: Metal-dependent hydrolase
FT                   HDOD; SMART: metal-dependent phosphohydrolase HD region;
FT                   SPTR: HD domain protein; TIGRFAM: metal dependent
FT                   phophohydrolase; PFAM: HDOD domain; TIGRFAM:
FT                   uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79476"
FT                   /db_xref="GOA:E1RAU6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAU6"
FT                   /protein_id="ADK79476.1"
FT                   /translation="MAPEVNVVQIQKAARNAVPIAIKTYTLPRETEVYLEDVLGIFLSE
FT                   FGQEHLKDRIAYCLKELSVNAKKANTKRVYFKEKELDINNARDYSEGMKHFKEETLSNI
FT                   GHFLELQKQAGLYIKVVFQARGKTFTLSVKNNVEISKKEQIRVYDRIARSRAFETMEEA
FT                   LSTVLDDSEGAGLGIVILVLMLKKLGLDEDAFDIDTVDGETVARITIPFSDVHIENLDK
FT                   LSEEVVSEINELPQFPDNIVFLQKLINDPDSEITDIARQISTDPSLTADLLKVVNSAQF
FT                   MLPKRVDNIVEAVKLVGLRGLKNLLYSYGTQKILSQDQKWLWDHSYRTAFYAYSLARSF
FT                   KKKKDLLDDAYVGGILHDMGKIVFAHVHPKLLDRISNFCTEREIDRDLFEDLSAGLNHA
FT                   EIGGRIAEKWNFPATLVEAIRFHHEPSECDPEYRDVVETVYLANALANLENGEITFEQI
FT                   DPKVLAGFHIRSEEQGNAILQRLSDAFSKDTDNRE"
FT   gene            complement(330325..332715)
FT                   /locus_tag="Spirs_0321"
FT   CDS_pept        complement(330325..332715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0321"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="COGs: COG1067 ATP-dependent protease; InterPro
FT                   IPR001984; KEGG: dsa:Desal_2757 peptidase S16 lon domain
FT                   protein; SPTR: Peptidase S16 lon domain protein; PFAM: Lon
FT                   protease (S16) C-terminal proteolytic domain; TIGRFAM:
FT                   lon-related putative ATP-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79477"
FT                   /db_xref="GOA:E1RAU7"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041699"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAU7"
FT                   /protein_id="ADK79477.1"
FT                   /translation="MSKQELNAESLELIITESEISEFGAHIDSPDIIGQPRAIRALKMG
FT                   TEMRGRGYNVFVTGLPGTGRTSAIRKILAALKPKQGSPLEDVVYVYNFDDPDAPKVLYL
FT                   EKGKGRLFKREIHDLVEKLKTALRTRIESDEVKERRNGLVRTVEEQENLVITDLEARFR
FT                   KEGFQIIQIREQEKETTDLKPIIEGKAIDFDELQEQAARGDITDQQWEKLREAYFRLMD
FT                   ELKKQFEELHSGRIALDKEIETLKAEVLQPVIDEAIDNIATDYRSASVEAYLDSLRNDL
FT                   RSHTYLFLRERGEEDDGPFPALIRYGVNVIVDNGTTETVPVIFENHPTYSNLFGVIESR
FT                   FDLGGEGGTTFMMIKSGSLIRARGGFIVLNAHDLLQEEGVWEHLKRALQTGEVEIQGPE
FT                   GGITLQHTVLKPKAISIDTKVILTGTENLYDLLYGQDMDFAKHFKITAEFDSVMERTAE
FT                   NCGRYIGFANMICDDESLREIARSGMAAIIEYGIKLSEQRDRLSTRFSLIADLIREADY
FT                   WSGKLGKKDIDREAVARALEERKFLWNLPEEKMTEMILSGEMLLQLEGNAVGKVNGLAV
FT                   HDRGYYAYGLPTVISASAAPGSEGIINIEREVGLSGEIHDKWLLIIEGFLRRTYAREIP
FT                   LSIYANICFEQSYSEIDGDSASSTEVYALLSAIGEIPLRQDIAVTGSVNQLGQLQPVGG
FT                   ISEKIEGFFNICRQTGLSGSQGVIIPAINQNNLMLSDEVCDVVRNGSFHVWSVDTVGEG
FT                   MELLTGLEEGKRNKKGIYPPESINGKVARRLKEMADLVKNYSS"
FT   gene            332792..333553
FT                   /locus_tag="Spirs_0322"
FT   CDS_pept        332792..333553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0322"
FT                   /product="protein of unknown function DUF34"
FT                   /note="COGs: COG0327 conserved hypothetical protein;
FT                   InterPro IPR002678; KEGG: tde:TDE2208 hypothetical protein;
FT                   PFAM: protein of unknown function DUF34; SPTR: Putative
FT                   uncharacterized protein; PFAM: NIF3 (NGG1p interacting
FT                   factor 3); TIGRFAM: conserved hypothetical protein
FT                   TIGR00486"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79478"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAU8"
FT                   /protein_id="ADK79478.1"
FT                   /translation="MTVSELDAYFRSILAIDDLAGVDYSLNGLQVGRFDMPVRKVAFAV
FT                   DACEESILRTKDIGAQMLFVHHGLFWGKEQSITGSHYRRIAALIENDIALYAAHLPLDM
FT                   HETYGNNAGLAKQLGLKDIEPFGVFRRVRIGCAGRFETPQTIDDVLALLEMDREELLGV
FT                   LAFGPEKISSVAIISGGADKDVEQAIEKGVDLYLTGELSHQVYHLCQESGINLIAAGHY
FT                   RTEVYGVQLMAGKLEADTGIETCFIDLPTGL"
FT   gene            333553..334050
FT                   /locus_tag="Spirs_0323"
FT   CDS_pept        333553..334050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0323"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="COGs: COG0597 Lipoprotein signal peptidase; InterPro
FT                   IPR001872; KEGG: tde:TDE2615 signal peptidase II; PFAM:
FT                   peptidase A8 signal peptidase II; SPTR: Lipoprotein signal
FT                   peptidase; TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   Signal peptidase (SPase) II; TIGRFAM: lipoprotein signal
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79479"
FT                   /db_xref="GOA:E1RAU9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAU9"
FT                   /protein_id="ADK79479.1"
FT                   /translation="MEKPYRPFFLTAAIILLDQLTKWLIVSLVPYHTVARSFGGDFLRI
FT                   IHTRNLAVAFSLGNGFPQPVKLFLFILVPLIALVAISVYLVKGRDLSSFQRWVLAAIVG
FT                   GGAGNIIDRIFRPEGVVDFIDVKFYGLFGLDRWPTFNVADSTVVVAGIALLISFFLEER
FT                   KQ"
FT   gene            334047..334322
FT                   /locus_tag="Spirs_0324"
FT   CDS_pept        334047..334322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0324"
FT                   /product="leader peptide processing enzyme"
FT                   /note="KEGG: oih:OB0617 leader peptide processing enzyme;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79480"
FT                   /db_xref="GOA:E1RAV0"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAV0"
FT                   /protein_id="ADK79480.1"
FT                   /translation="MNKKANTVIFILAASFLNIVIMIVLMLGLFALASLLLPADTGAGL
FT                   GQFIFLLIFAASVGGSFFIYHKLVGFISKKIDMEKYFHPIFRSRKR"
FT   sig_peptide     334047..334145
FT                   /locus_tag="Spirs_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(334332..335972)
FT                   /locus_tag="Spirs_0325"
FT   CDS_pept        complement(334332..335972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tde:TDE2751 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79481"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAV1"
FT                   /protein_id="ADK79481.1"
FT                   /translation="MSDNIFSGDIDPEIAELMGMEPQGSSDTTPDFSDLFDEGQISEQT
FT                   VEVEQVDLNKTTFTPITKFQSDKPLPYFSEASFYKIVLSGEGEDAKRLHSLLSKFLNAT
FT                   DVKDKSLYRQKLIPAYWNVAASIAARIHGHLPEQKKYMFRYGFLIPTIVSKEQREMIAR
FT                   IIPENQTNEPVYYIDEWLKKIAIGAISASATDEVKAKQQNQGQRLTGQIEKARGHKEVQ
FT                   IGLIRSKMIEIESAEKLILAKMNDVMHHPQHERFPQVKLPYEASQRSCLGEIMQTVRRL
FT                   QAMDKEISLFFRDLETADNQLEELLSKAGKSGNFSAVDSRTLQEEFNTVRQMAKMCVGR
FT                   QGNHFPILMKQYLKPSIREIGTRENIIAEMTSIEHLDPGVFLRTFKRQTNRIVPYIVLV
FT                   PCYGDKGICWEPFDRYNRATSRGRIALPMYPKDLRTAVLSAIADLRWQVAKEKAQHYWM
FT                   EEGLTGHYYQWFIAQKIRGDVKEYFIQDYILWITKESEGTQKLDREVRGIFWRNMPFPQ
FT                   ELKEELRKRGYVYNELYKKDINRSISDGY"
FT   gene            complement(336002..336075)
FT                   /locus_tag="Spirs_R0007"
FT   tRNA            complement(336002..336075)
FT                   /locus_tag="Spirs_R0007"
FT                   /product="tRNA-Ala"
FT   gene            complement(336138..337400)
FT                   /locus_tag="Spirs_0326"
FT   CDS_pept        complement(336138..337400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0326"
FT                   /product="surface antigen variable number repeat protein"
FT                   /note="COGs: COG4775 Outer membrane protein/protective
FT                   antigen OMA87; InterPro IPR010827; KEGG: ade:Adeh_1155
FT                   outer membrane protein/protective antigen OMA87-like; PFAM:
FT                   surface antigen variable number repeat protein; SPTR:
FT                   Surface antigen variable number repeat domain protein;
FT                   PFAM: Surface antigen variable number repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79482"
FT                   /db_xref="GOA:E1RAV2"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAV2"
FT                   /protein_id="ADK79482.1"
FT                   /translation="MRLLATISLGLCLFVTALSPLFSYNEGETVFPQSKEPLTVRSITI
FT                   TGLEKTRRSAILPLISIRLGDPLRKEDVEQSQQRLKQTNLFSKIQFHYNQEGPEVDIEL
FT                   VVEEKLSVVAIPVVASNGDSLMFGATLFEANFLGLRRQFIGAAFYTLNESLNATIGYID
FT                   PSLSDGTSTLIFFAGGGKTEREDLLQDKTSIRSFTSQGFRINGGLETRTDARLQPGIQV
FT                   KYDSTFVEDGDVDSAQMIGIGLSLSWKDLYYLEFFEKGLWANVSFDVGYDFYENGSPLF
FT                   TETELNIAYTLPFAGKHLLKFEARGGDSTAPTALLNTLNGDGFRVLPSGDSVGWQYMAG
FT                   SVTAEFSLLSFPWGTGTMAFFFDGGTYTPQERNHYTRFYGPGGGIRLYLNKIVFPALQF
FT                   NIGWNIPEDVSFFSFSIGMGR"
FT   sig_peptide     complement(337326..337400)
FT                   /locus_tag="Spirs_0326"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(337521..338162)
FT                   /locus_tag="Spirs_0327"
FT   CDS_pept        complement(337521..338162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0327"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="COGs: COG0450 Peroxiredoxin; InterPro
FT                   IPR000866:IPR019479:IPR017936; KEGG: hor:Hore_12960 alkyl
FT                   hydroperoxide reductase; PFAM: alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen;
FT                   Peroxiredoxin-like; PRIAM: Peroxiredoxin; SPTR: Alkyl
FT                   hydroperoxide reductase; PFAM: C-terminal domain of 1-Cys
FT                   peroxiredoxin; AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79483"
FT                   /db_xref="GOA:E1RAV3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAV3"
FT                   /protein_id="ADK79483.1"
FT                   /translation="MEHSFPLIGEAFPELEVQTTHGRKSLPGDYKGRWFVLFSHPADFT
FT                   PVCTTEFVAFAKRADQFAKLDCDLIGLSIDQVFSHIKWIQWINEKLEVKIPFPVIADDR
FT                   GLVAQQLGMIHPGKGTNTVRAVFIVDPKGIVRLVLYYPQEIGRNMDEVLRAVRALQVAD
FT                   KNNVAIPAGWPENELIGDRVIIHPPADEKSAETRLSEHEGFDWWFCHKKL"
FT   gene            complement(338231..338659)
FT                   /locus_tag="Spirs_0328"
FT   CDS_pept        complement(338231..338659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0328"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="COGs: COG0735 Fe2+/Zn2+ uptake regulation protein;
FT                   InterPro IPR002481; KEGG: cpb:Cphamn1_0153 ferric uptake
FT                   regulator, Fur family; PFAM: ferric-uptake regulator; SPTR:
FT                   Ferric uptake regulator, Fur family; PFAM: Ferric uptake
FT                   regulator family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79484"
FT                   /db_xref="GOA:E1RAV4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAV4"
FT                   /protein_id="ADK79484.1"
FT                   /translation="MNKALYRNSKQRNALYQYLLSTDTHPTAQELYEALRPDFPNLSFG
FT                   TVYRNLGILEQQGMVRRLGRGSTFDRFDATVEPHYHFICDKCGRIYDLPLNVDLSLEEK
FT                   VAQATGHTVTAHELDFHGICMHCKEAERQGEKDLVQKA"
FT   gene            complement(338695..339129)
FT                   /locus_tag="Spirs_0329"
FT   CDS_pept        complement(338695..339129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0226 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79485"
FT                   /db_xref="GOA:E1RAV5"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAV5"
FT                   /protein_id="ADK79485.1"
FT                   /translation="MKSSMVEWLMNKKNLKTIIIAIPVLVIVIGLKLLQGDGRFLYMSS
FT                   DRPATMEARFYRFSDEKERKVGLLPGDELMIRWEETEKAGTLRLEIFDPEGKLIKRIDN
FT                   GPAEYRCIATQKGNYRLLVVGEKARGSFSVSWDYIQALDR"
FT   gene            339211..340458
FT                   /locus_tag="Spirs_0330"
FT   CDS_pept        339211..340458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0330"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="COGs: COG0204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; InterPro IPR002123; KEGG: mla:Mlab_0811
FT                   hypothetical protein; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase; SPTR: Phospholipid/glycerol
FT                   acyltransferase; PFAM: Acyltransferase; TIGRFAM:
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79486"
FT                   /db_xref="GOA:E1RAV6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAV6"
FT                   /protein_id="ADK79486.1"
FT                   /translation="MPNINKKQRHKTITPSPFFIKVIKPFLHWLLPRLYTIQVIRSKEL
FT                   NAIHPPYIIVGNHVNFWDPFLLGLYIKEVPQFVTSDNIFRTRLFGVIMKLFGSIPKSKF
FT                   MSDAATVAQIVRIIKGGGVIGIFPEGRRTWDGRSLEHVPQVSKLIQRLAIPVVGVRVKG
FT                   AFLARPRWARKRSKGLVELEYFSLFSGEELKGLGWEEVKQLMEKQLFHDDVAWAREKEL
FT                   RFVGKRRAEYVEKLLYLCPSCEGVATLVSHDNTVECSSCGYAFTYDETGELGPVTGPLR
FT                   FSELGDWNDWQQKRLIERICELPDGEQIFMEEGPAMLLTGYRAQRLKKLKTGRALFSRD
FT                   TLYFRTTLREGFSFPVNELEAVNVQDKEKLEFYHKGMLFRLNFVSSRASALLWYRAITG
FT                   VQECLASGNLLSSDKS"
FT   gene            340485..341876
FT                   /locus_tag="Spirs_0331"
FT   CDS_pept        340485..341876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0331"
FT                   /product="dihydropyrimidinase"
FT                   /note="COGs: COG0044 Dihydroorotase and related cyclic
FT                   amidohydrolase; InterPro IPR006680:IPR011778; KEGG:
FT                   azc:AZC_2674 phenylhydantoinase; PFAM: amidohydrolase;
FT                   SPTR: D-hydantoinase; TIGRFAM: dihydropyrimidinase; PFAM:
FT                   Amidohydrolase family; TIGRFAM: D-hydantoinase;
FT                   dihydroorotase, multifunctional complex type"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79487"
FT                   /db_xref="GOA:E1RAV7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAV7"
FT                   /protein_id="ADK79487.1"
FT                   /translation="MYDVVIKNGTVVNSWGMIEADVAVSSETIVAVGLGLSGKREIDAG
FT                   GKLVIPGAVDTHVHLSLDLGGGLISSDDFFTGTRAAAFGGTTTVVPFVHPESGETMESA
FT                   FRRRQNEAEGDVVVDYGWHMNIGPDAFKELGGLQAAVNRVKSLGIVTFKLYMAYGYRLS
FT                   DSQLFQAMEAVGRAGGLSVVHAENWDLISFLVERAVHAGEHHPRWHETCRPSSFEAEAV
FT                   SKVAAIAAYLSFPAEIFHVGNRAVSKTIEDARKKNIPLFGETCPQYLFLTTDAFDREGV
FT                   EGAYPVCSPPIRPEADRTAMWDALSSGALQIVSTDHCPFLAEEKEKGLETGFQKIPGGV
FT                   PSIEMRLSALYSEGVRSGHISPEQWIDVCCTTPARLHGFDRKGDIAPGKDADIVIFDPE
FT                   KEHYLTAETLHERCGWTPYEGMKLVGKVESTLLRGRTVVDNGSFVGAAGMGKYISRSGI
FT                   DARLH"
FT   gene            341898..342644
FT                   /locus_tag="Spirs_0332"
FT   CDS_pept        341898..342644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0332"
FT                   /product="TPR repeat-containing protein"
FT                   /note="InterPro IPR019734:IPR001440:IPR013026; KEGG:
FT                   cyc:PCC7424_2005 TPR repeat-containing protein; PFAM: TPR
FT                   repeat-containing protein; SPTR: TPR repeat-containing
FT                   protein; PFAM: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAV8"
FT                   /protein_id="ADK79488.1"
FT                   /translation="MDFREDRPEIDALLEEADEAFDKGEFDMAVRRYSDVLRIDFEHVG
FT                   ALMNRGAAYHSLGQYEKALEDDLRALEYDTEDEKLFFNTGLVLNALERNDESLEYYDQA
FT                   LRLRFDYGLAYYARANTLAYLDRHEEAVEDYAKADRFGVEYDDIYRFWGLSCEKCGRYQ
FT                   DAANLYERAMDEVHDESVLCRIGYCFWMMGDYRAAEGFLHRAIGIDFGEGDACITLLAL
FT                   YSEQKRFSERDAVLRMLSGSEDGMSS"
FT   gene            342641..344068
FT                   /locus_tag="Spirs_0333"
FT   CDS_pept        342641..344068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0333"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_3958 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79489"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAV9"
FT                   /protein_id="ADK79489.1"
FT                   /translation="MTFGPDLLIRCPGCRNIYIRNSVGSENSLGARYWSDGWNDAPMMP
FT                   IPPLVAWCEWCHTWFFIEDAEPLVELPFGTEPGEHKVIPVSDSLDVEAYRSVLKQSWSK
FT                   EREILLRIRLMWGYNHMLRQDRYRKDPATVESHDNLERLADLLDPNRDLLMLAEVHREL
FT                   GEFPRAKEFAIAVIEAESEELNRTWAMRIIRESERRNIFPVQLNDDELFYHENLLFPEC
FT                   IDAGYYPLPEWEDVFAFADEKKMELTHPFVSVHFSLVGLQGDGWATFFEDGHSSWHYRY
FT                   DRLFTQEEWRFFLSLSEGARNELIDFWEMKSYQCDQFNQYELNFYYRTLFRLHYGYRQP
FT                   LEKELYDAHFRKYRKAWAGIRASLSLEEGAPEELLLYWRFFWESFTGRCKLSQIKAELV
FT                   DKMSSDLAEAQKLVNRRRDFLLNHIDTFEFGDEISDASPRYIGRIPGEFFEKALPGMCS
FT                   LYFDEEESRFEQYHDEG"
FT   gene            complement(344053..345216)
FT                   /locus_tag="Spirs_0334"
FT   CDS_pept        complement(344053..345216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0334"
FT                   /product="Capsule synthesis protein, CapA"
FT                   /note="COGs: COG2843 Putative protein of
FT                   poly-gamma-glutamate biosynthesis (capsule formation);
FT                   InterPro IPR019079; KEGG: tde:TDE1500 hypothetical protein;
FT                   PFAM: Capsule synthesis protein, CapA; SPTR: Putative
FT                   uncharacterized protein; PFAM: Bacterial capsule synthesis
FT                   protein PGA_cap"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79490"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAW0"
FT                   /protein_id="ADK79490.1"
FT                   /translation="MRIIGRIAAIFTALVLINGATIILTEYGHKAPHLPPPQERMAPPE
FT                   SITLLFAGDLMAHNVNFNMADYTDIYQEMKPAIEHADLAFINLETPVYEKAPYTSFPRF
FT                   NVHQDYVQAAVDAGFDIFALANNHSADQEAPGIIATLELMRKLAAEEGIAYSGLRMHQR
FT                   SPITPTTVKAGNWTIGFISITSFINVWSGHELIYLTDYYRNEALRRAFSDYIRTIRPLY
FT                   QILVVAVHDGAEYSNTPLERKKVFFRELAEAGADVVWGNHSHVLQPWERFTKKDGTTAV
FT                   LIYSMGNFISGQTWNIDPDDYKNEKNATGDSCLLNITFTKEPGKKAIPRSITPYLAFNY
FT                   RDPVKGMIVRPYDKIIGDEGVPKAWKDFYRERKRLLSWFLRPDQPSS"
FT   gene            345309..345497
FT                   /locus_tag="Spirs_0335"
FT   CDS_pept        345309..345497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0335"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bid:Bind_2706 FmdB family regulatory protein;
FT                   SPTR: Regulatory protein, FmdB family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79491"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAW1"
FT                   /protein_id="ADK79491.1"
FT                   /translation="MGQKAYQCEDCGNEVIVDDVNAIPECCGKAMKEIPLDECIKASNP
FT                   ESARSWEVEDACDDGVH"
FT   gene            345472..345768
FT                   /locus_tag="Spirs_0336"
FT   CDS_pept        345472..345768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dhd:Dhaf_0280 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79492"
FT                   /db_xref="GOA:E1RAW2"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAW2"
FT                   /protein_id="ADK79492.1"
FT                   /translation="MRVTTGSIKLFLLVAIAALLLTGCLPGDGSYSADRPAGIFSGIWH
FT                   GWIAPISLVISIFKDRIAIYEPNNTGFWYDFGFYAAILGGFGGFSLARKKRRE"
FT   sig_peptide     345472..345558
FT                   /locus_tag="Spirs_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(345772..346572)
FT                   /locus_tag="Spirs_0337"
FT   CDS_pept        complement(345772..346572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0337"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="COGs: COG1378 transcriptional regulator protein;
FT                   InterPro IPR002831; KEGG: hor:Hore_06640 transcriptional
FT                   regulator, TrmB; PFAM: transcriptional regulator TrmB;
FT                   SPTR: Transcriptional regulator, TrmB; PFAM: Sugar-specific
FT                   transcriptional regulator TrmB; Archaeal transcriptional
FT                   regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79493"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR021586"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAW3"
FT                   /protein_id="ADK79493.1"
FT                   /translation="MKSDIEETLSYFKEMGFTEYEAKVYLSLLAEHPASAYTISQNSGV
FT                   PHSRVYDVTRRLIKQGLAASSGTKPELFSPLSPGELIEKLRREYEVFTDELEKRLTSGN
FT                   FISDFDPVWNLPNRSKAIELAKDLIGRAKSTIYIGIWQEELGAFERVLRKAEKQGVKVY
FT                   MLLYGEEKPSFGEVYLHETENMDSYSELGHTLDCTVDSTWCITGTLGGQLPCQIVWTKN
FT                   RGLVQSIQSYISHDFYLAELHHHFGDQIDRLFGKNLTRLRKKFS"
FT   gene            complement(346679..347512)
FT                   /locus_tag="Spirs_0338"
FT   CDS_pept        complement(346679..347512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0338"
FT                   /product="Cof-like hydrolase"
FT                   /note="COGs: COG0561 hydrolase of the HAD superfamily;
FT                   InterPro IPR013200:IPR000150:IPR006379; KEGG: btl:BALH_4896
FT                   HAD superfamily hydrolase; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; SPTR: Cof-like hydrolase;
FT                   TIGRFAM: Cof-like hydrolase; HAD-superfamily hydrolase,
FT                   subfamily IIB; PFAM: haloacid dehalogenase-like hydrolase;
FT                   TIGRFAM: Cof subfamily of IIB subfamily of haloacid
FT                   dehalogenase superfamily; HAD-superfamily hydrolase,
FT                   subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79494"
FT                   /db_xref="GOA:E1RAW4"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAW4"
FT                   /protein_id="ADK79494.1"
FT                   /translation="MNAQSAVRLLAVDLDDTLLREDLTISNDNKQALIKAEEAGVTVLL
FT                   ASGRVFEAMHHYADELGMTARPGYLISNNGGTITRSDTGELVSRKTIEPVLAQQIYEAV
FT                   KTRNFPTEIYRGRSVYVDRDNSWTDIDCSLSGLTKKIVPDFAKTLAEEPPVKMVVPGDP
FT                   KVLEKVQAELTEMFGDTLTIFTSKPFFLEMLPKDADKGQALAYLAQSLGIAREEVMAIG
FT                   DSCNDLAMIQWAGIGVVMVNGNEAVKAEATYVTRKTNEENGVAEAVEHFILHRHP"
FT   gene            347576..348814
FT                   /locus_tag="Spirs_0339"
FT   CDS_pept        347576..348814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0339"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: cno:NT01CX_1080 major
FT                   facilitator superfamily protein; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Major facilitator superfamily
FT                   protein; manually curated; PFAM: Major Facilitator
FT                   Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79495"
FT                   /db_xref="GOA:E1RAW5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAW5"
FT                   /protein_id="ADK79495.1"
FT                   /translation="MFLNLYRGLPRSVYALFGARIVNRMGDFVRTFLTLYLTRILGLPT
FT                   ALSGTFVMLSAMASSVGAFAAGHFVDSHGRRRIILTSQLASALLIGSCGFLPTGTYIPW
FT                   LLIAGTFFMGAIRPAVNAVVADITEPDRRQSAYGLLYLGTNIGVAVGPMIAGFLFRHYI
FT                   RWIFIGDAVSTLIAMAVVFSLVPETIPHAGYASSGNTPDMEDLERPERGPFLSILLRRP
FT                   QLLVFALLGVCINLIYSQHSFALPLYLDSLFGSAGAAQFGLLMSFNAVTVLVATTLVLG
FT                   ATARFPASFNMGLGALCYLTGFGMLAFVSAFTPFGFFFLSTCIWTVGEILVVTNYQVFV
FT                   ASNTPLTHRGRFNGTMNLSFGIGNMLGPPVAGFFLAHVLFSSFWLFVAGASLIVATAYY
FT                   LLYLYTGKQRRAA"
FT   sig_peptide     347576..347749
FT                   /locus_tag="Spirs_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            348811..349782
FT                   /locus_tag="Spirs_0340"
FT   CDS_pept        348811..349782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0340"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="COGs: COG0111 Phosphoglycerate dehydrogenase and
FT                   related dehydrogenase; InterPro IPR006139:IPR006140; KEGG:
FT                   pmo:Pmob_0223 D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; PFAM: D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase catalytic region; SPTR: D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding; PFAM: D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD binding domain;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79496"
FT                   /db_xref="GOA:E1RAW6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAW6"
FT                   /protein_id="ADK79496.1"
FT                   /translation="MNIFFYQKLNSIWTSNLEKIRSEFPHVQFLTESDEPDMEEIEVVV
FT                   GGKPTKEFLSAAPRLKLVIVPFAGVNHLPLEFIAERGIRVANSHGNAPDVAERTLAMIL
FT                   AWYGKIVEYHNDLLRGQWHGFWVGRGLDDTWKSIRGSRCAILGTGEIGIHLARLLAPLE
FT                   VETIGYKRRPVSAPIPGFSRISHDLDEVIDAADTVVIALPATDATIGLFDEKRLSRMEG
FT                   KLLVNVGRGSIVDEAALSHALEAGTLAGAAIDCWYSYPTDGTIGAPARLPFYKQESVLL
FT                   SPHIAGFTPQALTRNIEQAFENLRRYLRDRSLLFEINPSGGY"
FT   gene            complement(349828..350754)
FT                   /locus_tag="Spirs_0341"
FT   CDS_pept        complement(349828..350754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0341"
FT                   /product="Hsp33 protein"
FT                   /note="COGs: COG1281 Disulfide bond chaperones of the HSP33
FT                   family; InterPro IPR000397; KEGG: dat:HRM2_11210 HslO;
FT                   PFAM: Hsp33 protein; SPTR: HslO; manually curated; PFAM:
FT                   Hsp33 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79497"
FT                   /db_xref="GOA:E1RAW7"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAW7"
FT                   /protein_id="ADK79497.1"
FT                   /translation="MIEKPIVGKTLSEHLKQLSKDTLDIFLLEEGSLRGAIAHGSMMVN
FT                   QMRANHDLGVLESYVLGQAYLAAGLLSSAVKGNDRLILSIECGGPIKGLSVETDAKAQV
FT                   RGYLAQVPIPVEKPLENFDLSPFFGPGFLKITKQLEHAKRPFPGQIMLRSGNLAEDLAW
FT                   YYLESEQTKSFFSLSIQFDNKGDIIGAGGLFLQELPGAKAEALEKVQETALAMPSLGTA
FT                   FSKGVSGSELVNRTLGKHSPQILGSRPLRFFCSCSKERFGAFLAGMQGLQQEEILKDSD
FT                   FPLRVECHNCGSVYEFSRVECEELFSN"
FT   gene            350839..351366
FT                   /locus_tag="Spirs_0342"
FT   CDS_pept        350839..351366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0342"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="COGs: COG0225 Peptide methionine sulfoxide
FT                   reductase; InterPro IPR002569; KEGG: mrb:Mrub_0616 peptide
FT                   methionine sulfoxide reductase; PFAM: Methionine sulfoxide
FT                   reductase A; PRIAM: Peptide-methionine (S)-S-oxide
FT                   reductase; SPTR: Peptide methionine sulfoxide reductase;
FT                   TIGRFAM: peptide methionine sulfoxide reductase; PFAM:
FT                   Peptide methionine sulfoxide reductase; TIGRFAM:
FT                   methionine-S-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79498"
FT                   /db_xref="GOA:E1RAW8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAW8"
FT                   /protein_id="ADK79498.1"
FT                   /translation="MREEVIVLGGGCFWCMEAIFRRVEGVLRVTNGYAGGRDPEPTYEK
FT                   VSSGTTGYAEVVEIRFDADRLSLKDLLELFWKAHDPTTRDRQGADIGSQYRSVIFFTEP
FT                   HQQIIARESMQELHDLGHYENPIVTELLPLSQFHPAEAYHQDYYARNSFAPYCRMVIAP
FT                   KLNKLEANGTGS"
FT   gene            351509..352633
FT                   /locus_tag="Spirs_0343"
FT   CDS_pept        351509..352633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0343"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="COGs: COG0683 ABC-type branched-chain amino acid
FT                   transport systems periplasmic component; InterPro
FT                   IPR000709:IPR001828; KEGG: dal:Dalk_4388 extracellular
FT                   ligand-binding receptor; PFAM: Extracellular ligand-binding
FT                   receptor; SPTR: Extracellular ligand-binding receptor;
FT                   PFAM: Receptor family ligand binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79499"
FT                   /db_xref="GOA:E1RAW9"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAW9"
FT                   /protein_id="ADK79499.1"
FT                   /translation="MRRGRIFLILLIVFLTLGMVSCKKKDSDTIKIGVAGAHSGDLASY
FT                   GLPTVKAAELVVKDANANGGILGRQVELVVEDDVCKPEVATNTASKLVGEKVVGVIGHI
FT                   CSGATKAALGIYKDSNIFAISPSATNPPLTQSGDYPNFFRTIASDDAQARLEVDFALDT
FT                   LGLTKIAVLHDKGDYGKGLAEFAKGFLENDDRAEVVLYEGVTPGAVDYTAVINKIEASG
FT                   AQAIIFGGYHPEASKIVAQMRKAGMDIAFISDDGVKDDTFIKVAGEYAEGVYATGPKDT
FT                   TSNPLAKKAIKEHQDAYGEDPGAFYLNAYAATLAVLNAIEAAGATDYDAVTNALRTEWV
FT                   ETPLGKIRFDEKGDAIGIGFSMYQVRNGAYVEIE"
FT   sig_peptide     351509..351580
FT                   /locus_tag="Spirs_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            352732..353640
FT                   /locus_tag="Spirs_0344"
FT   CDS_pept        352732..353640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0344"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG0559 Branched-chain amino acid ABC-type
FT                   transport system permease components; InterPro IPR001851;
FT                   KEGG: dat:HRM2_02780 LivH1; PFAM: inner-membrane
FT                   translocator; SPTR: LivH1; PFAM: Branched-chain amino acid
FT                   transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79500"
FT                   /db_xref="GOA:E1RAX0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAX0"
FT                   /protein_id="ADK79500.1"
FT                   /translation="MKLDFFLGLLLGGLTRGSIYALLALGYTMVYGIIQLINFAHGEIY
FT                   MIGAFTALIVAGVLTLSGMPTLAIFAIALVVAVVYAMGYGYTIEKMAYKPLRQAPRLSV
FT                   LISAIGMSMFLQNYVLLAQTSDFQPFPALIPEFAFLEPYRKIISSSQLFILITTAIVMV
FT                   LLTVLIRYTRTGKAMRATSQDKTMAMLVGINVNKVISTTFIIGSGTAALGGLLISSHIG
FT                   QINFYIGFIAGIKAFVAAVLGGIGSIPGAVLGSFVLGMTESFGTGLVSSDYEDVFAFVF
FT                   LILILIFRPEGLLGRSTKQKV"
FT   sig_peptide     352732..352794
FT                   /locus_tag="Spirs_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            353653..354912
FT                   /locus_tag="Spirs_0345"
FT   CDS_pept        353653..354912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0345"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG4177 ABC-type branched-chain amino acid
FT                   transport system permease component; InterPro IPR001851;
FT                   KEGG: dat:HRM2_02770 LivM1; PFAM: inner-membrane
FT                   translocator; SPTR: LivM1; PFAM: Branched-chain amino acid
FT                   transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79501"
FT                   /db_xref="GOA:E1RAX1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAX1"
FT                   /protein_id="ADK79501.1"
FT                   /translation="MTKINLWKEAKTSLIIALWFVILTFPIMVIKVNTIDDIVEWRWIR
FT                   ILFVGIGAFFLSAAYRYMLYRKKTGARREAKARVLKIPRLGINTTLDAAFFSQKKVALP
FT                   GILFIALAIIILPFISSMYQTNIISTALLSVMLGMGLNIVVGLGGMLHLGYIAFYAVGA
FT                   YTYALLNYHFGVNFWVALPLGGLFSMIFGILLGIPVLRLKGDYLAIVTLGFGEIIRIVL
FT                   ENWNEFSFGPSGIANIPRPGFFGVKLSIQHASIFTYFILIALVIFTIFIVSRLKNSRLG
FT                   RAWEAMREDDIACEAMGVDITKAKMTAFALGAFWAGLAGVVFASKTTFINPASFTMWES
FT                   IVVLCIVVLGGMGSLGGVVIGALLIVLLPEYLRAFSEYRMLLFGAVLVVMMIFRPEGLI
FT                   QARRHVFTFEHGENKSEAEK"
FT   gene            354909..355700
FT                   /locus_tag="Spirs_0346"
FT   CDS_pept        354909..355700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0346"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG0411 ABC-type branched-chain amino acid
FT                   transport systems ATPase component; InterPro
FT                   IPR003593:IPR003439:IPR018170; KEGG: dap:Dacet_0895 ABC
FT                   transporter related protein; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: ABC transporter related protein;
FT                   PFAM: ABC transporter; Branched-chain amino acid
FT                   ATP-binding cassette transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79502"
FT                   /db_xref="GOA:E1RAX2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAX2"
FT                   /protein_id="ADK79502.1"
FT                   /translation="MNEAVLDVRNLTMEFGGLRAVDSVDLQVADQQIAALIGPNGAGKT
FT                   TFFNCVTGIYKPTGGDVMANPPGKEPSRLNGLKPNKVTERGLARTFQNIRLFQNMTVLE
FT                   NVMIGRHCRLKAGVLGAIFRNKATREEEKRVIEESYHVLKKIGLEEHVNELAKNLPYGA
FT                   QRRLEIARALATEPFILLLDEPAAGMNPQETKDLMKLIYQLRENEKIAILLIEHDMSLV
FT                   MSISERVFVMDYGKLIADGTPQEIKKSPAVVKAYLGEDIDA"
FT   gene            355693..356400
FT                   /locus_tag="Spirs_0347"
FT   CDS_pept        355693..356400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0347"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG0410 ABC-type branched-chain amino acid
FT                   transport systems ATPase component; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: dap:Dacet_0896 ABC
FT                   transporter related protein; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: ABC transporter related protein;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79503"
FT                   /db_xref="GOA:E1RAX3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAX3"
FT                   /protein_id="ADK79503.1"
FT                   /translation="MLKIEDVNTFYGNIQALKGISIEINEGEVITLIGANGAGKTTTLM
FT                   SICGIVPPRSGNITFLGSSLLDKEPDEIVAMGISQVPEGRRIFPYLTVQENLDMGAFLR
FT                   KDQEGIARDREYIYELFPILAERRNQAGGTLSGGEQQMLAISRAIMARPKLLLLDEPSL
FT                   GLAPLIVLQIFDIIKKINTENKTTIFLVEQNANLALKTAHRGYVMENGAITLADSCENL
FT                   LENEAVRKAYLGM"
FT   gene            356426..357070
FT                   /locus_tag="Spirs_0348"
FT   CDS_pept        356426..357070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0348"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="COGs: COG2905 signal-transduction protein containing
FT                   cAMP-binding and CBS domains; InterPro IPR000644; KEGG:
FT                   cag:Cagg_2623 CBS domain containing protein; PFAM: CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein; SPTR: CBS domain containing protein; PFAM: CBS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79504"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAX4"
FT                   /protein_id="ADK79504.1"
FT                   /translation="MTVSRVMTHNPFTISDDTAVADAMALIHKEKVHRLPVLDKERKLV
FT                   GIVSEKDLLYASPSPASTLSVYEMSALLARLKVKKVMTKEVITVTEQTLIEDAARIMVD
FT                   KNVGGLPVMRDGLLVGIITESDIFKLFSELFGTRKRGLRVTALVPEQRGEIAGMAAAIS
FT                   EKGGNIISFGTFLGEDVSNSLCTFKVDEIGKEELQKAIAPYVVRIIDLREV"
FT   gene            complement(357048..359081)
FT                   /locus_tag="Spirs_0349"
FT   CDS_pept        complement(357048..359081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0349"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterProIPR001638:IPR003594:IPR011495:IPR005467:IPR 000014;
FT                   KEGG: dsa:Desal_2320 signal transduction histidine kinase,
FT                   nitrogen specific, NtrB; PFAM: extracellular solute-binding
FT                   protein family 3; histidine kinase
FT                   dimerisation/phosphoacceptor; ATP-binding region ATPase
FT                   domain protein; SMART: extracellular solute-binding protein
FT                   family 3; ATP-binding region ATPase domain protein; SPTR:
FT                   Sensor protein; TIGRFAM: PAS sensor protein; PFAM:
FT                   Histidine kinase; Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; Bacterial extracellular solute-binding
FT                   proteins, family 3; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79505"
FT                   /db_xref="GOA:E1RAX5"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAX5"
FT                   /protein_id="ADK79505.1"
FT                   /translation="MCNFVARIMLTVLVSAFFFFTPLPLFSDHSQAFTQPLIARGDYDY
FT                   PPFEYLDKKGHPTGFNIDLLNAIAEEMNLSVVIDLGLWSQVRNELTAGEVDLITGMYQT
FT                   EARQKVFDFSSPHNVVSHALYVKRGSSIQTLDELKGCVVYVESGDVMHDYLRERIPEAF
FT                   IVKVKSYRDALVALNSDLQVDAVLTSRIQGERIREEEKLNNIITVGPPFYPRKYCFAVQ
FT                   KGNSNLLAVLNDGITILRENGTYDRLYEKWFGKIIPGMSNTVSRRMILIVVIAIAVGGV
FT                   ITFTWIWSLKRSVRQKTAQLKKELTERKRMEWRFRSVFEGVPVSIWEEDISTIRERIRM
FT                   LREEGISDFSVYVNEHPEIIDWMVQNIKIVDVNPATLAMHNATSKEQLIGSFAKVETRH
FT                   IKNFLRTEFLAIAEGQEYIRAETKSVTFSGEEKIFLTTIFIPRTGSGAYSHMLVSMVDI
FT                   TEIKKTEKKLAKSLEEKEVLLKELHHRVKNNMQMMSSLINLQSRSVEDRALSQVIRVSE
FT                   NRIRAMALVHELLYQTDDFTSIELGFYLRSLVRNLMDSFRDEHKGNIRFDFSGSEINVT
FT                   IDTAIPCGLIVNELVSNSLEHAFPNGRTGTIKLKTLATGGFIMIEISDDGCGIAEGPRK
FT                   KKTMGLDIVQALVQQLRGTIDRVSFKGGGTKHTLRIRPHEDQ"
FT   sig_peptide     complement(359001..359081)
FT                   /locus_tag="Spirs_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(359331..360053)
FT                   /locus_tag="Spirs_0350"
FT   CDS_pept        complement(359331..360053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0350"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1126 ABC-type polar amino acid transport
FT                   system ATPase component; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: sbn:Sbal195_0984 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79506"
FT                   /db_xref="GOA:E1RAX6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAX6"
FT                   /protein_id="ADK79506.1"
FT                   /translation="MIKIVNLHKSFGHLKVLRGINEEIKPGEVVSVIGPSGSGKSTFLR
FT                   CINLLEEPTEGDIYIEGEKINDPGSDVNKLRRKVGMVFQQFNLFPHKDVMENICLAPVK
FT                   LGLTSKQEAEKKARDLLLAVGLPDKDHVYPAQLSGGQKQRVAIARALAMNPDVMLFDEP
FT                   TSALDPEMVGEVLDVMKHLAEDGMTMVVVTHEMGFAREVSDRVLFMDEGIIMEKRPPAE
FT                   LFDNPQNERTKLFLSKVL"
FT   gene            complement(360046..360723)
FT                   /locus_tag="Spirs_0351"
FT   CDS_pept        complement(360046..360723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0351"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="COGs: COG0765 ABC-type amino acid transport system
FT                   permease component; InterPro IPR000515:IPR010065; KEGG:
FT                   spl:Spea_3398 polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Polar amino acid
FT                   ABC transporter, inner membrane subunit; TIGRFAM: polar
FT                   amino acid ABC transporter, inner membrane subunit; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component; TIGRFAM: amine acid ABC transporter, permease
FT                   protein, 3-TM region, His/Glu/Gln/Arg/opine family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79507"
FT                   /db_xref="GOA:E1RAX7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAX7"
FT                   /protein_id="ADK79507.1"
FT                   /translation="MESIRRTLFQTLWEGGPDGLHLLLNGLKVTIVVTLFAITAGVILG
FT                   TLLALMRLSKNKVANIISKLYVEIIRGTPVLVQLLIIYFVIFRALDVDKTMASSLAFGI
FT                   NSGAYVAEIIRAGIQAVDKGQMEAARSLGLPHRLAMKEIILPQAIKNILPALGNEFIVL
FT                   LKETSIIGFIGGNDLMRAGNKIRSITYEATVPLFATAVIYLIITLSLSHLLNRYERRLH
FT                   SSD"
FT   gene            complement(360736..361485)
FT                   /locus_tag="Spirs_0352"
FT   CDS_pept        complement(360736..361485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0352"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="COGs: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain; InterPro
FT                   IPR001320:IPR001638:IPR018313; KEGG: slo:Shew_3166
FT                   extracellular solute-binding protein; PFAM: extracellular
FT                   solute-binding protein family 3; SMART: extracellular
FT                   solute-binding protein family 3; ionotropic glutamate
FT                   receptor; SPTR: Extracellular solute-binding protein,
FT                   family 3; PFAM: Bacterial extracellular solute-binding
FT                   proteins, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79508"
FT                   /db_xref="GOA:E1RAX8"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAX8"
FT                   /protein_id="ADK79508.1"
FT                   /translation="MKRIATLLTAIALVALLSVLSGCQEKNELVMGTNAAFPPFEYIGG
FT                   ADGNAVVGFDVEIAKAIAEKAGKTLRIEDMEFDSLLTALNADKIDFAIAGMTITDEREK
FT                   SVDFSDPYYEATQAVIVRKADNPISTKDDLNGKKISVQLGTTGNEIAKEFTDDSNIVAF
FT                   NTGFEAIMELKNGKVDAMIIDEQPAQNFIRQNSDLEIVSLDFDPEYYGIAVKEGKSSEE
FT                   LLPIINETLKELKANGTYDKLLSEYMK"
FT   sig_peptide     complement(361420..361485)
FT                   /locus_tag="Spirs_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            361643..362152
FT                   /locus_tag="Spirs_0353"
FT   CDS_pept        361643..362152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0353"
FT                   /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /note="COGs: COG1905 NADH:ubiquinone oxidoreductase 24 kD
FT                   subunit; InterPro IPR002023; KEGG: dma:DMR_07850 putative
FT                   NAD-reducing hydrogenase subunit; PFAM: NADH dehydrogenase
FT                   (ubiquinone) 24 kDa subunit; SPTR: Putative NAD-reducing
FT                   hydrogenase subunit; PFAM: Respiratory-chain NADH
FT                   dehydrogenase 24 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79509"
FT                   /db_xref="GOA:E1RAX9"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAX9"
FT                   /protein_id="ADK79509.1"
FT                   /translation="MNALTGDRTEAASFGVVCRILDLYDRDPGMIIPILQKVQEEYRYL
FT                   PEEVLLFLATSLEISPARLYGIATFYSHFSLEPKGKHVIKVCDGTACHVKGSGALIETL
FT                   RSMLALEKGIKTTSDMLFTLETVSCLGACGLAPVVVIDDTVHGQMTPDKVRALITKIRE
FT                   EEDAEA"
FT   gene            362139..364037
FT                   /locus_tag="Spirs_0354"
FT   CDS_pept        362139..364037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0354"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.5.11"
FT                   /note="COGs: COG1894 NADH:ubiquinone oxidoreductase
FT                   NADH-binding (51 kD) subunit;
FT                   InterProIPR011538:IPR019554:IPR019575:IPR001450:IPR
FT                   017896:IPR017900:IPR001949; KEGG: dma:DMR_07840 putative
FT                   NAD-reducing hydrogenase subunit; PFAM: Respiratory-chain
FT                   NADH dehydrogenase domain 51 kDa subunit; Soluble ligand
FT                   binding domain; NADH ubiquinone oxidoreductase, F subunit,
FT                   iron sulphur binding; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; PRIAM: NADH dehydrogenase (quinone); SPTR:
FT                   NADH dehydrogenase (Quinone); PFAM: NADH-ubiquinone
FT                   oxidoreductase-F iron-sulfur binding region; 4Fe-4S binding
FT                   domain; Respiratory-chain NADH dehydrogenase 24 Kd subunit;
FT                   Respiratory-chain NADH dehydrogenase 51 Kd subunit; SLBB
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79510"
FT                   /db_xref="GOA:E1RAY0"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAY0"
FT                   /protein_id="ADK79510.1"
FT                   /translation="MLKLNLEAVGTAYDHTVSSLRMRIIICAGTGCLAGGSLNIFHAFK
FT                   AEAQKHGVPLHVELKQEDNPEFLLSKSGCQGFCQVGPLVTIEPAGILYTKVTAEDVPEI
FT                   FETTILSGKTVERLLYVNPADGKRCSGPSDIPFYVRQSRSVLASCGLIDPENIREYIYG
FT                   GGYRAAMEAYTAHTPEELCTIFTDSGLRGRGGGGFPSGKKWALTLRQQADKKYLICNGD
FT                   EGDPGAFMDRSILEGNPHSVVEGMMIAARAIGAEAGYVYVRAEYPLAVERIRKAIDAAR
FT                   ELGLLGEDLFGTGACFDIKVMEGAGAFVCGEASAMVASIMGGRGMPRPKPPRTAEKGLW
FT                   DKPTVVNNVETLATVPLVLRKGSKGYRTVGTSGSPGTKTFALTGHVANTGLIEVPFGTT
FT                   LREIIFEIGGGVLDEKGNVDNDAFKAVQIGGPSGGCLTREHLDIPLDFDSLGGIGAMVG
FT                   SGGLVVMNRSTCMVQVARFFMQFTQAESCGKCVPCREGTRQMLDLLDDIIEGRADESTI
FT                   PLLESLCRTVARGSLCGLGKAAPSPVLSTLRYFRQEYESHVVDKRCPVGACKALSDFVI
FT                   DESLCKGCTACAKACPVGAISGEKKAPHTIDTERCIRCGACMATCRFGAIRRGGAA"
FT   gene            364034..366049
FT                   /locus_tag="Spirs_0355"
FT   CDS_pept        364034..366049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0355"
FT                   /product="hydrogenase, Fe-only"
FT                   /note="COGs: COG4624 Iron only hydrogenase large subunit
FT                   C-terminal domain;
FT                   InterProIPR001041:IPR019574:IPR001450:IPR004108:IPR
FT                   003149:IPR017896:IPR017900:IPR000283:IPR013352; KEGG:
FT                   dma:DMR_07830 putative Fe hydrogenase; PFAM: hydrogenase
FT                   large subunit domain protein; NADH:ubiquinone
FT                   oxidoreductase, subunit G, iron-sulphur binding;
FT                   ferredoxin; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; iron hydrogenase small subunit; SPTR: Putative Fe
FT                   hydrogenase; TIGRFAM: hydrogenase, Fe-only; PFAM: Iron only
FT                   hydrogenase large subunit, C-terminal domain;
FT                   NADH-ubiquinone oxidoreductase-G iron-sulfur binding
FT                   region; Iron hydrogenase small subunit; Respiratory-chain
FT                   NADH dehydrogenase 24 Kd subunit; TIGRFAM: hydrogenases,
FT                   Fe-only"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79511"
FT                   /db_xref="GOA:E1RAY1"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAY1"
FT                   /protein_id="ADK79511.1"
FT                   /translation="MKGYIKVDGIEVPLEGEENLLQVIRKAGIEIPTFCYHSELSVYGA
FT                   CRLCIVDIEGKGIQASCSTPPRGGMVVRTNTAEVRETRRMTLELLLANHDRECPTCERS
FT                   SDCVLRDLASRYGIDKVRFRKNREPRPLDTLSDALVRDPNKCVLCGDCVRYCHEIQGIG
FT                   AIDFAFRGEHVQVTPAFGRSIGEVDCINCGQCAAVCPTGAIIPKSEINEVWNDLQDEKS
FT                   KVVIQIAPAVRVALGEMFGLPPGEVVTGKMVRALRMMGFDRIYDTAFAADLTVVEEAAE
FT                   FLKRSEAGEGPLFTSCCPAWVKYAEQSLPRQLPNLSSCMSPQSMMGSLLRHALPEELSI
FT                   EPEHLKIVSVMPCTAKKFEKKRPELSRDGLPFVDHVITTRELGTMIRESGIMLDRLDAD
FT                   NFDLPFGFASHLGVGFGSSGGVAEAVLNYLDPEGCSGRIHWETVEDLSGVRKTTAVIGG
FT                   KAFSVAVVQGIKSAAAIAKMVQSGEISLDLIEVMACPGGCAGGAGQPVDRTGEKRLARV
FT                   KAVRSAAPAEGVRHAGVNPFVREVYTHMLGCDPGEGEAHRLFHTTYHSRKRIDGMDIRL
FT                   TGPSGAEARTDRIPVKVCVGTSCFLRGSQKVLSKLLHAVEEEKLDRFYEVQATFCSEQC
FT                   DKGPTVHIGDRVINRADGDQIVELLREMVATLSAEG"
FT   gene            complement(366096..367490)
FT                   /locus_tag="Spirs_0356"
FT   CDS_pept        complement(366096..367490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0356"
FT                   /product="putative metal dependent phosphohydrolase"
FT                   /note="KEGG: bhy:BHWA1_02074 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79512"
FT                   /db_xref="GOA:E1RAY2"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAY2"
FT                   /protein_id="ADK79512.1"
FT                   /translation="MQQNSMPLSEIIVRDKRMVSLLYEQEIPLICRRISDGKLKKVSFR
FT                   ALYDNNEVFWKQDKGWAFYVSEEHVQAMIDMLKELDGKKEKHYIAEHEAEAKNVGDLLN
FT                   FGEAYESIASMDSEKRVSLIKQDREKLDTLLIEAPKENEKILEALADTARDAALANRST
FT                   ILEAIHMGDEAARAYTQGIVDSTRAMVKSSTALIDNTIMQDELITSLVQRSNGTVVQHM
FT                   TRVFLNGVAFLTYYNRRMLTSSLPNKIRINFDKQYKSYYQRLLPHLHPEDITLERVFHT
FT                   GMQAISEAQLHTFATGFLIHDIGKAKDIEYHEGEAAYDRDTVVDHVRQGYLAVMHKTNY
FT                   PREAGLITGYHHEYYGSPDGYGFYRALLANARKNNPKLKQDYCMSFTMEPMIKFNALAY
FT                   FPAKVMEIVDVFDALTDPNRKYRKPLSSDEALDFMQRQFIDEELKLDPILFDLFRTFTK
FT                   GKQPAS"
FT   gene            367569..369443
FT                   /locus_tag="Spirs_0357"
FT   CDS_pept        367569..369443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dan:Dana_GF16459 GF16459 gene product from
FT                   transcript GF16459-RA; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79513"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAY3"
FT                   /protein_id="ADK79513.1"
FT                   /translation="MMNSMKTNVKRVVAASFRRAFGLDGRPPLGAGALPVIPRQEAGEE
FT                   ERRSCTFLNQLADALVDGNFEQGSMLSHRWSDAAGYAFEEAGKALDLFYGSLSDSETSS
FT                   LIAAFDQHQRADAATAVAEFWAPEIKGEKQEAVKHWRLRSAEPNPKPIKASEILLQLNG
FT                   LYTLPETIPDELPDELKDAGKRLLAHPGAKVADYDHPVPLFQDDESHELVSCLARLEDD
FT                   IAYEKSIGLLPVHHKVPILLSVSVTHEHLDEVVCAWIAYLLGKRLYHHFRLYLLTEERC
FT                   RYIDRKLFGGGMPQFGVAGAYGRHFTALKYSSLLFERGWGIRASFKLDTDEGILSRNLK
FT                   EATGKSWFETLCHPLWGAQAVDPKGQTVYLGVNEGEYVNSNDIDTLGYPEALRTPDVKL
FT                   PASHAGRDLFFQKGFAHGNATAWYNEFDDLEELISHPVVKGGGYGITNDGIRQAAPFTW
FT                   SKVGRAEDQQFYFSALSGGVRGIFHPNLRIAHYKNAVSGAEHKTESTRLAGDMYRLVQF
FT                   SFLAEYFGVKEELDPMPGVFASRLARAQAFFHLIHRAAAFLMEGKGDHASFLLSEGLRS
FT                   LADFEKLIDSGKALEEIEKERALWRQFINTTDTLSAGVVREVIDSCEV"
FT   sig_peptide     367569..367634
FT                   /locus_tag="Spirs_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(369553..370485)
FT                   /locus_tag="Spirs_0358"
FT   CDS_pept        complement(369553..370485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dat:HRM2_32580 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79514"
FT                   /db_xref="InterPro:IPR025641"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAY4"
FT                   /protein_id="ADK79514.1"
FT                   /translation="MPKKKMIQFAAVAVLLLLIIVTKFTGNRASFAPVAPWEEEADRIE
FT                   INAPGKDPIVAVKKADGWLIGDKEYSADEGKITRMTDALNSLKVGQMVSREGELERYEL
FT                   EDADAITVAVYHAKDLLRSIRIGKEADKGSGCYITLAGREGIYLVEGALRSIFDVSLDE
FT                   LRNRQIFSFTSSDIISVGVTSAEARFSLRKSGEEQEAWQFSEAQQERVDQNKITDFISQ
FT                   LARINATAFLSPDTIGSEEEASWSLTFQSEKEEHSLRIYGKVEGNDNAYRCLADTNKEP
FT                   FSINAYKAEQLMKPASWFISEEKPKEEGK"
FT   gene            complement(370478..372568)
FT                   /locus_tag="Spirs_0359"
FT   CDS_pept        complement(370478..372568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0359"
FT                   /product="ABC-type uncharacterized transport system"
FT                   /note="COGs: COG3225 ABC-type uncharacterized transport
FT                   system involved in gliding motility auxiliary component;
FT                   InterPro IPR019196; KEGG: dat:HRM2_32590 predicted ABC-type
FT                   transport system, membrane protein; PFAM: ABC-type
FT                   uncharacterised transport system; SPTR: Predicted ABC-type
FT                   transport system, membrane protein; PFAM: ABC-type
FT                   uncharacterized transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79515"
FT                   /db_xref="GOA:E1RAY5"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAY5"
FT                   /protein_id="ADK79515.1"
FT                   /translation="MKFKERLQHAKQWLLGDASDLFFYLLIIVLANIAASQLYIRSDLT
FT                   KGDVYSLSPISKELVQGIDAPLTIKVFFSHDLPAPYNSVERYLKDILEEYDRVGGKDFT
FT                   VGYYDMDDAESKSSASDYGIAPVQIQEIKSDQFQSRSAYLGLAVIYGDSIEVIDQITNS
FT                   SGLEYRLTTTMQKMVAAVDALHGITGKPLLTLYLSKSLGAFGIKGFDDLEQNVRDAVKQ
FT                   LPPSIRDRIDFRVEDPDAGDIKELSDRYGIQTIRWRASTDQNGKQLPAGNGALDLLLSY
FT                   GDKSRLIPIGLSQRLFSGYAISGVDNLATRIEETMRALLSNNPAVAYLTGHGELSLADQ
FT                   QQGAAPLQQLLSDMYELKEVKTGEDGNLTIPDNVSTLIINGPKTEISENERYTIDQFLL
FT                   RGGNLVLFLDPYQVNQPTAYGQPPSYTPIETGLEEQLSAYGIDYKRGYVLDDEAYSQRD
FT                   PQYGDIKIYWAPLLSGKSLSKESTITQNLGEMITLQSGTFIIPNETENSDDITTKVILS
FT                   SSQKSWLMDKNIMLNPMGMVPPGDEKLQSYPLAVSLEGSFSSAFPAPPKEETTEEEKQA
FT                   LDTASQIKTSIAKGRIAVAATSLLTTPQLLDPSSSNSNAAFVHNLVDWSTGNDQVIPMR
FT                   TKGLGRHKLLPTSPEVRNVIKGIAMGLIPLLVIFAGLFVWRLQRSRRRAIEERFSGGEH
FT                   HA"
FT   gene            complement(372572..373267)
FT                   /locus_tag="Spirs_0360"
FT   CDS_pept        complement(372572..373267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0360"
FT                   /product="ABC-type transport system, membrane protein"
FT                   /note="KEGG: dat:HRM2_32600 predicted ABC-type transport
FT                   system, membrane protein; SPTR: Predicted ABC-type
FT                   transport system, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79516"
FT                   /db_xref="GOA:E1RAY6"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAY6"
FT                   /protein_id="ADK79516.1"
FT                   /translation="MISMTKRELYSLFGGPIAYIVIALFLLFSGMLFFPTFFIYDQAEM
FT                   RGFFQLLPILFSFFVPAITMRSFAEERSTGTFEALVSFPVSSGKIVLSKFFAAVIFIAV
FT                   MLAPTLLYVVLISLVGDPDPGPIIGGYVGALLLGAAYAAVGLFASSMTSNQIVAFIVTA
FT                   AIALLFTFFDQMLVLVPAALVNTLEFLGTQYHFRTIARGLLDSRSLIYLISLTAVFLLF
FT                   TVKAVRERR"
FT   gene            complement(373260..374195)
FT                   /locus_tag="Spirs_0361"
FT   CDS_pept        complement(373260..374195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0361"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003593:IPR003439; KEGG:
FT                   dol:Dole_2070 ABC transporter-related protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter-related protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79517"
FT                   /db_xref="GOA:E1RAY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAY7"
FT                   /protein_id="ADK79517.1"
FT                   /translation="MITLSSVSKDYGSFRAVDNLSLEIKEGEITGLLGPNGAGKTTTMR
FT                   MITGYFRPSSGTVSVNGIDVSKDPETIRSIIGYLPESPPLYGEMLTYDYLRYVTGVRKI
FT                   TDETAIRRTAEICGITGVMHKRIDQLSKGYKQRVGLAQAIIHDPKILILDEPTTGLDPN
FT                   QIIEVRNLITEIGKTKTVILSTHILQEVEAIANRVVIINKGAIVKDDHTDNLRAVKNGH
FT                   YTVRLALSGTDTTKATEFFSTLPGILEAHQVPGEEGLITILVTAGTEEDVRPALFHTVT
FT                   QKGWTLFEMSREKQSLEAIFRELTTGGDHD"
FT   gene            374324..375214
FT                   /locus_tag="Spirs_0362"
FT   CDS_pept        374324..375214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0362"
FT                   /product="protein of unknown function DUF89"
FT                   /note="COGs: COG1578 conserved hypothetical protein;
FT                   InterPro IPR002791:IPR014444; KEGG: dol:Dole_1580
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF89; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF89"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79518"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR014444"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAY8"
FT                   /protein_id="ADK79518.1"
FT                   /translation="MRSYLDCFGCFMDQGLDVARRSGADEAQQRLILNEIARMFPSFDL
FT                   ETRPPVMSLNINQTIRNMTGVADPYADEKKRCNELALKAVGLVRDNIAAASDSLKRAME
FT                   YAIAGNSIDFGVNHHLDIDETLTDLINGEESKLASQSDSTFMLEAFRKELSNARSLLFI
FT                   SDNAGEIVFDMLLIEAIAALYPDISITVAVRDEPIINDATLEDAKAIGLNNVCEVISSG
FT                   SPAPGTPLDLCSDEFLERFFSSDMVVAKGQGNYETLNDAPRMIYLLFRVKCRVISHHCG
FT                   GAMGDIMLIPSQSIG"
FT   gene            375253..376419
FT                   /locus_tag="Spirs_0363"
FT   CDS_pept        375253..376419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0363"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="COGs: COG1454 Alcohol dehydrogenase class IV;
FT                   InterPro IPR001670:IPR018211; KEGG: mhu:Mhun_0171
FT                   iron-containing alcohol dehydrogenase; PFAM:
FT                   iron-containing alcohol dehydrogenase; SPTR: Probable
FT                   iron-containing alcohol dehydrogenase; PFAM:
FT                   Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79519"
FT                   /db_xref="GOA:E1RAY9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAY9"
FT                   /protein_id="ADK79519.1"
FT                   /translation="MEEHVSSLRKFVAPEFIFGPSALKKCAEYVKNFGAERILLVSDDG
FT                   VAKAGWTGKVEAALKEAGVVYELFLDVSPNPRADEVMKGADYYSRAKCDMLLSVGGGSP
FT                   IDCAKGIGIVVSNHRHILDFEGVDNVPIPMPPLLCIPTTAGSSADVSQFAIILDADTSS
FT                   KIAIVSKGVVPDISLIDPETTHTMDQALSAETGLDALTHAIEAYVSNAASAMTDMHALE
FT                   AIRYICRYLPTVIQKPQDSHARAGVMMGSLLAGLAFSNASLGLVHSMAHALGGVFDLPH
FT                   GLCNALLLEHVIAFNFEAVPDRYRVIASLLTGKALSTESQNMVLELLTGALVRLRRRVH
FT                   LGETFGVLKVDATMIRMLSERAMSDVCMVTNPRPVKREDIEGIYGCIF"
FT   gene            376403..377239
FT                   /locus_tag="Spirs_0364"
FT   CDS_pept        376403..377239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0364"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterPro IPR003594:IPR011495:IPR005467; KEGG: rci:RCIX1290
FT                   signal transduction histidine kinase; PFAM: histidine
FT                   kinase dimerisation/phosphoacceptor; ATP-binding region
FT                   ATPase domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; SPTR: Predicted signal transduction
FT                   histidine kinase; PFAM: Histidine kinase; Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79520"
FT                   /db_xref="GOA:E1RAZ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAZ0"
FT                   /protein_id="ADK79520.1"
FT                   /translation="MAASSEPYSDGNIDLVRSKIIGLGDRSIRKSYYPQLRETIRDLRE
FT                   QREHLMELVRLLEEREEELEQLLDEKDKLLREVHHRVKNNFQIVASLLNLGMDMLSDGD
FT                   EHEIFYRTKQRIDTMARVYEEILRREEFSEVDLCDLIRLVTEQYEEARRGKQVELSLDL
FT                   DCPGRMLDLDLAVPFALIVNEVVGNAFEHAFPGGAGLLYLRLYRSGSEGDKEGILTFEL
FT                   TDNGPSFAKRGTNSEAKRLGIALLKALVAQIGGAFSYEDQETGLGIQFILRLKRPT"
FT   gene            377436..378983
FT                   /locus_tag="Spirs_0365"
FT   CDS_pept        377436..378983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0365"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG0488 ATPase components of ABC transporter
FT                   with duplicated ATPase domains; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: glo:Glov_0246 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79521"
FT                   /db_xref="GOA:E1RAZ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAZ1"
FT                   /protein_id="ADK79521.1"
FT                   /translation="MVFNQLQISALSFSWPGMVEPLFTDLSFSIGAGWTGLVGANGSGK
FT                   STILSIITGENQPDSGSVKAPSRMLLCRQDTARLPDQADSFFYAFDERSEEIMRRLDIQ
FT                   YEWFFRWDSLSFGERKRVQIGTALYTAPDLLALDEPTNHLDEVSRDRLLSALADYEGIG
FT                   IIVSHDRYLLDCLCERTLFLRNGTVVLRPGGITVGLEEAAREAEEAKRALRTAQSRMHS
FT                   LQRDLERRRGVAREQQKRRSKAGLPIKDHDARFKKNLARLTGKDGTGGKLLRQLDGTLA
FT                   AASRTEETAKARLDDATMRKASGLTLGGELSGKDRLFMFGPDELQVGNRQLSYPELELR
FT                   PGERVAITGANGNGKSTLIHLLVEHFFLPNQDERFPWFYRNAVFLPQELSEADRRLCAD
FT                   LVASLDPSERGMLISAVHRLGSEVEGVLHSSLLSPGEARKVIIARASLMETEVLILDEP
FT                   TNHLDIESILLLEDALKKFSGALLLVSHDRRFREALTDREWKIYQEAPGRLVLSDEP"
FT   gene            complement(378980..380527)
FT                   /locus_tag="Spirs_0366"
FT   CDS_pept        complement(378980..380527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0366"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR003660:IPR004089:IPR004090:IPR013163; KEGG:
FT                   afw:Anae109_2874 methyl-accepting chemotaxis sensory
FT                   transducer; PFAM: chemotaxis sensory transducer; Cache type
FT                   2 domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SPTR: Methyl-accepting
FT                   chemotaxis sensory transducer with Cache sensor; PFAM:
FT                   Cache domain; HAMP domain; Methyl-accepting chemotaxis
FT                   protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79522"
FT                   /db_xref="GOA:E1RAZ2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAZ2"
FT                   /protein_id="ADK79522.1"
FT                   /translation="MKKQSFAWKLIIIVSTLLLISLLISDILFIRTFRTSIYQEKRESL
FT                   TRLVDAAMGIINYAAEKETSGALSREDAQDMAKELLAHFTYGKDRMDYFWINNMQQIMV
FT                   MHPYRPELDGTDISGLKDPTGVPIFQKMVDVVNQSGKGFVEYSWQYYNEKGRIEPKLSY
FT                   VADFKPWGWIIGTGIYIDDIEKTIIAIATRIAGVTIIFLLVAIIFIYLISRAMAGPLVR
FT                   FATIAKDIAEGDLLVDVPTLKRNDELGTLASALGQMVEQVGNIILEVQEAAAQVRIGSD
FT                   QVNYSAQDLSRGTTEQASSMEEISSSIEEMVANMRQTAKNAKATDSIAQKAATSAGESG
FT                   KAVGKTVEAMNAIAEKVSLIEEIARQTNMLSLNAAIEAARAGESGKGFAVVAAEVRKLA
FT                   ERSRYAANQIGELIESSVRIAEQAGTAIDDLVPEIMNTSKLVREISAATEEQENSASQI
FT                   GKGVEQLDRIVQDNAAASEELAASAEELSAQAEQMHAATDYFQVDRNDAIEEEQEED"
FT   gene            380648..380971
FT                   /locus_tag="Spirs_0367"
FT   CDS_pept        380648..380971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0367"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ptm:GSPATT00001744001 hypothetical protein;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79523"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAZ3"
FT                   /protein_id="ADK79523.1"
FT                   /translation="MVFSPPIQDGDSIEVGQDELIEALTDYDFDPLEEVLEEIREDFEV
FT                   DAGQLDEYVEALREEPEILDAVSHYIADDFIEEEDLDYDYYLRRFTDDLIVYLFQQWRP
FT                   EEE"
FT   gene            complement(380916..381818)
FT                   /locus_tag="Spirs_0368"
FT   CDS_pept        complement(380916..381818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0368"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterPro IPR003594:IPR011495:IPR005467; KEGG: mbn:Mboo_1812
FT                   signal transduction histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase
FT                   dimerisation/phosphoacceptor; SMART: ATP-binding region
FT                   ATPase domain protein; SPTR: Signal Transduction Histidine
FT                   Kinase; PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79524"
FT                   /db_xref="GOA:E1RAZ4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAZ4"
FT                   /protein_id="ADK79524.1"
FT                   /translation="MKLHRGPVVISVIYFCFGFLWILVSDTIVTTVAPHPEVYRHMQTW
FT                   KGWIYVVITTILIYILLSIYAQRKDRALEELRMRQRDIAEGLEEKNELIRELHHRVKNN
FT                   LQLVLSMIRLTDAGDRGKSADLLPHLAGRVFAISAIQESIFAGEQYAQVSVGRFIQDIL
FT                   HFLCSLSGNSGCPEFLLEMEEKDTLSIQQAVPFGIIFEELVSNALRHAFLPEEGGTITI
FT                   RLEICADIMKLTVADNGKGWDTEAIQEGVGLSIAREMAKQISGTLLIEPSDKGTYATLT
FT                   LSTLLRASTAEKDRQSDHR"
FT   gene            complement(381815..382933)
FT                   /locus_tag="Spirs_0369"
FT   CDS_pept        complement(381815..382933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0369"
FT                   /product="peptidase M29 aminopeptidase II"
FT                   /note="COGs: COG2309 Leucyl aminopeptidase (aminopeptidase
FT                   T); InterPro IPR000787; KEGG: cpf:CPF_0868 metalloprotease;
FT                   PFAM: peptidase M29 aminopeptidase II; SPTR: Peptidase M29
FT                   aminopeptidase II; PFAM: Thermophilic metalloprotease
FT                   (M29)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79525"
FT                   /db_xref="GOA:E1RAZ5"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAZ5"
FT                   /protein_id="ADK79525.1"
FT                   /translation="MKDFRLEKLASLLVNYSTKVKPGDFVFIMGQEVAIPWIKAVTREV
FT                   LRVGGHPESLITSDEIEEEILKISTIEQLRENNFLMEQMMGKADVFLFGWGNSNVKGFS
FT                   NIDPMRIQERQKGNKAWRKLYSGRTGTGDLRWCGTQFPTIADAQEAAMSLSEYEDFVYA
FT                   AGLLDSEDPSARWEKINEEQNRWVRYLEGKKELYFRTTDTDLKVRVDGRRWISCAGTEN
FT                   FPDGEIFSTPLINGVDGHVRFTFPAIYKQRSVEDVRLEIKEGKIVKAHAAKGEDFLHSA
FT                   LDTDEGSRYFGEIAIGTNYGIKQFTSNTLFDEKIGGTFHMAAGDAPKETGGENESVIHW
FT                   DMICDMRQGGEITADGECFYKDGAFITEVLKE"
FT   gene            383074..384642
FT                   /locus_tag="Spirs_0370"
FT   CDS_pept        383074..384642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0370"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro
FT                   IPR000160:IPR013656:IPR000014; KEGG: dae:Dtox_1677
FT                   diguanylate cyclase with PAS/PAC sensor; PFAM: GGDEF domain
FT                   containing protein; PAS fold-4 domain protein; PRIAM:
FT                   Diguanylate kinase; SMART: GGDEF domain containing protein;
FT                   SPTR: Diguanylate cyclase with PAS/PAC sensor; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: GGDEF
FT                   domain; PAS fold; TIGRFAM: PAS domain S-box; diguanylate
FT                   cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79526"
FT                   /db_xref="GOA:E1RAZ6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAZ6"
FT                   /protein_id="ADK79526.1"
FT                   /translation="MRIGIISILLFLSSTILLSLTVPAWSHRDRALGKSFIALCLSIAI
FT                   YNLGYGMELASTNLTTLIVWSKFQYLGIPFIPTFFFLFAANYTGIRDRIPLPLVFYLVG
FT                   FPCITMVLHLTQEHHNLMYINPTIHRVWNLSFLAFDKGLWYKISRWHVAIIISAGAILF
FT                   LRFFLRSVAVFRRQSVLILIGALFPWAGWLVYMLDILPSGFDPTPFALFLASLFLATAL
FT                   LRYRLFDVSPIAKEQVFESIDTGVLVLDSEKRLVDYNHAAYLVFPALKKEMKGVHGEDL
FT                   FKNITSGNRLFEESDSGDVSVDIQIASDDSLRHYWARRSSIRTPKGRVLGSLILLDDIT
FT                   NRVRLLEKMETLASKDPLTGISNRRHLSSFGEKEVMRAFHYGTNLALIMFDLDLFKKVN
FT                   DTYGHDVGDQLLIHIVEIARGLVREADLLGRYGGEEFVILLPQTSLSDAQLIAERIRSS
FT                   IEISPLALESGTSIPMTASFGVTSSLGSSDFSFESLCKKADEALYRAKAEGRNQVVTFL
FT                   ETDNE"
FT   sig_peptide     383074..383151
FT                   /locus_tag="Spirs_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            384879..386042
FT                   /locus_tag="Spirs_0371"
FT   CDS_pept        384879..386042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0371"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG0738 Fucose permease; InterPro IPR011701;
FT                   KEGG: hau:Haur_1480 major facilitator transporter; PFAM:
FT                   major facilitator superfamily MFS_1; SPTR: Transporter,
FT                   major facilitator family; PFAM: Major Facilitator
FT                   Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79527"
FT                   /db_xref="GOA:E1RAZ7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAZ7"
FT                   /protein_id="ADK79527.1"
FT                   /translation="MITTHTKNRLLLFLTFIAFVSLGLPDGLLGVAWPSIASQFARPLS
FT                   RLALLQLAATCGFFFSSTNAGRLIERLGVGRLLIASNVMVFIALSGFSFADRWPLIVGS
FT                   MVVLGMGGGAVDAGLNAYSASRFTKEQITLMHAFYGLGAMIGPVIMRRVLHLHAPWQRG
FT                   YLITLSMIALLLLLFIVSQKMWNGGVSLSSDADKAGESEVPGRIKNIGMLLFFVYTGVE
FT                   VTTGGWSFTWLTKGRGVTPETAAFWVGIYWGALMVGRLFFGFLGQRWHTRTILSRMVLV
FT                   VAAGCLLFLQPWSSFISLVALPVIGFSCAPLFPLFVSYTPTVVGQADASRQIGRQVACA
FT                   SIGSAVVPLLVGLGVEITALGAIPVMLLFFALILVILYNRWVAGLAE"
FT   sig_peptide     384879..384947
FT                   /locus_tag="Spirs_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            386070..386849
FT                   /locus_tag="Spirs_0372"
FT   CDS_pept        386070..386849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0372"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="COGs: COG0708 Exonuclease III; InterPro
FT                   IPR005135:IPR004808:IPR020847:IPR000097; KEGG:
FT                   str:Sterm_0377 exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; PRIAM: DNA-(apurinic
FT                   or apyrimidinic site) lyase; SPTR: Exodeoxyribonuclease III
FT                   Xth; TIGRFAM: exodeoxyribonuclease III Xth;
FT                   exodeoxyribonuclease III; PFAM:
FT                   Endonuclease/Exonuclease/phosphatase family; TIGRFAM:
FT                   exodeoxyribonuclease III; exodeoxyribonuclease III (xth)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79528"
FT                   /db_xref="GOA:E1RAZ8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAZ8"
FT                   /protein_id="ADK79528.1"
FT                   /translation="MLKTMETRIASWNVNGIRAAQKKGLLEYMMQEHADVVCLQETKAK
FT                   PEQLDEQLLNPSDYRSYFSSAERGGYSGVAVYSRKKPLSVSPLGIAEFDAEGRALLVEF
FT                   SDFVLINGYFPNSQSEGARLDYKLAYCDAILKRCNSLVGEGRHVVVCGDYNIAHKPIDL
FT                   ARPKENEGNPGFLPEERAWMSSFLDAGYTDTFRIFNNEGGNYTWWSYRTKGRERNVGWR
FT                   LDYFCTDKEFENRVKNSEIRSEVMGSDHCPVVLTIAE"
FT   gene            387259..388287
FT                   /locus_tag="Spirs_0373"
FT   CDS_pept        387259..388287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0373"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683; KEGG: rlg:Rleg_4943 oxidoreductase
FT                   domain protein; PFAM: oxidoreductase domain protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Oxidoreductase
FT                   family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79529"
FT                   /db_xref="GOA:E1RAZ9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAZ9"
FT                   /protein_id="ADK79529.1"
FT                   /translation="MTINPLRWGIIGAGTWGKTHADIVSHHLLADLVAIADLDPQRAER
FT                   LASEHGVAAYGDYREMLEKEELDAVSIVTPDFAHAEPFIACCEAGKHVLLEKPLATNHK
FT                   DLARMKEAHAKSGIRCMVDYHNRWNPPIALAYQDIQEGKIGDIVSMYYRLNDTIFVPTE
FT                   MLKWSEQSSILWFLGSHSVDTLRFFCGSEVDTVYALSRSMVLKKRGIDIPDIYQTIMTF
FT                   KNGVVATMENGWITPNTHPHWNDIKVNVTGTKGMFNMDLTNNQSIERYLEDASDHPDTV
FT                   IKPILHGKPTGFSYESIIDFIEKIYYEKPFLVDFQDAYNVSKVILSIFESVKEHKIVTV
FT                   EY"
FT   gene            388303..389667
FT                   /locus_tag="Spirs_0374"
FT   CDS_pept        388303..389667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0374"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   ara:Arad_9887 sugar ABC transporter; PFAM: extracellular
FT                   solute-binding protein family 1; SPTR: Extracellular
FT                   solute-binding protein; PFAM: Bacterial extracellular
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79530"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB00"
FT                   /protein_id="ADK79530.1"
FT                   /translation="MKRSNVWKKIVLLCFLLIFAATGTIFAGGSSETLTESDDPYINAV
FT                   REKLQGTTITIASMSHTSSNAMREMVDEFTAETGIKVRWDIMEEGLLREKILMDHHAGT
FT                   GTYDVLFLDAFNLSQYSAVDVMIDLKPLINDSALTPSWFDYEDILPAYRDGVGSYGGVA
FT                   YGIPVAGESRFLAYRKDLFDKYGKTPPATTDELLETAKFFNEEVDGVYGIAMRAQKGIH
FT                   FASGWMTLMYSMGGQFLDQKTWDVLVDSPATVDSLKYYVELMQQGPPDISVYTHEEAIS
FT                   AFMAGKTAMWIDATAIASWILDPSKSTITDKVEFAPLPAGPAGAYAPLAGWSAGISSDV
FT                   SDTQKEAAWAFIVWMTGKKHSLEYVHNGGVIVRESLLTNGELVAKDKSLPAQLLTMKEA
FT                   ANLVKDGIIWIPPHPKAIKVLEIVGNYGNDVLSGISTPEKAMEKAQTEVEMIMNE"
FT   sig_peptide     388303..388383
FT                   /locus_tag="Spirs_0374"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            389731..390612
FT                   /locus_tag="Spirs_0375"
FT   CDS_pept        389731..390612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0375"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG:
FT                   rec:RHECIAT_PC0000130 probable sugar ABC transporter,
FT                   permease protein; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Transport protein;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79531"
FT                   /db_xref="GOA:E1RB01"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB01"
FT                   /protein_id="ADK79531.1"
FT                   /translation="MMLFKQREYLKYLLPALIVLALINIFPTFFLYIISLTNYDISQRV
FT                   EDLSFVGLENYRYLFSIDKDFWKSIYITLTYTFVSVTVELVLGSAIALLFDANTRFRKL
FT                   KLSLFIIPMIATPSIIALMWKLILNAEYGVLNTFLRWMGCAGRNWLSTDFALVSLILID
FT                   IWQWTPYVTLMIYSGLQTVPQEPLEAADVDGASWFQKLVWIVLPHISTIVSITLLLKLI
FT                   ENLKSFDIVYNLTQGGPGNATELLSLHVFRLGFKQTHWLGRASACAVILLLIIIPIVSN
FT                   LAKKISYSRESA"
FT   gene            390609..391421
FT                   /locus_tag="Spirs_0376"
FT   CDS_pept        390609..391421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0376"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG: pmo:Pmob_0307
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Transport protein;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79532"
FT                   /db_xref="GOA:E1RB02"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB02"
FT                   /protein_id="ADK79532.1"
FT                   /translation="MKRKTSPIIPVVTWIIILAALAPVLWMLLISFKQRVDIISFSVLF
FT                   KPTLENYKTVFQKYDFLRFILNSTIVVVATTAISVFLGTLAAYGLARFQFKKKESLAFG
FT                   ILSLRMLPPMAVVIPFFIMARYTHLLDTQLLLIIVYLGFNIPFTIWMMRGFIEDVSLSI
FT                   EESAWLDGCTRLEGFCKVVFPSIFPGLAATSIFCFIQSWNEFALAFFLTSFNSRTVPTI
FT                   VNSFISVLGVLWGEMAAVGVVSILPIVIFTMFVQKYLVKGLTMGAIKG"
FT   gene            complement(391422..392099)
FT                   /locus_tag="Spirs_0377"
FT   CDS_pept        complement(391422..392099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0377"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterPro IPR001789:IPR000792; KEGG: npu:Npun_R2420 two
FT                   component LuxR family transcriptional regulator; PFAM:
FT                   response regulator receiver; regulatory protein LuxR;
FT                   SMART: response regulator receiver; regulatory protein
FT                   LuxR; SPTR: Two component transcriptional regulator, LuxR
FT                   family; PFAM: Response regulator receiver domain; Bacterial
FT                   regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79533"
FT                   /db_xref="GOA:E1RB03"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB03"
FT                   /protein_id="ADK79533.1"
FT                   /translation="MSDRIKLVLADDQTLFRESLSNILKLKAKEFDVVGLAQNGEEAVA
FT                   LAASTAPDIILMDVRMPILDGVEATKIIHERFSDIKIMMLTTFDDDEYILHAIQNGAIG
FT                   YIIKTIPPNELITSIMALKNGIFQMSPSIAGKLARQKVWEQTKTNMLNKEPLPSWFLSL
FT                   RAKERALLLLICQGYTNKEIGNRLYLAEQTVKNYTSRIYEAMEVDNRHAAIKKALDANI
FT                   DQL"
FT   gene            complement(392083..393372)
FT                   /locus_tag="Spirs_0378"
FT   CDS_pept        complement(392083..393372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0378"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG4585 Signal transduction histidine kinase;
FT                   InterPro IPR011712:IPR003594; KEGG: cbh:CLC_1414 sensor
FT                   histidine kinase; PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; SPTR: Sensor histidine kinase; PFAM: Histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79534"
FT                   /db_xref="GOA:E1RB04"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB04"
FT                   /protein_id="ADK79534.1"
FT                   /translation="MTEHQMIHRRIAIKVHSLPYASTIALFLFCNSLLLHFASTLYYGS
FT                   IQSHSASLWVAFRWQFLLLMAVSFCASISQIFFYLQKSSRLLFSELIQFVSLVLIGLPM
FT                   GQDLTIEMILSCALITMIIMTNSQVAWIKVPFILLAFSLFQFKLRFLGYTVEAAKGRIL
FT                   TISEIVLLLVSLIMFFIKDIISNNIELRQKNRQLEETAGLLTNANRSIQEYTLSMEEVS
FT                   AEKERLRMTRELHDIIGYTMVNTTIMMEEAIARYKQKDESALLTLIVKTRDHAKNAHQD
FT                   VRKILLNYRSQQKRKSSFIRDLIKLTETFSLATGISIEVFPSNFPSVLPYHVSYALLRI
FT                   SQEGLTNSLYHGRAKNIVFLLTKSIDSLFLIIRDNGQGSIHYEEGLGISGMRERLRMLK
FT                   GTLTIKAKKDLFELHIEIPYKEGQSDVGSY"
FT   gene            393567..394880
FT                   /locus_tag="Spirs_0379"
FT   CDS_pept        393567..394880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0379"
FT                   /product="amidohydrolase"
FT                   /note="COGs: COG0402 Cytosine deaminase and related
FT                   metal-dependent hydrolase; InterPro IPR006680; KEGG:
FT                   cdf:CD2078 putative amidohydrolase; PFAM: amidohydrolase;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79535"
FT                   /db_xref="GOA:E1RB05"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB05"
FT                   /protein_id="ADK79535.1"
FT                   /translation="MANTVIKGGFLMLEEGIRKAWGVRVEGHTIVQVGPNESLTVSAGD
FT                   KYIDATDKLIAPGFINGHMHMYGVLSHGISADAVVTDFTSFLEDFWWPYVENRIDHRLV
FT                   EITTKWACVEMIKSGITTFMEVLEGPNSVPGALDIEKRVVESAGLRGILSFEACERISP
FT                   ENGQVGLKENIDFARNNNKAGSLVQGMISIHTLFTAGKEYIMQAKKAADELGCGIHMHL
FT                   SESVYEPNWVMEKYGKRPVELYDEWGYLGPHVLASQGVQMSPKEIDILAERGVRVVHMP
FT                   LSNCEVGGGVAPIPRYLEKGVTTGLGTDGYVNNFFEVMRGAFLIHKAYHQDPQVMPAAA
FT                   VYDTATAQGARAMGRDDIGTIKEGALADIITIGLDTPTPINEKNVYDQLILFRNPEDVC
FT                   EVMVNGVLLKEQGKLLTLDEAAIKDELREATETFWTFS"
FT   gene            394899..397403
FT                   /locus_tag="Spirs_0380"
FT   CDS_pept        394899..397403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0380"
FT                   /product="dihydroorotate dehydrogenase family protein"
FT                   /note="COGs: COG0493 NADPH-dependent glutamate synthase
FT                   beta chain and related oxidoreductase;
FT                   InterProIPR000759:IPR012135:IPR013027:IPR001450:IPR
FT                   017896:IPR017900:IPR005720; KEGG: dal:Dalk_2523 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; dihydroorotate oxidase; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; TIGRFAM: dihydroorotate
FT                   dehydrogenase family protein; PFAM: Dihydroorotate
FT                   dehydrogenase; Pyridine nucleotide-disulphide
FT                   oxidoreductase; 4Fe-4S binding domain; TIGRFAM: putative
FT                   selenate reductase, YgfK subunit; dihydroorotate
FT                   dehydrogenase (subfamily 1) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79536"
FT                   /db_xref="GOA:E1RB06"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB06"
FT                   /protein_id="ADK79536.1"
FT                   /translation="MINIKELKGADISCELCGIRMQSPFILSSGPLSYAAEGLIEAHKA
FT                   GAGAVVTKTIRLNAAINPTPHIGIVNEDSLINCEKWADSPPEVWFEREIPMTKAAGAVV
FT                   IASIGHTLPEAEALVKRAEAAGADMIELVSYTEDTLLPMLVATKERVSIPVICKLSGNW
FT                   PDPVGTARKCLEKGADAISAIDSLGPTLKIDIQNARPEMNSADGYGWLSGAAMRPVAMR
FT                   IVSEIARNGCSQLVGIGGIGKAEDAVEYVMAGAQALGICSSLIIHGMDYLNKLCHDLSV
FT                   LLDQLGYASLAKAKGIALPNFPTAERVAKLEFSYEPYYAKCQAACPAGVDVPLYLDMVR
FT                   KGNYVQAYETISVTNPFPGICGRVCDHPCEGSCRRSLFDDPLQIRLIKRLAADKTYESF
FT                   GDKLPLPEMLPKNGKKLAVIGAGPAGLTAAYYLARIGYSVTIFESLPMAGGMLAVGIPE
FT                   FRLPKNILKLEVDRVIRMGVEIRTGITIGRDLSIEELTQQGYERVLIATGAHGDPAVEI
FT                   PGMDKEGVVSGVRFLRDLALGRFTSLSGRKVAVIGGGNAAVDAARSALRIGAASVTLLY
FT                   RREREDMPAYEEEISEAEKEGVRYIFLAGPESIEGNGKAAAFRYTPMSLGEIDESGRRK
FT                   PVPSGAPSQSIDADFVVIATGQRVDTDFLPPLADSSTGKTKSDGIYAAGDCTSETASVI
FT                   EAIAAGRRSAQAIHQSLGGAGSVMETKSQHRSYFIEVTDVGSAKEESPMLPVSERLSGF
FT                   PEVETGLSEDAARREAARCMHCGCINCLRCVAVCPYNARTLDFPIMSVDRELCRNCGAC
FT                   VSVCPTGALTATVVDELAESRI"
FT   gene            397539..397973
FT                   /locus_tag="Spirs_0381"
FT   CDS_pept        397539..397973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tme:Tmel_1130 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79537"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB07"
FT                   /protein_id="ADK79537.1"
FT                   /translation="MKRLPLLFLLMLISVSTLFASKELDAKVGDFFQALKQEKYEEGIT
FT                   NLLAGSLLEEKVVNVTQTRNNWIAQFSQIKSLYGDYLAWDKVSTVSLGGLEETTYFVYC
FT                   RDYPIKIVITEYDNGMDRKIINMFFDDQILDTLRDHGSYF"
FT   sig_peptide     397539..397598
FT                   /locus_tag="Spirs_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(398354..399511)
FT                   /locus_tag="Spirs_0382"
FT   CDS_pept        complement(398354..399511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0382"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="COGs: COG1454 Alcohol dehydrogenase class IV;
FT                   InterPro IPR001670:IPR018211; KEGG: tau:Tola_2293
FT                   iron-containing alcohol dehydrogenase; PFAM:
FT                   iron-containing alcohol dehydrogenase; SPTR:
FT                   Iron-containing alcohol dehydrogenase; PFAM:
FT                   Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79538"
FT                   /db_xref="GOA:E1RB08"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB08"
FT                   /protein_id="ADK79538.1"
FT                   /translation="MAVMNYSVPRTIVYGEKALDKLGELEGKKAMLVTGGSSMKRFGFL
FT                   DQAKNILEKAGMKTAVIDGVEPNPSVKTVKEGAEAMIAFQPDWIVAIGGGSALDAAKVM
FT                   WCFYEHPELTFEDIVTPLTMPKLRTKAHFAAIPSTSGTASEITAFSVITDTDNHIKYPL
FT                   VSPEMVPDIAILDPALPAKMPAHITANTGMDVMAHATEALVSTASTSFTDPYALEAITL
FT                   VAEWLPKAYKNGNDMEARYHMHNASTLAGMAFTNASLGLVHSLAHKIGGEFGVTHGLAN
FT                   AILMPWIIEFNKKSTDKYALAEKALKVDNLENEIRRLNRVLDIPASFASCNEVDFNEEK
FT                   FKAVLDRMSENAYNDPCTLTNPGAPSIADIKAIYQAAYYGEWKKA"
FT   gene            complement(399697..400305)
FT                   /locus_tag="Spirs_0383"
FT   CDS_pept        complement(399697..400305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0383"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647; KEGG: mxa:MXAN_2869 TetR family
FT                   transcriptional regulator; PFAM: regulatory protein TetR;
FT                   SPTR: Transcriptional regulator, TetR family; PFAM:
FT                   Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79539"
FT                   /db_xref="GOA:E1RB09"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB09"
FT                   /protein_id="ADK79539.1"
FT                   /translation="MKTQQDTRAENEEQIILATIECIETFGIHGATIRRIAQRAGVNSA
FT                   AISYYFRSKEHLLQVAMERTLENAFDLNDFSDSVGKPVQERLTHIFSFLIEGALKFPGI
FT                   SRAHFYEPFIEGNYETPGVEHINAFLSALETEILASSNSYTQQEVRTKLVYLTSATMIY
FT                   PGLMPKLLEPFSNVKLSDKATRDAYVENLIWTLFPASQP"
FT   gene            complement(400305..401180)
FT                   /locus_tag="Spirs_0384"
FT   CDS_pept        complement(400305..401180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0384"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR002347:IPR002198; KEGG:
FT                   dge:Dgeo_1140 short-chain dehydrogenase/reductase SDR;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   Short-chain dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79540"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB10"
FT                   /protein_id="ADK79540.1"
FT                   /translation="MNKTAVITGATSGIGLATAQALAQQGWYIIGIGRSEERCAQAKAA
FT                   IEKAGASGCEFSVTDLSSLTQVKKAAKEIMLMMAQNGDRGALDVLINNAGTFSNWFIQT
FT                   EDGIELQFAVNYLAHFLLTLALLPALSKASEPRIISVSSASHRHTHLRWNDIQLRKHYS
FT                   GLRAYKQTKLANVLFSAEFNRRYAARTGIQAFVADPGLVRTEIGLKSSGGLAKLVWRVR
FT                   MAQGRPPREGAETSVFLATDPTVYNSGQLYWRNNMPLAPDPLALNQTAAERLWQISERM
FT                   CGIEQEKEPD"
FT   sig_peptide     complement(401112..401180)
FT                   /locus_tag="Spirs_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            401310..402113
FT                   /locus_tag="Spirs_0385"
FT   CDS_pept        401310..402113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0385"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro IPR002347:IPR002198;
FT                   KEGG: cts:Ctha_1171 short-chain dehydrogenase/reductase
FT                   SDR; PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   Short-chain dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79541"
FT                   /db_xref="GOA:E1RB11"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB11"
FT                   /protein_id="ADK79541.1"
FT                   /translation="MISVFLTGATGGLGKAFAVECACRGWNLFLTDRQTASLRILAESL
FT                   QRQFSCSVEYYPCDLTDTRSREELYHYIKGEGLQFNMLINVAGLDYEGPFLERSGSEVR
FT                   NLLRLNIESSLETTAELFRLREEGKPFRIITVASLAAFYPMPIKAMYAASKRFLLNFFV
FT                   AFREEIRDAGGSVTILCPAGMPTRPDLIDSIESQGIMGRITTRNVGMVASKTIDSALRN
FT                   RLIYIPGRINNVLRSLGLLMPMQLVAAVIGSRWKNRRAKRNMAFL"
FT   sig_peptide     401310..401363
FT                   /locus_tag="Spirs_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(402146..403263)
FT                   /pseudo
FT                   /locus_tag="Spirs_0386"
FT   gene            403843..404571
FT                   /locus_tag="Spirs_0387"
FT   CDS_pept        403843..404571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfh:PFHG_04377 conserved hypothetical protein;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79542"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB12"
FT                   /protein_id="ADK79542.1"
FT                   /translation="MPIVNRDNISKLTCGIRYEKTFRISDIAGSLFDTVLHHRSSPFGT
FT                   EFFPRYQELNSQDRALINSERGYYFRITTSDVIFQYTLHPEKQDLSDEIEWFKNDASQF
FT                   IINEILEKNSIKNIMRFGFMITHEIDGENLGGNVLDQLTNGEIRNADQFTFRFGNKDTT
FT                   KEALIRRDVNDYINKITTIKQITESKYEVTLDFQYYFSPELTSIKDWNTESFYTKAFYS
FT                   LDNSFYDMINPLVSKLVETV"
FT   gene            404568..405002
FT                   /locus_tag="Spirs_0388"
FT   CDS_pept        404568..405002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0388"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgu:100220912 similar to coiled-coil domain
FT                   containing 88A; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79543"
FT                   /db_xref="GOA:E1RB13"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB13"
FT                   /protein_id="ADK79543.1"
FT                   /translation="MSDPRKSHVSKSRWEKEQYVNMLKSQHAEDPTFEFHETESTNSVV
FT                   VDEAGSSSIARPELKNYEPDNKRLNKEILYGIIVFGITSLLFLFGMSLNREIGVLDERT
FT                   NTTKDSIETVEINVKQMNEQMKEMAIEQEVIKRIFETTAK"
FT   gene            405193..405876
FT                   /locus_tag="Spirs_0389"
FT   CDS_pept        405193..405876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0389"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH282 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79544"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB14"
FT                   /protein_id="ADK79544.1"
FT                   /translation="MIEAILNKKIRQNKRYWEDVIFSSVFGMLKYLNKGILYDVLKNAK
FT                   TLNEKENKFYYLKDQLNFIDSDNINYEFWKHLQLKDCKRCEPDLIIEGPNSIVCIEAKY
FT                   KSGKSSKKDNSNVPNDQLAKEYDNLSYYKGKKQLYLIYLTSSLRYPIEDIKESIDEYNN
FT                   KRKLPITIYWLNWNKIYCQLDKCRHNKRIIDDICLVLEYFYLDYFTHFKISSDKEYKRI
FT                   DWRFR"
FT   gene            405873..406436
FT                   /locus_tag="Spirs_0390"
FT   CDS_pept        405873..406436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcb:PC000842.02.0 structural maintenance of
FT                   chromosome protein; SPTR: Putative uncharacterized protein
FT                   PY06369"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79545"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB15"
FT                   /protein_id="ADK79545.1"
FT                   /translation="MNDVIGIVENIEQMKSILMSLKKMTKYIINDFEEKNWELLEEKYI
FT                   SDCMPNKRKANYEEQFDLLFSMPTELFHVFKYRSRNKKFFPFINIFLNSINNINQPVVI
FT                   YGKFIPKDKVKKDKYWEEFQYDASKLILNNAIEKTSGGIILVDDLTEEEKNEFYYIKKI
FT                   EYRIINLFEVDNEILSKLIKEITT"
FT   gene            406636..408267
FT                   /locus_tag="Spirs_0391"
FT   CDS_pept        406636..408267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0391"
FT                   /product="putative transcriptional regulator"
FT                   /note="InterPro IPR000055:IPR007421; KEGG: mac:MA3410
FT                   hypothetical protein; PFAM: AAA-4 family protein;
FT                   restriction modification system DNA specificity domain;
FT                   SPTR: Type I restriction-modification system M subunit;
FT                   PFAM: Divergent AAA domain; Type I restriction modification
FT                   DNA specificity domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79546"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB16"
FT                   /protein_id="ADK79546.1"
FT                   /translation="MEIIEKFIDEITAHLDIKKFLHINMEMSNQYHFHNSINENNYDYI
FT                   LKNNIYSFEKDELSRNYDLIFGVLPFGIKDFKQYQKYKIPVNYDVIINTLEKLEKNGLG
FT                   IYTVEPSFFWSTRGKVFIDLLEEKSYFINFCIEAPKGIIPYTNIRPYLIGLSKEKTELF
FT                   IGSLNELNNVSVLIDNYFNNKSSNNIDFGKLVDINDFTSISNEEVKKEEQILLQHYKNV
FT                   EFKVVKDIIKSITPVKDSEDFSNSENEIYITKQGNLPSKINHKNFSNLLKIDVNHNLIN
FT                   PKYLEIYFRSSLGQISLKSIQLGSSIPYIRRTDLLKIKIPVPPLIEQSDIVEVNEKLNE
FT                   LKERIASLENEFSLNLSSSKFISEKIETTLNQISHDSINDRIIHCLKTGENKNIEYKES
FT                   FSLNVKEKEKNPRKDKAIELSALKTIVGFLNSNGGYLLIGVDDNATIFGIEDELKMLFK
FT                   NNNDSYLLYIKDKIKNKIGVEFFQYINYQITDFNGTKLLFIEVDKSPLPCCYEKKDFYL
FT                   RLNPATEKLEGKELIEYIFRRFQNET"
FT   gene            408462..409388
FT                   /locus_tag="Spirs_0392"
FT   CDS_pept        408462..409388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0392"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfh:PFHG_03053 conserved hypothetical protein;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79547"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB17"
FT                   /protein_id="ADK79547.1"
FT                   /translation="MKTIELFFRNLSEKKYKESDFSDIIASLCNASESFTRIFIDYLFD
FT                   NKYHEVKGLSVYREFTSEDKKSTIDFKIEDENGCIVCLIENKINDKDDHFEKYMKSFRN
FT                   EIGFIANYKIENKKDHYKYSKTWPGFYKYIEEKLDNFNDCDRLLINGFRKYIQGVCGIM
FT                   NDIEKFNLSDIGSLEDLHSYLRSLVQQKDGCKINTNKKSITEYRHGIDFEYKNTELWFG
FT                   VYTASYSKNLHIGFKAESNINLTEKFKKALLEEGEYYVQPYYEENGNECWFELKDEYYE
FT                   TLVNDKVPTKLKLEIIKNFFDEALSLI"
FT   gene            410187..410729
FT                   /locus_tag="Spirs_0393"
FT   CDS_pept        410187..410729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0393"
FT                   /product="Domain of unknown function DUF1863"
FT                   /note="InterPro IPR015032; KEGG: sun:SUN_2116 hypothetical
FT                   protein; PFAM: Domain of unknown function DUF1863; SPTR:
FT                   Putative uncharacterized protein; PFAM: MTH538 TIR-like
FT                   domain (DUF1863)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79548"
FT                   /db_xref="InterPro:IPR015032"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB18"
FT                   /protein_id="ADK79548.1"
FT                   /translation="MSRHRVFISYHHLNDQQYKNQLEGIFRSSYEVALSNSVQIGDLNP
FT                   NLPSDRLRQLIRDKYIRDATVTIVLIGTETWKRRHVDWEIGSSIRKTEYNSRCGLIGLL
FT                   LPTRSDYYRDSFYPYTIPPRLYLNAKNGYAKIYNWTTNFMNLKYWIDEAFDRRNVIIPD
FT                   NSFPNFVNNRSGDRWYE"
FT   gene            410722..411363
FT                   /locus_tag="Spirs_0394"
FT   CDS_pept        410722..411363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_1164 hypothetical protein; SPTR:
FT                   Conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79549"
FT                   /db_xref="GOA:E1RB19"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB19"
FT                   /protein_id="ADK79549.1"
FT                   /translation="MNEVKLMLIEIVGDELRIDISLTTLLILIVTIILITILLKKQKNK
FT                   GAIFKKTVPVKMQYSIGGQTIEYEILRSYRNIEIAHRVFIEIMTRKAGQPFDHENDVIV
FT                   EIYNSWYEMFSLIRNEIKDIPGNLIKGNETTKNLVSLLMDVLNKGLRPHLTSYQAKYRK
FT                   WWLSHEKEEISPQELQKKYPEYEEQVSSIREVNMMLVKYCEQLKKIIYDK"
FT   gene            411620..411874
FT                   /locus_tag="Spirs_0395"
FT   CDS_pept        411620..411874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gfo:GFO_0860 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79550"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB20"
FT                   /protein_id="ADK79550.1"
FT                   /translation="MNKKLTLSVDDSIIEKAKAYAEDKNESLSQLVENYFRLLTADRRA
FT                   KEKEISPLVNDLMGTITVPEDFDYKTAKLEYLESRYLND"
FT   gene            411867..412292
FT                   /locus_tag="Spirs_0396"
FT   CDS_pept        411867..412292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0396"
FT                   /product="PilT domain-containing protein"
FT                   /note="KEGG: gfo:GFO_3473 PilT domain-containing protein;
FT                   SPTR: PIN domain containing protein; PFAM: PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79551"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB21"
FT                   /protein_id="ADK79551.1"
FT                   /translation="MIKLFIDSDIVLDLLIKRNEFESSAILFTQIDRKEFQGFTSPIVF
FT                   ANVHYIMTKYAGKEKSILNLRRIRKILSLLTINEEVIDEALYSDAPDLEDSIQYIASEK
FT                   NGIDFIITRNKKDYKGSKIPALSATEFLEMNIGNEEI"
FT   gene            412660..413004
FT                   /locus_tag="Spirs_0397"
FT   CDS_pept        412660..413004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0397"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="InterPro IPR002934; KEGG: rca:Rcas_3922 DNA
FT                   polymerase beta subunit; PFAM: DNA polymerase beta domain
FT                   protein region; SPTR: DNA polymerase beta domain protein
FT                   region; PFAM: Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79552"
FT                   /db_xref="GOA:E1RB22"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB22"
FT                   /protein_id="ADK79552.1"
FT                   /translation="MSTVSSIEYLTETVESLKTLNPLKVVLFGSTARGETHEWSDLDIL
FT                   VVLDEDKVPQSYEEKMKLKLVVRKAIREQSYKVPIDLLVYTRPEYDALKAQNSSFIREI
FT                   SSEGKTLYER"
FT   gene            412994..413389
FT                   /locus_tag="Spirs_0398"
FT   CDS_pept        412994..413389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0398"
FT                   /product="HEPN domain protein"
FT                   /note="COGs: COG2250 conserved hypothetical protein related
FT                   to C-terminal domain of eukaryotic chaperone SACSIN;
FT                   InterPro IPR007842; KEGG: csc:Csac_0790 HEPN
FT                   domain-containing protein; PFAM: HEPN domain protein;
FT                   SMART: HEPN domain protein; SPTR: HEPN domain protein;
FT                   PFAM: HEPN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79553"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB23"
FT                   /protein_id="ADK79553.1"
FT                   /translation="MKDKVKEWVKYADLDYKSALKLNEDEYLTSSAAFHCQQAVEKYLK
FT                   ALIENLDMDVPRVHTLLVLMNIVMENYKIDFDRDVLDQINEVYIDTRYPSSTGLIPDGI
FT                   PQKGTITLFLSFVEDIKIKVEKLLKTN"
FT   gene            414087..414989
FT                   /locus_tag="Spirs_0399"
FT   CDS_pept        414087..414989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0399"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecb:100063761 Fanconi anemia, complementation
FT                   group M; SPTR: Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79554"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB24"
FT                   /protein_id="ADK79554.1"
FT                   /translation="MKTVIFSKPLSAQWSEYSKNYKKYKETTLQYFKRKNRNILTNPLL
FT                   TPERRQIDTFCLDLWAADANKKLLHLYFVDRSLYEFLENVKLPDLNGIIEYIKDNGFSS
FT                   KQKILLPNGKPLTVSEEETSYYSFGIHIPNVSKESGYAFSFMMNKNKEIALIWVIGRDR
FT                   GWCPIKKYKDLLKEESKNSKEIVKIIQFAVNTVAYMNTFPGCVIDGVPEIIKKQPFYND
FT                   NSLYVDISDKIVDYSENTNIGKKVSPHFRRGYFKRLTAERYTKMRGKLIFVHETMVNGK
FT                   AKTIYTSDELEKMEQIDGT"
FT   gene            415134..416135
FT                   /locus_tag="Spirs_0400"
FT   CDS_pept        415134..416135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pvx:PVX_100940 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79555"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB25"
FT                   /protein_id="ADK79555.1"
FT                   /translation="MRFNYYFIFNNNSYVKTANPQKDIWDYFLKISDVPFLKRTWPETK
FT                   IETIKKVSTHIKQAYEYYISSRNVTLLTKPVLIYYSLHNLTKAFIELRGNEDDLNYHGL
FT                   CNCEIGETILETKAYANDGVFQSLAKCFNYEFDKKEELLITDFIYNTVEGNKLLVDYYG
FT                   LNSNFINVRWKGNYEGTVELELINWKNITDSYDNLSEIIINNTKLLNDFELFEENEKVC
FT                   LRSKEKQQGSEMNKLANSLANKYCVYKINEEEPNWINIMKSDKKFCPSLGYYGISYILS
FT                   SVVRYNPEAVEKYIKIPETSNEFFINKLLEYCERILPNLYINKITNMNLIYG"
FT   gene            416400..417358
FT                   /pseudo
FT                   /locus_tag="Spirs_0401"
FT   gene            417622..418287
FT                   /locus_tag="Spirs_0402"
FT   CDS_pept        417622..418287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0402"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dat:HRM2_19130 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79556"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB26"
FT                   /protein_id="ADK79556.1"
FT                   /translation="MGEMALGYGSEFHLLRWIGRHRNLFDNKINELLKINDINWLDFNF
FT                   NKNKSIPDDELKGFEFVPLNSIVRDTFKKEWPQSGNVMNWDLVGYSKKTSTWILCEAKA
FT                   HIGELKSKCGASEGSKKQIIDALNKTKEYLKISKENNWTEPYYQYANRLYSVCLLKRLN
FT                   FNAILLKIYFIGDMVQKNVRNSPQNIIEWDTAINEMNNIMGLNEELDFVKHLYLNTFE"
FT   gene            418563..419750
FT                   /locus_tag="Spirs_0403"
FT   CDS_pept        418563..419750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0403"
FT                   /product="ATPase"
FT                   /note="COGs: COG1373 ATPase (AAA+ superfamily); InterPro
FT                   IPR011579; KEGG: hya:HY04AAS1_1358 ATPase; PFAM: ATPase;
FT                   SPTR: ATPase; PFAM: Archaeal ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79557"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB27"
FT                   /protein_id="ADK79557.1"
FT                   /translation="MIEALSQYNPWWSGEIPLEGIIPREKYLKKLVSYLDNEQIIFLTG
FT                   LRRIGKTTLMKLVIKELIENKGINPNHILYVSLDDYVFKENSILDILEEYRKLHRISVD
FT                   DKVYLFLDEIIYQKDYYQQLKTIFDRQNTKIYATSSSSIKLKDTKAFLTGRSYLVEINP
FT                   LDYKEYLYFKNIKIPLKDLKLNEPYFQDYLKSGGIPYYVLKEEREFLIGLVDDIIYKDI
FT                   ISEHGIKNPQIIKDYFLLLMERSGKQLSINKIANILKISVDSSKKYLSYFNDTFLIRLL
FT                   SRYGTTNEKLLSPKKIYCSDLGIKFSFTGLRDLGSYFENYIYLQLKQNDVYYLYENGIE
FT                   IDFYVRDIDTLIELKYNSKMNEKQERLFEDFNASNKMVIDSVYSLEDLNELNLKF"
FT   gene            419997..420905
FT                   /locus_tag="Spirs_0404"
FT   CDS_pept        419997..420905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0404"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce8483 hypothetical protein; SPTR:
FT                   Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79558"
FT                   /db_xref="GOA:E1RB28"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB28"
FT                   /protein_id="ADK79558.1"
FT                   /translation="MKQLKIQSRKRYKQGFHLDAIELERIYSIIKEQMSKIELGDNEKI
FT                   FNSFHIKYKNGVRKVTNELEEVVAEENFGTFLIERIEINSYISSKDEELADYRQIYMDD
FT                   DEEGISIIFEKEIGKSFFNDNNISLIINGKERDWVMVTESLINDRINLIKRNKLEILTK
FT                   PSLSFLFVIITFSLMISMFVTLYNYIAPSAYIDEIEQKWISGVITDPVEVIIKLEKEKY
FT                   AKEFGVSVISYIPAIIGGSIAVLLLIIKVVVKKLYPVCVFYWGDYIKYFDKIDGIRKTI
FT                   VTVIIIGFLISLAAGLIVKYI"
FT   gene            421116..421517
FT                   /locus_tag="Spirs_0405"
FT   CDS_pept        421116..421517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmw:Mmwyl1_2728 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79559"
FT                   /db_xref="GOA:E1RB29"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB29"
FT                   /protein_id="ADK79559.1"
FT                   /translation="MNLIHNDIIWWQISLFQLMNAWFPGISAFLLGMLFNKIIEKNKLK
FT                   QSLKNTLLEIFIPIFNVGKEISKELAIKTKDQLRNTLNTYSQIYPSLFKKEKIKELNDI
FT                   LKLDLIEKSGKLNEYFNNPTRIIKLIESL"
FT   gene            421534..422013
FT                   /locus_tag="Spirs_0406"
FT   CDS_pept        421534..422013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDBDRAFT_0218381 hypothetical protein;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79560"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB30"
FT                   /protein_id="ADK79560.1"
FT                   /translation="MKNNNKQNNKEDGENNFKIIERELELSHSFLRVEQFFNPKRIPFE
FT                   FVFTNPFSTTCCYFTIKISSIYFKDLVSDSEELMFTKIKSENNQILVFQSTKEKKIHKN
FT                   EPVNFKAYAILRSDSFYRGTFNKESAIKDQRHWMQLSIFDDIGEISCRIVREISE"
FT   gene            422207..422860
FT                   /locus_tag="Spirs_0407"
FT   CDS_pept        422207..422860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR000126; KEGG: fsu:Fisuc_1304
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: Trypsin"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79561"
FT                   /db_xref="GOA:E1RB31"
FT                   /db_xref="InterPro:IPR000126"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB31"
FT                   /protein_id="ADK79561.1"
FT                   /translation="MYEGIPRVVMPLGRVGPNGVNLLGTCFLLPNRGWFATASHVTEND
FT                   DRNLVVLIPEEESLSNYQDTTKKDVKMINAKIIKTDPIHDTTIIEINADVNSTIKIGSL
FT                   DSVSVNENVVLFGYPHANHGRKVLTSQTTTIGAKILLDNSGIKSKHAVVNIQTKPGQSG
FT                   SPVFSIRNSSIVGILIGSYAPQKSGGISIGGIDPQTLHQTSHMVSAEYILRMIK"
FT   gene            422857..423276
FT                   /locus_tag="Spirs_0408"
FT   CDS_pept        422857..423276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: drm:Dred_3028 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79562"
FT                   /db_xref="GOA:E1RB32"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB32"
FT                   /protein_id="ADK79562.1"
FT                   /translation="MSYNNLEIFNEEELFNTLEDYQKEIINEIGYSEKDSEEIAEIWLN
FT                   ASTSNTVAFGTRTGKKIFYENIKKEVIRFICDENSYVNERQKLFSKSDITHAFFINILT
FT                   TAIAPVVGTSATFLTPVIVLFLISVGNVTKNAFCL"
FT   gene            423337..424455
FT                   /pseudo
FT                   /locus_tag="Spirs_0409"
FT   gene            424835..425089
FT                   /locus_tag="Spirs_0410"
FT   CDS_pept        424835..425089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gfo:GFO_0860 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79563"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB33"
FT                   /protein_id="ADK79563.1"
FT                   /translation="MNKKLTLSVNDSIIEKAKAYAEDKNESLSQLVENYFRLLTANRRN
FT                   KEKEISPLVNEIMGTITVPENFDYKRAKLEYLETRYLND"
FT   gene            425082..425507
FT                   /locus_tag="Spirs_0411"
FT   CDS_pept        425082..425507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0411"
FT                   /product="PilT domain-containing protein"
FT                   /note="KEGG: gfo:GFO_3473 PilT domain-containing protein;
FT                   SPTR: PIN domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79564"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB34"
FT                   /protein_id="ADK79564.1"
FT                   /translation="MIKLFIDSDIVLDLLIKRNEFESSAILFTQIDRKEFQGFTSPIVF
FT                   ANVHSIMTKYAGKEESILNLRRIRKILSLLTINEEVIDEALYSDAPGFEDSIQYIASEK
FT                   NGIDFIITRNKKDYKGSKIPALTATEFLEMNIGNEEI"
FT   gene            425788..426738
FT                   /pseudo
FT                   /locus_tag="Spirs_0412"
FT   gene            426951..427907
FT                   /locus_tag="Spirs_0413"
FT   CDS_pept        426951..427907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ljf:FI9785_910 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79565"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB35"
FT                   /protein_id="ADK79565.1"
FT                   /translation="MRMESASSARSTIVPITRKAYRANFYLDPIDGQVNNATYSLRNIY
FT                   YHPLKKTISPDGSQKSHAGSLSLFRAFSRTAWLKTFRADAFEYTVGDTSIRLLWNPTPL
FT                   HNAKTQLTYTFSDQNYIDIHISIECYGYYPDYELVFSNYLAEGFNNTVLVRDFQDGVRQ
FT                   AAVHLSPVFKDTFVFFPRDEQSIHTMTDGRHFKGHWYWNCSYGREYAVPLVASMDKNLE
FT                   VVLMGLEKDVHAVGATYSTEDGYSDDVLEHHAQYLRLFGEDFTPGMGRQTYIRCFFSQS
FT                   LETIRDYQALYADFEKDYKKTARRFELPPTSPHYETE"
FT   gene            427961..428539
FT                   /locus_tag="Spirs_0414"
FT   CDS_pept        427961..428539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0414"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1670 Acetyltransferase including
FT                   N-acetylase of ribosomal protein; InterPro IPR000182; KEGG:
FT                   str:Sterm_2425 GCN5-related N-acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase; SPTR: GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79566"
FT                   /db_xref="GOA:E1RB36"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB36"
FT                   /protein_id="ADK79566.1"
FT                   /translation="MANMSLIGEKVYLNPTHENDIPFLANFMNDDHIKYFGRNCGSAIY
FT                   ETKMKTHFEENKEDERYTIFRKDNNEIIGDISINSIDIYNRAGSLSVIIYGKENRGKGF
FT                   GKEAILLILKHAFIDLNLENIDLGTWEYNKAAIHVYEKIGFKLIGRRRNRRIVGNSFYD
FT                   EIIMDMISDEYFKLYGNTELEKYKTKTEL"
FT   gene            428689..429248
FT                   /pseudo
FT                   /locus_tag="Spirs_0415"
FT   gene            complement(429322..430680)
FT                   /locus_tag="Spirs_0416"
FT   CDS_pept        complement(429322..430680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0416"
FT                   /product="MATE efflux family protein"
FT                   /note="COGs: COG0534 Na+-driven multidrug efflux pump;
FT                   InterPro IPR002528; KEGG: cdf:CD2108 putative drug/sodium
FT                   antiporter; PFAM: multi antimicrobial extrusion protein
FT                   MatE; SPTR: Putative uncharacterized protein; TIGRFAM: MATE
FT                   efflux family protein; PFAM: MatE; TIGRFAM: putative efflux
FT                   protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79567"
FT                   /db_xref="GOA:E1RB37"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB37"
FT                   /protein_id="ADK79567.1"
FT                   /translation="MAESKIINNYTSGNIWTQLIQFSFPFMLSNALQVLYSLVDMIIVG
FT                   RFVGSAGLSAVSIASQVFMFMVMLCIGFSNGGQVLIAQYVGSNQKEKLNSIIGTLFSIL
FT                   FIIGIFMMVVGLLFSRSILQLLNTPAESYAMAADYILICSIGVLFSFGYNALSAVLRGM
FT                   GDSKHPFIFILIASVTNIFLDLLFIGVFKWQAAGAALATIIGQTVSFIFAVIYLYKRKE
FT                   SFGFDFKLRSFRIDAEARRLLVKLGLPFAVQSCAINISMLFVNALVNSLGVYPSATFGV
FT                   GMKIDDIINKITLGIGFATSTMCAQNIGAKEFGRTKKIVYVTILYQAVCYAFFTLIYLT
FT                   LARELFSIFTNDVHVLDLSRTYVTAIVWSFPGMILMRASNGIIRGVGNARLGLIFGLMD
FT                   AFIFRIGCSWFLGSVCGLGLYGYFLGYSIAVYGTGIPGFIYFLSNKWEKYRLM"
FT   gene            431106..432038
FT                   /locus_tag="Spirs_0417"
FT   CDS_pept        431106..432038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0417"
FT                   /product="protein of unknown function DUF437"
FT                   /note="COGs: COG4405 conserved hypothetical protein;
FT                   InterPro IPR000182:IPR007374; KEGG: cac:CAC1000
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF437; GCN5-related N-acetyltransferase; SPTR:
FT                   Uncharacterized protein, homolog of yhfF B.subtilis; PFAM:
FT                   Acetyltransferase (GNAT) family; ASCH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79568"
FT                   /db_xref="GOA:E1RB38"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB38"
FT                   /protein_id="ADK79568.1"
FT                   /translation="MLKTKQIKNDDVPYELIYLADEDDDQINKYKDTSTFLATMDDEKI
FT                   IGIIGINEINEESTEIVCVAVDEAYQNKRIGTNLIEKAISYSKDKKYKELIIKTGNCGI
FT                   GQLYLYQRCGFRFDSVNKDYMIKNYKNPIYENDIQCFDQIVLKYRIFSEKELTKIIEEY
FT                   WNRFIKKNKEYEKSKYEVWSFGYSENLANKLIGYVKEGKKTGTSSALEMYDIDEKVPEE
FT                   GDISIITYGNGLPGCIIKTEEMRKKKFREITEEEARLEGEGDLSLEYWRNAHEHFFRLE
FT                   YEEQGKKFSEEIPVIFERFKVIYDEDRKI"
FT   gene            432219..433304
FT                   /locus_tag="Spirs_0418"
FT   CDS_pept        432219..433304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0418"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="COGs: COG3177 conserved hypothetical protein;
FT                   InterPro IPR003812; KEGG: gur:Gura_4148 filamentation
FT                   induced by cAMP protein Fic; PFAM: filamentation induced by
FT                   cAMP protein Fic; SPTR: Filamentation induced by cAMP
FT                   protein Fic; PFAM: Fic/DOC family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79569"
FT                   /db_xref="GOA:E1RB39"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR026287"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB39"
FT                   /protein_id="ADK79569.1"
FT                   /translation="MNSSEKRPNNELPLLPPNADIETKKILNQAIRANRELAILKGYCS
FT                   LLPNDSILLSAIILKEAKTSSEIENIVTTQDELYRALATTVKEIDVETKEVLNYRSAIW
FT                   RGFRQLKEKGFLSTNILIELQSELEGNSAGIRKLPGTALVNERTGKAIYIPPDNEEKIL
FT                   ELLKNLEKYINERDEIDPLIKMAVIHYQFESIHPFYDGNGRTGRIVNVLYLILQGLLDK
FT                   PILYLSEYIIKNKSEYYELLQKVRDEKGWEEWIVYMLKAVEITSIETLKLVSSIVELLN
FT                   KTTEVCREKLPKTTYSKELIELLFEQPYTKIEFLVNAGLAERRTASKYLKQLEEIGILE
FT                   SFKSWKERIYVNKRLYEVLKG"
FT   gene            433565..434089
FT                   /locus_tag="Spirs_0419"
FT   CDS_pept        433565..434089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0419"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abn:AB57_2683 hypothetical protein; SPTR:
FT                   Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79570"
FT                   /db_xref="InterPro:IPR027823"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB40"
FT                   /protein_id="ADK79570.1"
FT                   /translation="MKRSISLFFIVPIIVSCVQIPYDPDIDYPDKYEVILELSNMPKNE
FT                   IFLKANKWFISNFSSENSIILISDKEYGYIIGTIFDSFVDVNTFYQMKFDVNIEIKGNR
FT                   VRMTFENPHEKYTGTIYGTISTMMGETDDGNDYKPDFRRMTSNKHLAETNRRWRKNAES
FT                   FNLFMATEDDW"
FT   gene            434186..434419
FT                   /pseudo
FT                   /locus_tag="Spirs_0420"
FT   gene            434814..435121
FT                   /pseudo
FT                   /locus_tag="Spirs_0421"
FT   gene            complement(435427..436113)
FT                   /locus_tag="Spirs_0422"
FT   CDS_pept        complement(435427..436113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0422"
FT                   /product="GntR domain protein"
FT                   /note="COGs: COG2186 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011711; KEGG: pth:PTH_2232 transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH; SPTR:
FT                   Transcriptional regulator; PFAM: Bacterial regulatory
FT                   proteins, gntR family; FCD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79571"
FT                   /db_xref="GOA:E1RB41"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB41"
FT                   /protein_id="ADK79571.1"
FT                   /translation="MQPMPLEKEKLSDLVAERLVQYIEENNLQPGDMLPTEKELAKCFR
FT                   IGRTSVREGISKLKSIGLLHTVQGYGCIINETSISSFLESISTSVLSRFVKLDMQDYRQ
FT                   IMETRALLETYALRTYISSDRITDPQKLYIIVRRMDKALGISDYSLFQELDFDFHRQIV
FT                   HLANNSILSQIYELVKEPFIRRAEAFCPTQDHSRLQEEHRQLLDGIRRKDMAVVQILDN
FT                   HIKCQA"
FT   gene            complement(436135..436983)
FT                   /locus_tag="Spirs_0423"
FT   CDS_pept        complement(436135..436983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0423"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="COGs: COG1737 Transcriptional regulators; InterPro
FT                   IPR000281:IPR001347; KEGG: tma:TM0326 RpiR family
FT                   transcriptional regulator; PFAM: helix-turn-helix protein
FT                   RpiR; sugar isomerase (SIS); SPTR: Uncharacterized HTH-type
FT                   transcriptional regulator TM_0326; PFAM: Helix-turn-helix
FT                   domain, rpiR family; SIS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79572"
FT                   /db_xref="GOA:E1RB42"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB42"
FT                   /protein_id="ADK79572.1"
FT                   /translation="MDIISTIKKKLAFLPPIQKKIGSFVISNPHKAINMSISSLTSASG
FT                   ARSEASVVKFYKALGFSGYHEFKVTLATEIANQGQSPLEQFSTILPSDTIFNIRKKIFQ
FT                   SAIHVLAMNNKDLEDDTFERIVTQIEQSKRIIVIGYGTSAVTAYDLFVKLSRLGFDCHY
FT                   TTDEHTTAIILSNPREKDLLFCFSFSGETKNIVAQASLVKGKIPIICISGEDNSQLAKL
FT                   SDIYLPIQSFETTYRNESIVSRYVQLAAIDIIFSCLAQRAGKDAEKRLMNSRKGLSFLK
FT                   F"
FT   gene            complement(437035..437919)
FT                   /locus_tag="Spirs_0424"
FT   CDS_pept        complement(437035..437919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0424"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="COGs: COG0329 Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase; InterPro
FT                   IPR002220:IPR005829; KEGG: tpe:Tpen_1620
FT                   dihydrodipicolinate synthetase; PFAM: dihydrodipicolinate
FT                   synthetase; SPTR: Dihydrodipicolinate synthase; PFAM:
FT                   Dihydrodipicolinate synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79573"
FT                   /db_xref="GOA:E1RB43"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB43"
FT                   /protein_id="ADK79573.1"
FT                   /translation="MQKKLFSGIIPPLITSFDKQGNIDEKTMRNLTRWLANHVQGFYPC
FT                   GTYGSGPLLTTEERKLVARIVNEEKGNAFAIIHVGAATTTEAIDLAKHAEEIGSDAIGA
FT                   IPPYYYHYTQEQLVDHYKALIDAVKIPVFLYNNPDLSNNPVAPQTLSVLADYGLAGVKD
FT                   SAFDLVSFYNYKLAVTRPDFQFIIGTEAIAAGALDVGACGVIAGLANCFPEFMTDFYKT
FT                   WKAGDPLETGKKQLAVVKARNIIKMAQTLTMIYAILKMRGINPGYPRSPFKDISKETYD
FT                   KARKMIDEQGILA"
FT   gene            438049..438990
FT                   /locus_tag="Spirs_0425"
FT   CDS_pept        438049..438990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0425"
FT                   /product="PfkB domain protein"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR011611:IPR002173; KEGG: amt:Amet_0892
FT                   ribokinase-like domain-containing protein; PFAM: PfkB
FT                   domain protein; SPTR: PfkB domain protein; PFAM: pfkB
FT                   family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79574"
FT                   /db_xref="GOA:E1RB44"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB44"
FT                   /protein_id="ADK79574.1"
FT                   /translation="MGARSVKNILVWGEPMFGFYPIDNPMIEKCNTLSMTWGGDASNFA
FT                   IGVARLDHHSVFFTGLGTEPFGDGFIDLWMKNGVDVSQVVRDPSRRTGFYFVSFINGKH
FT                   NLTYYRENSAATAIQFAQLDQQVLKESAVFHFTGTGLGMGSAARTLCRQIIDAKKGSDC
FT                   IISFDVNYRTLQWNDPILAEREISNAIASGVTHLDITDDEMFALGWGTDLDALIRRFPT
FT                   LEVIAYKQGPKGVTIKTRGSQFDSPAFLVKVKDTVGAGDSFDVGFIISLLEGKSLEEAA
FT                   RIGNATGGLTCTGLGPISSSPTRKELDEFLAT"
FT   gene            439020..439793
FT                   /locus_tag="Spirs_0426"
FT   CDS_pept        439020..439793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0426"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR002347:IPR002198; KEGG:
FT                   ect:ECIAI39_0671 putative short-chain
FT                   dehydrogenase/reductase SDR precursor; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR:
FT                   3-oxoacyl-[acyl-carrier-protein] reductase; PFAM: short
FT                   chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79575"
FT                   /db_xref="GOA:E1RB45"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB45"
FT                   /protein_id="ADK79575.1"
FT                   /translation="MVDDTFMKTCSLQEKVVLITGGGTGIGLGIARCMVLSGATVILIG
FT                   RRLEKLKEACASLGSNAYYYQFDITNWEAHEQFAEKVVETFGKLDILVNNAGNQYKASS
FT                   FKVNLDDMSSTFDVHVKASFAMTRTFLPYMIDRQRGSVIFISSMAGFIGLTNQISYAAA
FT                   KSAIMGLVRTFSSEVSQHGLRFNAIVPGWFETPMMLKAMGNDIKRQEHVLCRTAMHRFG
FT                   QPEDIGWAAVYLGSDASKFVTGTSLVVDGGALSGF"
FT   gene            439877..440884
FT                   /locus_tag="Spirs_0427"
FT   CDS_pept        439877..440884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0427"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="COGs: COG1063 Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenase; InterPro IPR013154:IPR013149;
FT                   KEGG: mjl:Mjls_2811 alcohol dehydrogenase; PFAM: Alcohol
FT                   dehydrogenase GroES domain protein; Alcohol dehydrogenase
FT                   zinc-binding domain protein; SPTR: Alcohol dehydrogenase
FT                   GroES domain protein; PFAM: Alcohol dehydrogenase
FT                   GroES-like domain; Zinc-binding dehydrogenase; TIGRFAM:
FT                   2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79576"
FT                   /db_xref="GOA:E1RB46"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB46"
FT                   /protein_id="ADK79576.1"
FT                   /translation="MICNVLKDKNILVMEERPMLEPRTGQVRIKTVLAGICGSDIHALH
FT                   GMQPSLLFPTVMGHELVGVIDAIAASENEGTFKVGDRVVVDPSFRCGKCDLCLSGKENI
FT                   CEELRVLGVHCDGGFADYFLCEIDMLHKIPDSLRFEEAIFSEPLSIAMHAISRITSTGR
FT                   KKTAIIGAGPIGLALLIALKELFEEVLVFEVLENRKSAARIIGADQVLDSVGDTYPAED
FT                   IDVVFDTVSIPSTVTLTERIVKRGGEVIIVGMAKPEIGFQLLPILKKELSVRGTRMTRR
FT                   EDFKAALDLLTKTDPKLIQAIITGYWSLSDSIKAIRYTETHAGTCIKEVLDFRR"
FT   gene            440891..441829
FT                   /locus_tag="Spirs_0428"
FT   CDS_pept        440891..441829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0428"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="COGs: COG0111 Phosphoglycerate dehydrogenase and
FT                   related dehydrogenase; InterPro IPR006139:IPR006140; KEGG:
FT                   dtu:Dtur_1775 D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; PFAM: D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase catalytic region; SPTR: D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding; PFAM: D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD binding domain;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79577"
FT                   /db_xref="GOA:E1RB47"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB47"
FT                   /protein_id="ADK79577.1"
FT                   /translation="MHNIAIITTAFGNGLPDREHTYAALADELELRIRYCTKEELLADP
FT                   KGIKGVIVGVEKADKELFTCPDLRVAMKFGVGLDNFDMESAGKAHVQVVNMPGINSDAV
FT                   AEMTITLMLCVSRMILPMGQRMSNGQFVQYCSHTVQHKKLGIIGMGTIGRKVAKMATAL
FT                   GMECLGYDVRTFDLEGVNMVDLPTLFEQSDVITIHIPLMSTTHHLIGKEAFSRMKHGVI
FT                   LINTSRGGVVDDEELYERLQNGHIMGAGLDVFENEEIRNRLVTHENVICTPHVAAYTHE
FT                   TLRFMENTALKKIKACLAGEKNHEVSKGGTV"
FT   gene            441826..442845
FT                   /locus_tag="Spirs_0429"
FT   CDS_pept        441826..442845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3181 conserved hypothetical protein;
FT                   InterPro IPR005064; KEGG: cpy:Cphy_0596 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Tripartite
FT                   tricarboxylate transporter family receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79578"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB48"
FT                   /protein_id="ADK79578.1"
FT                   /translation="MRKVCVALLLSTAVLSSVFAAAQAEDSAESYPNRSILMIVPFGPG
FT                   GATDQLARITQKVMEDELGQPFTVQNMAGGGTSIGTQYLMDQTHDGYTVMAAPTDIVSI
FT                   GVMGQSKFTYKDLSYLGIGVSVPAVFLVNPNSNIHTLEELVAAMKAKKLTAGVADAGCA
FT                   WTRATALLCSETGVQLPEFVPSGGGYNAAVAAMKGDVDFACCGFGEAMELIKGDQLRAL
FT                   AYWGSEEFTLSNGTVVPNASKLYPQLQKYDPFGGWVGFAVPADTPKPIQEKLIAAYKTA
FT                   LSDPSFDKFCETQVMFPVKLFGDDAQAYAEMSSRVNAYMLWDLGFAKIDPATLGLERL"
FT   sig_peptide     441826..441897
FT                   /locus_tag="Spirs_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            442888..443364
FT                   /locus_tag="Spirs_0430"
FT   CDS_pept        442888..443364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dtu:Dtur_0299 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79579"
FT                   /db_xref="GOA:E1RB49"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB49"
FT                   /protein_id="ADK79579.1"
FT                   /translation="MFILELIVSAITSLLFLFFLLTSLGMESTGNPLVGPGVFPSILST
FT                   IILICSVLWCIDSLVAYLKHQKSTGTQEAHDSPNGLFHFTKESRRLAIIIILTVLYILI
FT                   LMPLVGFVISTFLFLFVSVMLFYGKLSSALIVSVLLSLVMFVLFQFVLHLPMPR"
FT   sig_peptide     442888..442962
FT                   /locus_tag="Spirs_0430"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            443388..444878
FT                   /locus_tag="Spirs_0431"
FT   CDS_pept        443388..444878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0431"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="COGs: COG3333 conserved hypothetical protein;
FT                   InterPro IPR002823; KEGG: tle:Tlet_1876 hypothetical
FT                   protein; PFAM: protein of unknown function DUF112
FT                   transmembrane; SPTR: Putative uncharacterized protein;
FT                   PFAM: Tripartite tricarboxylate transporter TctA family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79580"
FT                   /db_xref="GOA:E1RB50"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB50"
FT                   /protein_id="ADK79580.1"
FT                   /translation="MTEVLNLALLMQPKTLMFAILATFLGIVVGALPGLTATMAVSILV
FT                   SLTFGLNTAEAIVILISVFLGGIYGGSRSAILLNVPGTPSSAATALDGWPLSKRGEGGD
FT                   VGILVTTFSSLAGIFGLIVLALLTPVIAKFALKFGYWEYFWLAIMGVLISATLTTGDMK
FT                   NYKGIITGFAGMLIACVGLDPIHGLPRLCFGTTQLYGGINLVPAMIGLFGLTEAFSALM
FT                   EPSSHDILDGGPEAKLGSLVKKSFSLLKRYPINFARSSIIGTFIGALPGVGPDIASWVA
FT                   YGTAKKQSKTPEEYGHGSYEGIIASETANNAATSGVFIPLLTLGIPGDAVSAIILGGIQ
FT                   MHGYKPGPTFFFENPGFVYFLAGTLFIVNVIMWIEGCAITKVISKILKAPVGILMPIVM
FT                   VFCVFGAYMINLRKFDVILMLCFGLLGIVMRKFKLPPAPMALGIILGTLADTNFRQAML
FT                   AGRYSAAPFFTRPLSLIMFLVILTALLSPLFKRFGKTK"
FT   sig_peptide     443388..443495
FT                   /locus_tag="Spirs_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            444926..445663
FT                   /locus_tag="Spirs_0432"
FT   CDS_pept        444926..445663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0432"
FT                   /product="GntR domain protein"
FT                   /note="COGs: COG2186 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011711; KEGG: amt:Amet_0818 GntR
FT                   domain-containing protein; PFAM: GntR domain protein;
FT                   regulatory protein GntR HTH; SMART: regulatory protein GntR
FT                   HTH; SPTR: GntR domain protein; PFAM: Bacterial regulatory
FT                   proteins, gntR family; FCD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79581"
FT                   /db_xref="GOA:E1RB51"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB51"
FT                   /protein_id="ADK79581.1"
FT                   /translation="MVDNLEAYRDAVDSRVSQITDEIISYITTNGSQPGDKLLSESQIS
FT                   ENLNLSKTSVRECVSMLNNIGLIHSVQGKGLILNEVTVDTFFRQFHHPAMNLFLKLSPE
FT                   EVKNIKDLRVLIETYAVEHYLESDEDDPLEEMEGLLQQMKGLCQSDDCVGYMEIDLLFH
FT                   KNIVSLARNNFLSNIYSVIRIPILREVEVAFSKGNLNTIQMYHEKIHEELKQKNRNVIN
FT                   LMQKHLEYLIRPKTALKHHPPLK"
FT   gene            445787..447079
FT                   /locus_tag="Spirs_0433"
FT   CDS_pept        445787..447079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afn:Acfer_0081 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterized
FT                   conserved protein (DUF2088)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79582"
FT                   /db_xref="GOA:E1RB52"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB52"
FT                   /protein_id="ADK79582.1"
FT                   /translation="MIAGRKRPMSSQLVQHTSIPRFFGVRQNFDRNSMDPLEIPLVVQK
FT                   VISQKGIGNRVLPGMKVAVTVGSRGINNLPIIVKSIVEEVFARGAFPFIVPAMGSHGSS
FT                   TAEGQRKLIEGYGVTEAYLGCPILSSMEVVCIGKTDDGRDAFIDKYAFSADGIILFNRV
FT                   KPHTAFRGPYESGIMKMMAIGLGNQHGAEACHEMGFRTMGRNVELFGKAILKNAPILFA
FT                   VPVIENAFDETQRILAIGAESIIEEEPKLLQEAYSLMPKLYEEYCDVLIVDKIGKNYSG
FT                   DGMDPNITGTFSTPYAEGGICAQRVCVLDLSDETHGNGVGIGMANVTTQRAVDKLDIDS
FT                   MYSNVITSTVLGGVRIPLTMENDREAIQVCIQTCNEIDRKKVRIIRIPNSMHISRILMS
FT                   EIYYDQVRSNSFYTVESEPEFLEFDAEGNLW"
FT   gene            complement(447218..447577)
FT                   /locus_tag="Spirs_0434"
FT   CDS_pept        complement(447218..447577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0434"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cal:CaO19.2504 bud site selection; SPTR:
FT                   Putative uncharacterized protein BMS1"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79583"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB53"
FT                   /protein_id="ADK79583.1"
FT                   /translation="MLTPDYTVAEKLEEQAEQYKETNLEEISENLLGNLKDRKSDKAAK
FT                   MTTLLNQLYKFVDQGGHIETYEKEESDDIQEDDSDGTKQIENDIDLKHHIFNEIRRLQY
FT                   DIDELKYLTEPEREK"
FT   gene            complement(447635..448893)
FT                   /pseudo
FT                   /locus_tag="Spirs_0435"
FT   gene            448940..449795
FT                   /pseudo
FT                   /locus_tag="Spirs_0436"
FT   gene            449863..450792
FT                   /locus_tag="Spirs_0437"
FT   CDS_pept        449863..450792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: edi:EDI_200050 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79584"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB54"
FT                   /protein_id="ADK79584.1"
FT                   /translation="MRINYRRLLVLSLIIWVCGAAFLPGESLTQFPGTNLYFELPEGFS
FT                   WNTKYNAFTGPLQTSLTIGISTYPYDQIVQQITTTMKSNTQAELVESQISPNNSFFHIR
FT                   NNSFEQLMYIIATKGYVYTLTYMGVPLLDKHFMNRYARIRDTITINPEKVGDIQELQFF
FT                   ALPNQGFFFTQLVSIRHYFQKNYPDGNSAIVSIGKIPEIKQETIIKRYGSYMNYYTQIA
FT                   LNNEKAKGQSITNKEQTICKNESTGSEGYEILLQYKNSENVVTFLYNCFFVVGDNVIII
FT                   EGQPMKGYASQIVEDLKELSRNTVFTFK"
FT   sig_peptide     449863..449949
FT                   /locus_tag="Spirs_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(451024..452208)
FT                   /locus_tag="Spirs_0438"
FT   CDS_pept        complement(451024..452208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0438"
FT                   /product="transposase mutator type"
FT                   /note="COGs: COG3328 Transposase and inactivated
FT                   derivatives; InterPro IPR001207; KEGG: glo:Glov_3450
FT                   transposase mutator type; PFAM: transposase mutator type;
FT                   SPTR: Transposase mutator type; PFAM: Transposase, Mutator
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79585"
FT                   /db_xref="GOA:E1RB55"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB55"
FT                   /protein_id="ADK79585.1"
FT                   /translation="MNSKIIEINEEEVKAHLGEFVRETVEETLNAMLEAEAEQLVNAQK
FT                   HERNTDRKGYRAGHYNRKLLTKAGEVTIQMPKLKKVTFETAIIERYKRREISVEEAMVE
FT                   MYLAGVSVRRVEDITEALWGAVVSPGTISNLNKKIYEEIEKWRNLPLESHYAYVYLDGI
FT                   WMKRSWAGEVRNVSVLVAIGVNQDGFREIIGVAEGTKEDKDSWQRFLRYLKERGLATVD
FT                   MFISDKSLGLVESMPEFYPQARWQRCVVHFYRNVFSFVPHGKVKEVATMLKAIHAQENK
FT                   EEAIRKKDLIAQKLMDIKLYKAAALVREGSFETFSYYHFPVEHWKRIRTNNGLERIMRE
FT                   IRRRTRVIGSFPDGESALMLVSARLRHISGSTWNERKYLNMDLLIDYDREDQVS"
FT   gene            complement(452371..453555)
FT                   /locus_tag="Spirs_0439"
FT   CDS_pept        complement(452371..453555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0439"
FT                   /product="ATPase"
FT                   /note="COGs: COG1373 ATPase (AAA+ superfamily); InterPro
FT                   IPR011579; KEGG: cbd:CBUD_0184 hypothetical ATPase; PFAM:
FT                   ATPase; SPTR: Hypothetical ATPase; PFAM: Archaeal ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79586"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB56"
FT                   /protein_id="ADK79586.1"
FT                   /translation="MDIQELLFQYNPWWVGTFSTEGFINRTSYFEKLKKQIDSKPIIFL
FT                   TGLRRVGKTTLMKILIDYMIKSGIDENHIFYVSLDDYSLSKMLLSEILIEYRKIHKLSF
FT                   DEKIYVFFDEITYKDDYHQQLKNIYDNQNVKLFVTSSSSSLLKDKKAFLTGRALTYEVK
FT                   PLDFNEYLKFKGIEIKGSETYLFDSYFRDYMKEGGMPENVLKPSREYLMNLIDDIIQKD
FT                   ITAFNGLRNHQIVREYYTLLMERSGKQLSINKIANILKLSVDTARRYLGYFENTFLVHL
FT                   LPRYGKTNERLLSAKKLYACDLGIKHLFIGDRDLGSYFENYIYLKMKNNKELFYVYENG
FT                   YEIDFITDDKILIESKYNSEIKGKQKILFDEFDAKEKYVIDSVKKLKILEDFEK"
FT   gene            453745..454077
FT                   /locus_tag="Spirs_0440"
FT   CDS_pept        453745..454077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0440"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: pvi:Cvib_1307 transposase
FT                   IS3/IS911 family protein; PFAM: transposase IS3/IS911
FT                   family protein; SPTR: Transposase IS3/IS911 family protein;
FT                   PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79587"
FT                   /db_xref="GOA:E1RB57"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB57"
FT                   /protein_id="ADK79587.1"
FT                   /translation="MYDTIYKEKYVRRKFDEEFKAEVALEALKEEKTLQELAEEYEVHP
FT                   NQISAWKKQLLQNASSLFERKNKKNQELDEVKKREQELYKQLGQAKYENEWLKKKYKQL
FT                   YGKDYE"
FT   gene            454074..454910
FT                   /locus_tag="Spirs_0441"
FT   CDS_pept        454074..454910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0441"
FT                   /product="Integrase catalytic region"
FT                   /note="COGs: COG2801 Transposase and inactivated
FT                   derivatives; InterPro IPR001584; KEGG: maq:Maqu_0236
FT                   integrase catalytic subunit; PFAM: Integrase catalytic
FT                   region; SPTR: Integrase catalytic region; PFAM: Integrase
FT                   core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79588"
FT                   /db_xref="GOA:E1RB58"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB58"
FT                   /protein_id="ADK79588.1"
FT                   /translation="MIDPSDRHLSIARQSELVGVSRSHHYYKKRAPQRADIEEMIKLKE
FT                   LFIKYPFYGYRKQMLELGNESIVSTVKRVRRFMKELGLKALSPKKLTSIPKKEHPVYPY
FT                   LLKGKRIRYPNQVWATDITYLKLETGYVYLVAIMDLYSRKVLSWRISLTMDAEFCCEAL
FT                   KDALRNYGTPAIFNTDQGSQFTSYGFLQILKDEGVEISMDGQGRWRDNIYVERFWRTLK
FT                   YEDIYLKSYESVRELKTGLTRYFRFYNSRRFHQGLDYRTPEEMYISFQEKELKAAA"
FT   gene            455153..455608
FT                   /locus_tag="Spirs_0442"
FT   CDS_pept        455153..455608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_1902 helicase C2; SPTR:
FT                   Transcriptional regulator, DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79589"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB59"
FT                   /protein_id="ADK79589.1"
FT                   /translation="MGHGVAIMKGEPLPVQIRSVPIRRQPHAKTTRMWGNLFHKRLFQE
FT                   DGLRGEGFTRDHYKVQNMSSTDIKTATGLVAANKDVGDKLVFTNQSTTISFSCQEIQAT
FT                   DEHLESMGYLIQDFFRNGCRANRDLFAMRLATLVRVIRETINEGVLE"
FT   gene            complement(456124..456197)
FT                   /locus_tag="Spirs_R0008"
FT   tRNA            complement(456124..456197)
FT                   /locus_tag="Spirs_R0008"
FT                   /product="tRNA-Arg"
FT   gene            456321..457676
FT                   /locus_tag="Spirs_0443"
FT   CDS_pept        456321..457676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0443"
FT                   /product="amidohydrolase"
FT                   /note="COGs: COG0402 Cytosine deaminase and related
FT                   metal-dependent hydrolase; InterPro IPR006680; KEGG:
FT                   cdl:CDR20291_1989 putative amidohydrolase; PFAM:
FT                   amidohydrolase; SPTR: Probable amidohydrolase; PFAM:
FT                   Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79590"
FT                   /db_xref="GOA:E1RB60"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB60"
FT                   /protein_id="ADK79590.1"
FT                   /translation="MATTLIENGTILTVDDSNTVYKSGYVLVEDDHIVKVGQGDADERT
FT                   RDEASKIIDASLMAVMPGMVNAHTHLFQSFLRGLADDKPLLKWLETAIWPVAKSMDSGN
FT                   AGMAARLGILENIRGGATSVIDHQYIHTEPGVDDAVFAAAEDLGIRFRHAYGWADMNYH
FT                   PTLQLTADYIISELERLYHGWHGKANGRLTFEPAPLIPWGCSNETMLKTWELVKAWKVG
FT                   NHIHVAETREEIEMNLKDRGNRHIEWLDSLGILGPEMQLVHSVWLEDNELELVKKSGAT
FT                   VVHCPVSNMYLASGAARIPEMKDLGIHVALATDGPGSNNNQDMMETLKTTALLAKLSTL
FT                   NAMALLPMDVIRFACRGGSHAFGQPQAIGSLEVGKKADIVLIDLDSPFAMPVHHADSAI
FT                   VYNLGSASVDTVMVDGRILLEKKEFTDIDEEKVLSDARQSCSELFRRAGVAV"
FT   gene            457829..458212
FT                   /locus_tag="Spirs_0444"
FT   CDS_pept        457829..458212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lba:Lebu_1283 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF2992)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79591"
FT                   /db_xref="InterPro:IPR016787"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB61"
FT                   /protein_id="ADK79591.1"
FT                   /translation="MDTVVSTIFFNGQFWVALVEKRGEDGTLSVAKHTFGPEPTNNDIL
FT                   DFYFNSYHYLRFYACQRIVRAKKRLSGKEEKRSLKKSFDLYKEEQREVLLVRKKERKVR
FT                   YRADANEQYRRRCEKRKEKRRGH"
FT   gene            complement(458231..458962)
FT                   /locus_tag="Spirs_0445"
FT   CDS_pept        complement(458231..458962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0445"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011663; KEGG: bsu:BSU16810 putative
FT                   transcriptional regulator (GntR family); PFAM: regulatory
FT                   protein GntR HTH; UbiC transcription regulator-associated
FT                   domain protein; SMART: regulatory protein GntR HTH; SPTR:
FT                   Putative uncharacterized protein ymfC; PFAM: Bacterial
FT                   regulatory proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79592"
FT                   /db_xref="GOA:E1RB62"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB62"
FT                   /protein_id="ADK79592.1"
FT                   /translation="MITNRYSRLLLVRQALLELIQTLPPSNGTQANRLPPEGELARKLG
FT                   VSVATVREALRMLEREGIVSKRHGAGNFYHSSALDLSMRIDTNLEFTELIQAGGYEVGQ
FT                   RGDRVVRRAPDKEERKWFGIEGEHLCYHWRYLADGHPAILTTNLIPACIITNPPETEEA
FT                   DGNILNFLWKYAGQKISHANVCMEPQLAEEADLAAFEASNALPIIVWYQRFFSYQDRPV
FT                   GYVRVAFNPLIVKMQLLQKWL"
FT   gene            458978..459949
FT                   /locus_tag="Spirs_0446"
FT   CDS_pept        458978..459949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0446"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="InterProIPR001450:IPR008254:IPR017896:IPR017900:IPR
FT                   001226; KEGG: dol:Dole_1740 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; PFAM: NADPH-dependent
FT                   FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79593"
FT                   /db_xref="GOA:E1RB63"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB63"
FT                   /protein_id="ADK79593.1"
FT                   /translation="MGDERLKSLRNVAFSSASWNRCSEHDMIASMKVFVVYSSPAGSTA
FT                   RIARRIADFFRKGGTEEFSVSLYDLGALKFYNEGNKISPLLKEIDAAGENGLLFLGSPV
FT                   YVGHAVPPVSNFIDLLPSDIGTVFVPFVTWGGVSSGVALQEMAESAFSHGLRVAGGISM
FT                   VAPHSHMWRDDNPLGKARPNKNDMEMLDRWLFDFVRRLATSALSPESSIEALIHPDPVV
FT                   RESFSRVDLASAADEMPDRTIRTEGANACTLCRSCYAVCPTSAIQFAPHPVFTDRCIYC
FT                   FNCVKLCPNGSIVADLVSKERFLHKTSLLRNEPASPRFVFLT"
FT   gene            460090..460380
FT                   /locus_tag="Spirs_0447"
FT   CDS_pept        460090..460380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tad:TRIADDRAFT_52854 hypothetical protein;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79594"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB64"
FT                   /protein_id="ADK79594.1"
FT                   /translation="MNDHDKRILEFILSHGLVSVERLQLSFERRLCETLSLFDSSKHLI
FT                   MLSRQDIMREANHFFIRSLESVRSPSHWHLYEKKDFPDCVSEASDLLALRN"
FT   gene            460437..461189
FT                   /locus_tag="Spirs_0448"
FT   CDS_pept        460437..461189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0448"
FT                   /product="SagB-type dehydrogenase domain protein"
FT                   /note="COGs: COG0778 Nitroreductase; InterPro
FT                   IPR000415:IPR020051; KEGG: ppd:Ppro_0543 hypothetical
FT                   protein; PFAM: nitroreductase; SPTR: Nitroreductase;
FT                   TIGRFAM: SagB-type dehydrogenase domain; PFAM:
FT                   Nitroreductase family; TIGRFAM: SagB-type dehydrogenase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79595"
FT                   /db_xref="GOA:E1RB65"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB65"
FT                   /protein_id="ADK79595.1"
FT                   /translation="MKDNSFAAGRSLLKSRWPELSTIKTAKANGLPSPPLQDPASQGEG
FT                   LIRLPIMPGGMASEITLIEAMAARQSRRHFPGGELSLDELSFLLWATQGVRKVSSQFSL
FT                   RSVPSGGARHPLETYLFIKAVHGLDPGLYRYLPLDHALTLLRKANDPDGEEKELDEALL
FT                   KHNFGAAVTFLWAGAPERGEWSYAFEAHRLMLIDAGHVCQNLYLACEAIGCGTCAVGAY
FT                   DQEKCDRFLGLDGKERFLMYAAPVGKRA"
FT   gene            complement(461155..461373)
FT                   /locus_tag="Spirs_0449"
FT   CDS_pept        complement(461155..461373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79596"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB66"
FT                   /protein_id="ADK79596.1"
FT                   /translation="MVTWEAMTPEERDRFIYLILSEDALKTIVLIMQKKYGPTVSTETI
FT                   MRFAFKVAVNRMTPQHLKHVSPRERHT"
FT   gene            461434..462717
FT                   /locus_tag="Spirs_0450"
FT   CDS_pept        461434..462717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0450"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG4277 DNA-binding protein with the
FT                   Helix-hairpin-helix motif; InterPro IPR007197:IPR000532;
FT                   KEGG: hmo:HM1_1854 radical sam domain protein, putative;
FT                   PFAM: Radical SAM domain protein; SPTR: Radical sam domain
FT                   protein, putative; PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79597"
FT                   /db_xref="GOA:E1RB67"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB67"
FT                   /protein_id="ADK79597.1"
FT                   /translation="MNTEAKIKILADAAKYDVSCASSGSTRLGPKGGMGSTLSAGICHS
FT                   WSSDGRCISLLKVLFSNACRYDCSYCVNRASAGGRRVSFTVDELTNIAMAFYRRNYIEG
FT                   LFLSSGIFAEPDVVMEQLLRVAITLRSEHRFGGYIHMKAIPGASQELVAAAGRWVDRMS
FT                   VNIELPSERSLNRLAPQKKRRDILGPMGWMRTEIDHYREGMEEFRHSSFLKTKPASFVP
FT                   AGQSTQLIVGASPEADGTILSLADGLYKSYGMKRVYYSAFVPTVSRAEGPGLDLGTPNR
FT                   LKAREHRLYQADWLMRFYGFAFDELVGDRSASLDPELDPKSHWAIVHRDHFPVDLERAD
FT                   YEVLLRVPGIGVRSAHRLVVARREGPLNFELVARLGVVLSRAKYFVTCGGRSLVSADYS
FT                   EKVLRMRLGEGPDAFGQLSLFDAISGEL"
FT   gene            462717..463511
FT                   /locus_tag="Spirs_0451"
FT   CDS_pept        462717..463511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hor:Hore_05000 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79598"
FT                   /db_xref="InterPro:IPR025404"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB68"
FT                   /protein_id="ADK79598.1"
FT                   /translation="MPRLSYDGSWKGFLTLLAKSEIMEPEDCKDLAIHRQGRNGDLFSE
FT                   AGDFVATLERDARRIHDCLGKKLGARAAWVMSRAQAAEREDVDRLLLLLWRFPDRLDRD
FT                   ERLGLREWAERVATECHRYQGILRFFPLDVGIMYAPLRPRFAVLPFLATWAAERFPQTP
FT                   LLFHDRGRDLFRWTVPASKVGPGIKGRASGEGAFDKARRVFELLPSKQELEAVPARGDC
FT                   VQECWSGYVHATAIKERRNSNLQRSFLPKVYREYLPELRFDS"
FT   gene            complement(463605..464882)
FT                   /locus_tag="Spirs_0452"
FT   CDS_pept        complement(463605..464882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0452"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /note="COGs: COG1760 L-serine deaminase; InterPro
FT                   IPR005131:IPR005130; KEGG: app:CAP2UW1_0154 serine
FT                   dehydratase alpha chain; PFAM: serine dehydratase alpha
FT                   chain; serine dehydratase beta chain; PRIAM: L-serine
FT                   ammonia-lyase; SPTR: Serine dehydratase alpha chain; PFAM:
FT                   Serine dehydratase alpha chain; Serine dehydratase beta
FT                   chain; TIGRFAM: L-serine dehydratase,
FT                   iron-sulfur-dependent, single chain form"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79599"
FT                   /db_xref="GOA:E1RB69"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB69"
FT                   /protein_id="ADK79599.1"
FT                   /translation="MKSLRELYRIGIGPSSSHTMAPHRAAENFLGRYPSAPRYRVTLFG
FT                   SLAATGKGHLTDRAILDVLGDDTTTLIWKPNELLPRHPNALRFEAIDTDGALIAEEIVY
FT                   SIGGGALLYEDEQVQANEQRTDPYPYLTMRSILPWAEREGRQLWEYVYEHEDTDFDQFL
FT                   SDVWTTMKETIARGIENEGRLPGSLNLARKASSYFMKSRHAYGMIRQISKLFAYALAVS
FT                   EENASGGIVVTAPTCGSCGVLPAVLKVLQEDFEFTDKRIRRALATAGLIGNLVKHNGSI
FT                   SGAEVGCQGEVGTACAMAAAAAAQLLGGTPSQVEYAAEMGLEHHLGLTCDPVGGLVQVP
FT                   CIERNAVAATRAVDAGTFATLSDGKHMISFDEVVDTMAQTGKDLSSRYRETSSGGLSIF
FT                   YNRDELEALAKHGTPQHDQQEIPPGV"
FT   gene            complement(464885..465736)
FT                   /locus_tag="Spirs_0453"
FT   CDS_pept        complement(464885..465736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0453"
FT                   /product="histidinol phosphate phosphatase HisJ family"
FT                   /note="COGs: COG1387 Histidinol phosphatase and related
FT                   hydrolase of the PHP family; InterPro IPR004013:IPR010140;
FT                   KEGG: tro:trd_A0397 histidinol-phosphatase; PFAM: PHP
FT                   domain protein; SPTR: Putative histidinol-phosphatase;
FT                   TIGRFAM: histidinol phosphate phosphatase HisJ family;
FT                   PFAM: PHP domain; TIGRFAM: histidinol phosphate phosphatase
FT                   HisJ family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79600"
FT                   /db_xref="GOA:E1RB70"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB70"
FT                   /protein_id="ADK79600.1"
FT                   /translation="MRLANYHTHSLWCDGKGTLGDYVETAIAKGFEALGFSGHAPLPFP
FT                   NDWTMTEKGIVGYISDVRTLRDLYEDKLEIYLGLEVDFIEGVTTPASSWIGSLGMDYLI
FT                   GAVHMLQDPKDGLCYSVDGSEAELHHLIDVSFSGDVEAMIRAYYRAVILLVQDGGFDFL
FT                   AHFDLVKKHNVKTPFFDEEASWYKDVVSKALDAIADKGIPLEMNTGALSRGYREDPYPS
FT                   QWILEGCRERGIPMLINSDAHRPEWLDYAFPTCRSMLTAAGYKTVRMLIQGRWQKVPLE
FT                   EV"
FT   gene            complement(465748..466323)
FT                   /locus_tag="Spirs_0454"
FT   CDS_pept        complement(465748..466323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0454"
FT                   /product="nitroreductase"
FT                   /note="COGs: COG0778 Nitroreductase; InterPro IPR000415;
FT                   KEGG: hmo:HM1_3019 nitroreductase family protein; PFAM:
FT                   nitroreductase; SPTR: Nitroreductase family protein; PFAM:
FT                   Nitroreductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79601"
FT                   /db_xref="GOA:E1RB71"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023312"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB71"
FT                   /protein_id="ADK79601.1"
FT                   /translation="MDIDQLIAKSRSFRRFDGTHAIEKATVLQLIDLARKSPSGANRQP
FT                   LKFHVSVDKGLNERIYPTLAWAGYLIDWEGPIESERPTAYVTILLDKEISQSAGVDHGI
FT                   AAWSILLGATARGLGGCMIASIRKKELAAVLELDQNRFDILLVVALGKPVEQVVLEDVG
FT                   NDGEIRYWRDNEDVHHVPKRRIDDITIG"
FT   gene            466443..467441
FT                   /locus_tag="Spirs_0455"
FT   CDS_pept        466443..467441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0455"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro
FT                   IPR011703:IPR016366; KEGG: btu:BT0176 MoxR protein; PFAM:
FT                   ATPase associated with various cellular activities AAA_3;
FT                   SPTR: MoxR protein; PFAM: ATPase family associated with
FT                   various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79602"
FT                   /db_xref="GOA:E1RB72"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB72"
FT                   /protein_id="ADK79602.1"
FT                   /translation="MYYNRAMMAQELENRVQKSSEELQKLREEIGKRIIGQSEMVDGIL
FT                   MALMAGGHVLLEGVPGLAKTLAVRTVAEVFDAGFKRLQFTPDLLPADLIGTLTYRQNSG
FT                   EFVPRKGPIFTNIVLADEINRAPAKVQSALLEAMEERQVTIGDTSHPLPDPFFVLATQN
FT                   PIEQEGTYPLPEAQLDRFVMKLLLDYPTEHEELEILRRMGKQQELPVRPILRPEHLLAL
FT                   RQTAEAVMVDERIEEYIVSLVAASRMKDSNPRSHSRFIDFGASPRGTLALYRCSKISAL
FT                   FEGRTFVIPDDVKSVAYPILRHRLVLSYEAEAEEMRADDVIRLLLKYVPVP"
FT   gene            467447..468319
FT                   /locus_tag="Spirs_0456"
FT   CDS_pept        467447..468319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0456"
FT                   /product="protein of unknown function DUF58"
FT                   /note="COGs: COG1721 conserved hypothetical protein (some
FT                   members contain a von Willebrand factor type A (vWA)
FT                   domain); InterPro IPR002881; KEGG: hau:Haur_4903
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF58; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79603"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB73"
FT                   /protein_id="ADK79603.1"
FT                   /translation="MDSLELFARIKNLPLVSSRLVEGVLSGNYRSLFKGPGLEFDEVRE
FT                   YAEGDDSRFIDWNVSSRMGQPYVKTFREEREMALFLVIDVSASLGFGNGKLSKQETVAT
FT                   LAALLAFSAVHNNDRVGAAFFSDRIEKWVPPRKGRNQIFRLAGDIMEVEPKGKGSDLAL
FT                   ALRGVHESVKRRGICVIISDFRTAPCWREMSLVAKRHDVIAIRIEDPSDKDFPVPGFAQ
FT                   LRDPETDGVLPAFGASSRFRREYREFWETHRIYWDRECRRRGISTLTVSTEDDPIESLF
FT                   TFFRRRRRR"
FT   gene            468316..469230
FT                   /locus_tag="Spirs_0457"
FT   CDS_pept        468316..469230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bdu:BDU_173 hypothetical protein; SPTR:
FT                   Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79604"
FT                   /db_xref="GOA:E1RB74"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB74"
FT                   /protein_id="ADK79604.1"
FT                   /translation="MKRLLLVLFLAPMLLPAQEITEQPLIVSRQLFLPAEYYVGDSVEL
FT                   RLTLEGVDPDSLEIPSTLPDVPWIEIRDISIERDSVGSELTIHFTTYMPGTRTLPSIVF
FT                   GEGKVLEGVKIHASSILDDTNAPFSPARGQLLLPGTSVGLILFGLLIFLGPVLTLLLAG
FT                   KGRRFFRGIMERHRGRRPARIFYRRLRELEDNFDKIAGRDFYFTMTGILRSYLTQRTGE
FT                   DFLSATSREFGFLCDRFFDDQALVAALAEMDHISDGVKFGGERVHTDRKRHDLALLKDV
FT                   ASYVERRAEGHRSSNRRKGRGSV"
FT   sig_peptide     468316..468372
FT                   /locus_tag="Spirs_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            469227..470228
FT                   /locus_tag="Spirs_0458"
FT   CDS_pept        469227..470228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0458"
FT                   /product="von Willebrand factor type A"
FT                   /note="InterPro IPR002035; KEGG: bhr:BH0173 hypothetical
FT                   membrane spanning protein; PFAM: von Willebrand factor type
FT                   A; SMART: von Willebrand factor type A; SPTR: Hypothetical
FT                   membrane spanning protein; PFAM: von Willebrand factor type
FT                   A domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79605"
FT                   /db_xref="GOA:E1RB75"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB75"
FT                   /protein_id="ADK79605.1"
FT                   /translation="MITFDQPGILLFLAVLPPAMFLTYGWKRRGGLLPLSFTMWERDRF
FT                   ESPLFFHRFLLFLANVSLWLGVASLIVALAGPRLVEREKIYLHRGVDIVFVLDQSPSMI
FT                   VRDFGGDTRFDAAKHAIRTFVEGREHDPLGLVIFGDEAALVTPPTLDYTSFLSRMDAVR
FT                   VMKLGRGSALGLGMAVATVHLEKSSAERKVMVIVSDGENNAGEITPESAARVAASLGIR
FT                   IYAVGVGGEGSVATEFTDPETGKSYRGTYEGKIDMELLKAVTESTRGQAFLAGSPGALS
FT                   QVFREIDALESVELRSTTDISSEPVHHLLIRLGLWLLVFYAFVKRLFFREVL"
FT   gene            470228..471202
FT                   /locus_tag="Spirs_0459"
FT   CDS_pept        470228..471202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0459"
FT                   /product="von Willebrand factor type A"
FT                   /note="InterPro IPR002035; KEGG: cpi:Cpin_0906 von
FT                   Willebrand factor type A; PFAM: von Willebrand factor type
FT                   A; SMART: von Willebrand factor type A; SPTR: von
FT                   Willebrand factor type A domain protein; PFAM: von
FT                   Willebrand factor type A domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79606"
FT                   /db_xref="GOA:E1RB76"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB76"
FT                   /protein_id="ADK79606.1"
FT                   /translation="MVQNPGSAFLFLLFLPLFWSIGRSLVVGKRLFRSFRDGASPRSLY
FT                   DVFLIKWFFSSFFLILFLLFTILALMGFTGTGIDSEQFPEKKDVVFAVDLSRSMLASDV
FT                   VPSRLERTKVLIRTVLDNSSGNRYGLVVFTDLGLVMVPVTEDVQSLVSAVDALSPDLLS
FT                   SAGTNIAAGISAAGQAFPEGERRQRLIVVFSDGEEHSGDPKEITASLRRDHHITTSVIA
FT                   LGSADGAAVPAADGGVMQDEEGNPVRSKVNTILLQSVAAAGEGSFLDGGDADALKQLRK
FT                   LLGYKPDSGVRLTRDTLYRPFLALALLFLLLHVLVRMVPWRKK"
FT   gene            471187..471777
FT                   /locus_tag="Spirs_0460"
FT   CDS_pept        471187..471777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0460"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="InterPro IPR019734:IPR001440:IPR013105:IPR013026;
FT                   KEGG: bbu:BB0171 hypothetical protein; PFAM:
FT                   Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79607"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB77"
FT                   /protein_id="ADK79607.1"
FT                   /translation="MAKKIMRLVLLFSLLWLLTACDSPETHLAVLQGNYAFARGEYHEA
FT                   TFKYLQALDFERWKSRVHYNLGNVYHELGEDDAALQEWELAFSDQDKELSFRIAFNQGV
FT                   LFFGQGHYQEAYDAFRRALTVHPASVDAKINLEHALRKISRKRQEQQTESPQAALPEAK
FT                   GESERILDYVRRNESFTWSSAPEADHHKEEQQW"
FT   sig_peptide     471187..471246
FT                   /locus_tag="Spirs_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            471771..473783
FT                   /locus_tag="Spirs_0461"
FT   CDS_pept        471771..473783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0461"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR013026; KEGG: bga:BG0169 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79608"
FT                   /db_xref="GOA:E1RB78"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB78"
FT                   /protein_id="ADK79608.1"
FT                   /translation="MVAHIEKRALLLLFFFLTGLFPLAALPPLSVTLEPNPVGVRDNTT
FT                   LVVDLPLSSSAGVEAIAPEVPSGLSIWRGPYIRFYRGDDYAHQGVDHFVRISYTLRASR
FT                   TGRMVIPSFRFLSEEGEYETSPLLLEVGLYRSGHLQIPFEPYWELGRQSVYAGETVPVT
FT                   LKVPMQREVRLVDDVSVRPPREGFFEETGRVGAIDRSEIEGFSFYTLPAAGYLLTPERS
FT                   GDLQIPSAFVTIDGIREQADALDLHVLPLPDSVAATGAVGSFAYKAAADKGPFQEGDRF
FT                   FVTVTVSGKGNLPYLSVPEPILKGASLISSSEESEIDADADGFVGRRVVRFEFLVSGKG
FT                   TIEISYPPFPFLIPSSGRVSTRYLSSSTIRVEDSEHFGTVEGETPFSFEPLPIAGFSVT
FT                   NEDSYRNLRSYLWLLPGPLLFFVFLIFGRKKRSVATVSILFFFMSAAGAVDEVPPISDE
FT                   KALAAYAAGDDEAAYQEYLLLLEISPDNPRLFYNCAVTAYRASHVGKAVFYARQAFRTH
FT                   PSDGKMKELVQAIEKREGFGFQAPLPFSVHPDLFFFLLMLSINGAGFVAVFYLLHRKNL
FT                   TFIVAVLLFTIGVASAIALGFSAADWGRHVVVAQADLPVLSIPDSGAGTSFVLREGEAV
FT                   TLLGRSRDYLFIETGINTSGWVPLDQVLILGPMER"
FT   sig_peptide     471771..471842
FT                   /locus_tag="Spirs_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            473785..474258
FT                   /locus_tag="Spirs_0462"
FT   CDS_pept        473785..474258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0462"
FT                   /product="Smr protein/MutS2"
FT                   /note="COGs: COG2840 conserved hypothetical protein;
FT                   InterPro IPR002625; KEGG: tde:TDE1254 Smr domain-containing
FT                   protein; PFAM: Smr protein/MutS2; SMART: Smr protein/MutS2;
FT                   SPTR: Smr domain protein; PFAM: Smr domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79609"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB79"
FT                   /protein_id="ADK79609.1"
FT                   /translation="MDFGEILEKWEAGRKQQTISKQREPVDDSGFARQIERYLPEEADW
FT                   EQVIGEKELSDIDPVLRRSTLRRIAPEAEIDLHGMTRDEAVTALDRFFREAASRDLQKV
FT                   LIIHGKGNHSGRDGAVLPDVVREYLQYSPIAGESGQADRSLGGSGATWVILKE"
FT   gene            complement(474269..474487)
FT                   /locus_tag="Spirs_0463"
FT   CDS_pept        complement(474269..474487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0463"
FT                   /product="translation initiation factor IF-1"
FT                   /note="COGs: COG0361 Translation initiation factor 1
FT                   (IF-1); InterPro IPR006196:IPR004368; KEGG: tde:TDE2087
FT                   translation initiation factor IF-1; PFAM: S1 IF1 family
FT                   protein; SPTR: Translation initiation factor IF-1; TIGRFAM:
FT                   translation initiation factor IF-1; PFAM: Translation
FT                   initiation factor 1A / IF-1; TIGRFAM: translation
FT                   initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79610"
FT                   /db_xref="GOA:E1RB80"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB80"
FT                   /protein_id="ADK79610.1"
FT                   /translation="MAKEEAIEVEGIVKESLPNTMFRVELKNGHLILAHLSGKMRKHYI
FT                   RIVPGDKVRVALSPYDLTRGRIIYRER"
FT   gene            474624..474980
FT                   /locus_tag="Spirs_0464"
FT   CDS_pept        474624..474980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0464"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="COGs: COG1734 DnaK suppressor protein; InterPro
FT                   IPR020460:IPR000962; KEGG: tpp:TPASS_0096 possible DnaK
FT                   suppressor; PFAM: zinc finger DksA/TraR C4-type; SPTR: DnaK
FT                   suppressor, putative; PFAM: Prokaryotic dksA/traR C4-type
FT                   zinc finger; TIGRFAM: RNA polymerase-binding protein DksA"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79611"
FT                   /db_xref="GOA:E1RB81"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB81"
FT                   /protein_id="ADK79611.1"
FT                   /translation="MDKVFEEKMKDSLLAMKEELVRSLISESEDFEALVRDMDPKDLVD
FT                   VAADDIDRKTLEALNAQEVKRIRLIDSALSRLKNGRYGLCMRCGKKIPTERLEAIPYAL
FT                   MCIECKSSDERRSR"
FT   gene            475044..475451
FT                   /locus_tag="Spirs_0465"
FT   CDS_pept        475044..475451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0465"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tde:TDE1987 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79612"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB82"
FT                   /protein_id="ADK79612.1"
FT                   /translation="MEISTYAGSPVVSVSKLLHARYSSGRVSMPVSRNQYLYARFKNVT
FT                   GIPTENGVGGFPLAKLRSIDVLIERLKQIKGDKVQVDVSGQDDGESEKRIDAMIDQLAD
FT                   RLHNAALTSQQTPYTAVSSEALMGIVVNMNL"
FT   gene            complement(475458..476126)
FT                   /locus_tag="Spirs_0466"
FT   CDS_pept        complement(475458..476126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0466"
FT                   /product="beta-lactamase domain protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; KEGG: dap:Dacet_1446 beta-lactamase domain
FT                   protein; SPTR: Beta-lactamase domain protein; PFAM:
FT                   Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79613"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB83"
FT                   /protein_id="ADK79613.1"
FT                   /translation="MVERIIVGRLNTNCYIYSRWKKECVIIDPGGDYEKIISHMVGKNL
FT                   TPRGIILTHGHLDHVSALGKIIDYYVEQEIHLDIAAHEDDAIFFGSGAREIHEEAFQQM
FT                   GIDGKALFQEMYKPIPDIDLFLEEGKSVFDCDLRVIHTPGHTKGSVCLYSEESDMLFSG
FT                   DTLFFEGVGRTDLFGGDSQALFRSINEKLMPLPDRTRVFPGHGPLTTIERERGYNPYVQ
FT                   "
FT   gene            476151..477119
FT                   /locus_tag="Spirs_0467"
FT   CDS_pept        476151..477119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0467"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcr:505171.70 ATP-dependent DEAD/H RNA
FT                   helicase; SPTR: ATP-dependent DEAD/H RNA helicase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79614"
FT                   /db_xref="GOA:E1RB84"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB84"
FT                   /protein_id="ADK79614.1"
FT                   /translation="MVILQASAFLHLFVIVLIALCTYGIVPGIGAFFVRRKWRRFREGL
FT                   LSAASYPVPDYRLLHSGESGRAGCFRFYGTLRALRGENGAWVDNGKISLRVGLERVRVY
FT                   MISAPSSLSHREGSSAFDDEMVPIEVPWRRIKTLPEGTKVFVAGELDRRATGALFLSTQ
FT                   KVPLVVIVYDGPDEHLLSHAVKTGRERNGYWNFLTPGALTTGSFTLFVYFYLLLRAPLL
FT                   RFPAILALTVSLLPLTLVLPPAVIGYSFYRSLWKRAFLLRTERDLLTLNEISEGKKAPP
FT                   KEAEVKKRTSQRLELLALLILALSVGVELFMIFIFFAAVIR"
FT   gene            complement(477135..478637)
FT                   /locus_tag="Spirs_0468"
FT   CDS_pept        complement(477135..478637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0468"
FT                   /product="DbpA RNA-binding domain protein"
FT                   /note="COGs: COG0513 Superfamily II DNA and RNA helicase;
FT                   InterPro IPR011545:IPR005580:IPR000504:IPR014021; KEGG:
FT                   cby:CLM_3166 ATP-dependent RNA helicase, DEAD/DEAH box
FT                   family; PFAM: DbpA RNA-binding domain protein; DEAD/DEAH
FT                   box helicase domain protein; SPTR: ATP-dependent RNA
FT                   helicase, DEAD/DEAH box family; PFAM: DbpA RNA binding
FT                   domain; DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79615"
FT                   /db_xref="GOA:E1RB85"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB85"
FT                   /protein_id="ADK79615.1"
FT                   /translation="MFQSANDHHSGERILSLVKDAGLHTASPIQRQLFPELPSEKDLLI
FT                   ETGDEEGKALALLFPALIRNERPARELYALILTADRTKLLRSDILLRKLTSKQFKGQQF
FT                   AVLGTESQAKKELRLISRRLNIIVGTPERIIDHLRRGNLDLSSLSTLVLDVPDEPHREG
FT                   FEQDAEFILSKIPSRIQTVIFAPHPEKLEFLAAFQRRSTSLTRAQREDYLLHMQLYTCS
FT                   RNKAEAAARILLGRGRVKNCLLICENNEEAQTLRRLLQVSGVDGQADACIISGGSTENI
FT                   PMQGINTILFAGILPEIGTIKKLVADTGKDPAEVELLTVCDTDNAECLKTLTTMEEARI
FT                   MSLEEKAMPSNQEVLKGHIENILNTIKIDEDPEILNSYRSLLRKHVPFFMRSYFAAYLL
FT                   KESGAKLNLPNEKEKSDRRRKEKMKTLFVSIGKNRKVYPKDLVYLFRSTLSLKKAEIGS
FT                   VKVLDNYSFVEISELRSQEAISKMDGMEYRGRKITVNYSRKK"
FT   gene            478721..479938
FT                   /locus_tag="Spirs_0469"
FT   CDS_pept        478721..479938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0469"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="COGs: COG2885 Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)protein; InterPro IPR006665;
FT                   KEGG: tpp:TPASS_0292 outer membrane protein TpN50; PFAM:
FT                   OmpA/MotB domain protein; SPTR: OmpA family protein; PFAM:
FT                   OmpA family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79616"
FT                   /db_xref="GOA:E1RB86"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB86"
FT                   /protein_id="ADK79616.1"
FT                   /translation="MTERYGKLTLCLLLMLMLSGILPVSAVEFAYKSALDDQYRILSKV
FT                   DERVYINGTYSHHANILNKISAKVVEVQDDKAKIEATFLTSESREGNVTVYELNQEYES
FT                   TFWRSRLGRYEIAPIYYMPVVRDVPTFPDRDLKPGDSWQADGEEVHDLRQGYGIPDPFL
FT                   FPMTVNYRYLGEGTYEGKNADLISIQYSIAQRADSYYDRYPLYPRRITGYSDQIMYWDR
FT                   QEGQPMAYEENFSIVFDLSNGDSYEFTGTATARQVRSRSMDKETVKDELERRIAENGIP
FT                   DAGVRVGDDGVIISLENIQFKADSAVPLPGEMDKLKRVVSLLKLYPDRDILVTGHTALA
FT                   GTAEGRMALSLERARTVAAFLKDELNIDDDRLMIEGKGAGAPVAPNDTEEGKRKNRRVE
FT                   ITILEN"
FT   sig_peptide     478721..478798
FT                   /locus_tag="Spirs_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            480006..480650
FT                   /locus_tag="Spirs_0470"
FT   CDS_pept        480006..480650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0470"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cte:CT1380 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79617"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB87"
FT                   /protein_id="ADK79617.1"
FT                   /translation="MNHFKRLSLMSLFVLIALLLSSCLGVEMDVSINSDGSGTVDMAFH
FT                   ISQMFFQMDPEQQDVPIPITKEQLESSYEGVEGVTVVDVTEKDTEDRKTITATLAFDDF
FT                   SDLSKGDEDMFEGATLTKENGHTVFRTVLKDAVEPEEEGDMSSSDPSQEEMIKQYFEGY
FT                   SFLYRVRAPKKIKSHSIGELSDNDRVLTYEIPMYDFNSMQNSEPLVLEVSW"
FT   sig_peptide     480006..480080
FT                   /locus_tag="Spirs_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            480678..481064
FT                   /locus_tag="Spirs_0471"
FT   CDS_pept        480678..481064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0471"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pop:POPTR_833422 hypothetical protein; SPTR:
FT                   Membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79618"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB88"
FT                   /protein_id="ADK79618.1"
FT                   /translation="MLGSGGDALERQVRKLEKERDIDPAVKMVRLRELFSRCARTVPSE
FT                   LLEEFFLRLTETTGRSGDDGEERFFDRLYGAADLFVLDYDDREDPLLLEDWKLIGELVS
FT                   DYGSDIDDESLTYVMSRVVDHGAL"
FT   gene            481076..482224
FT                   /locus_tag="Spirs_0472"
FT   CDS_pept        481076..482224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0472"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lbz:LbrM20_V2.2080 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79619"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB89"
FT                   /protein_id="ADK79619.1"
FT                   /translation="MSAMKNELSKAKHDLEALLVSLGEKSSLLGAGNLALKISDESGAD
FT                   ELRLRALSSREKLEKIEKEIRRIRSLLSEKEEVERRIEELVASEKELSERRTRLYGEIG
FT                   RKGFESYQKGALTDERFSSLFSEIVEYSDREKKALEELRDLEASKERSPLLKRITFGAK
FT                   ITLAKNNLTGLRKEQDKAYLKVGEALFGQELASAIVDPQLLTLIATFRESERREEELRG
FT                   ERSEAEKKRQDLVTQLADAGADKNSTKCLRDLDQKRVEAETAVAESDRDYGATLLLMPE
FT                   LRELIRKEGDASLLEEVAELEKKEEFLRTRIAALEAGIEAEEKREELEKQRTQLEKVKR
FT                   KREELDAEMKEIKKRISEGEKELNRLLEAADVDQSSESDVSE"
FT   gene            482221..483474
FT                   /locus_tag="Spirs_0473"
FT   CDS_pept        482221..483474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0473"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /note="COGs: COG1457 Purine-cytosine permease and related
FT                   protein; InterPro IPR001248; KEGG: tsi:TSIB_0467 probable
FT                   hydroxymethylpyrimidine transporter CytX; PFAM: permease
FT                   for cytosine/purines uracil thiamine allantoin; SPTR:
FT                   Probable hydroxymethylpyrimidine transporter CytX; PFAM:
FT                   Permease for cytosine/purines, uracil, thiamine, allantoin;
FT                   TIGRFAM: NCS1 nucleoside transporter family; probable
FT                   hydroxymethylpyrimidine transporter CytX"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79620"
FT                   /db_xref="GOA:E1RB90"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB90"
FT                   /protein_id="ADK79620.1"
FT                   /translation="MIDKGARTLSGFGTALLWAGVAVSVSEIWAGSLLQDAGLFAGLLI
FT                   IVIGHLFGGLVLSASGTMGTRYGIMSMQSTRMVLGNRGSIIPSLLNVFQLVGWATIMLA
FT                   LSGSIGASVGHRLGAPFNSKAFWILLIGAGTLAWSFLVGSSKLQWVHTVVIIGLVLISA
FT                   LMTWIALNPHYYTMKPAAADSFSFTRGMRLMDLVIVMPISWVPLISDYSRLAKSERGGF
FT                   WGSFLGYGIVSCWMYGIGLVISLATGTEDPAANILRLMGTLGLTIPAVVLVFASTMTSD
FT                   FPDIYSSACSLFNINSKIKPAWTMWGTGILTIILALFFDLSRFETFLNVVGAFFIPLFA
FT                   ILLTDYFLIRKQDLTGLDFAVGSGMNFSGGFRIKGLLVWGIGTLVYFLARAVDCPLGAS
FT                   ITAFLVSSVIYLLLEKRT"
FT   sig_peptide     482221..482292
FT                   /locus_tag="Spirs_0473"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(483667..485457)
FT                   /locus_tag="Spirs_0474"
FT   CDS_pept        complement(483667..485457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0474"
FT                   /product="NAD(P)-dependent iron-only hydrogenase catalytic
FT                   subunit"
FT                   /note="COGs: COG4624 Iron only hydrogenase large subunit
FT                   C-terminal domain;
FT                   InterProIPR001041:IPR019574:IPR001450:IPR004108:IPR
FT                   003149:IPR017896:IPR017900:IPR000283:IPR013352; KEGG:
FT                   dae:Dtox_0172 hydrogenase, Fe-only; PFAM: hydrogenase large
FT                   subunit domain protein; NADH:ubiquinone oxidoreductase,
FT                   subunit G, iron-sulphur binding; ferredoxin; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; iron
FT                   hydrogenase small subunit; SPTR: Hydrogenase, Fe-only;
FT                   TIGRFAM: hydrogenase, Fe-only; PFAM: Iron only hydrogenase
FT                   large subunit, C-terminal domain; 2Fe-2S iron-sulfur
FT                   cluster binding domain; NADH-ubiquinone oxidoreductase-G
FT                   iron-sulfur binding region; Iron hydrogenase small subunit;
FT                   TIGRFAM: hydrogenases, Fe-only"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79621"
FT                   /db_xref="GOA:E1RB91"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB91"
FT                   /protein_id="ADK79621.1"
FT                   /translation="MNKEITIHINNKTITAPQGTTILEAAKAADISIPTLCYLEHYPPL
FT                   GACRLCLVEVEGAKTLLTACSTPIAEGMMVTTNSKRVREARKTVLELLLSEHIGDCRFC
FT                   TRGEDCELQTLARRLGVEEPQWTGEQPKTVVDVSTPALERDSGKCVKCRRCVTACGEIQ
FT                   GIGALFPQGRGYSTVIGPAFTRPLSEVTCVQCGQCAAVCPTGAITEVSHIPQVWDALDD
FT                   PELHVVVQTAPAIRAALGECFGLPPGTLVTGKMVTALRKLGFDAVFDTDFAADLTIMEE
FT                   GTELLTRLQAALTGGPDEKAPPLPMFTSCSPGWVKYAEHYFPDFLPNISSCKSPQQMFG
FT                   AVAKTYYAKKKGIDPAKIVVVSVMPCTAKKFEAGRPEMNASGFSDVDYVLTTRELGRLI
FT                   KQAGIDFVSLEESSMDAPLGISTGAADIFANTGGVMEAALRTVWEIVTGTPLPTENLHI
FT                   KEVAGLKGIKEASLTVETTVKEWEFLKGVELKVAVAHGLSRAGTLLSEIREGRKNYHFV
FT                   EIMTCPGGCIGGGGQPRFTDDAVRQARIAAIYREDEGKKLRASHLNPAIIQLYEEYLGK
FT                   PLGEKSHHLLHTIYHQRELV"
FT   gene            complement(485454..488576)
FT                   /locus_tag="Spirs_0475"
FT   CDS_pept        complement(485454..488576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0475"
FT                   /product="Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit"
FT                   /note="COGs: COG1894 NADH:ubiquinone oxidoreductase
FT                   NADH-binding (51 kD) subunit;
FT                   InterProIPR013027:IPR000103:IPR002023:IPR011538:IPR
FT                   019554:IPR019575:IPR019794:IPR001949; KEGG: dal:Dalk_2559
FT                   respiratory-chain NADH dehydrogenase domain 51 kDa subunit;
FT                   PFAM: Respiratory-chain NADH dehydrogenase domain 51 kDa
FT                   subunit; NADH dehydrogenase (ubiquinone) 24 kDa subunit;
FT                   Soluble ligand binding domain; NADH ubiquinone
FT                   oxidoreductase, F subunit, iron sulphur binding;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; SPTR: Putative uncharacterized protein;
FT                   PFAM: NADH-ubiquinone oxidoreductase-F iron-sulfur binding
FT                   region; Pyridine nucleotide-disulphide oxidoreductase;
FT                   Respiratory-chain NADH dehydrogenase 24 Kd subunit;
FT                   Respiratory-chain NADH dehydrogenase 51 Kd subunit; SLBB
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79622"
FT                   /db_xref="GOA:E1RB92"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB92"
FT                   /protein_id="ADK79622.1"
FT                   /translation="MKRIGNSNELTQVQKQLCASERKKRHLIRVCAGGGCLASGSIEVM
FT                   EALESNLKELAVDASVKKTGCLGPCARGPVVMIEPEGLFYEGVHPEDCREICETLYKAG
FT                   KNGTVDPIEHLLHYNRAEQRSVVKVDEVDFYRGQAKIVLSRCGVVDPDSIEDAIACGAY
FT                   TALAKVLNEEDADKVIDTLKISGLRGRGGAGFPTWLKWDFTRKSPGEEKYVLCNADEGD
FT                   PGAFMDRSVLEGDPHALIEGMAIAGKTIGADHGVVYVRAEYPLAVKRLGHAIEAAKESG
FT                   LLGENILGSEFNFDIEIRMGSGAFVCGEETALIASIEGKRGEPRPRPPFPANKGLWGKP
FT                   SLLNNVETYANIAGIIKKGAEWYASFGTTESKGTKVFALAGAISTSGLVEVPIGTCLGE
FT                   VVFDIGGGIPGGKEFKAAQIGGPSGGCIPREYLNVPLDYASLQELGAIMGSGGLIVMDD
FT                   DTCMVDVARYFLEFVQEESCGKCTPCRVGTKRMLEILERICNGKGEMEDIDRLIELGTK
FT                   IKETALCGLGQTAPNPVLSTIRHFRHEYEEHIRDHHCTAGVCSALVRAPCQSACPAGVD
FT                   IPGFISLVKERRYAEALRLHRERNPFAAVCARVCFHTCEDKCRRAGIDEAVAIRAIKRY
FT                   MVDQEVTVQRPEVREDADREVRKVAIIGAGPAGLSCSYFLARLGYRPRIFEAQSRPGGM
FT                   LVQTIPAYRLPRETLAREIRMIEQIGVDIVTDKRLGRDFSLQDLRDEGYEAIFIAVGAP
FT                   GNLRLGIKGEDAEGVVQGIDFLRTYNIRGSVSVGERIVVVGGGNAAVDAARTAIRLGAK
FT                   EVTMLYRRSREQMPAYAEEIEEALLEGVKLMSLTQPSEILTDEKGAVRAIRCHGMTLGE
FT                   FDRSGRRRPTDDEAQPFEIETDQIIIAIGQALDKKTFAGATEIPIGGNRFIAANQRDGS
FT                   TAIPWLFAGGDAATGPNSVVSAIASGEKAAVGIDTALFGSCDPFWRKEKKLDTDYDPTA
FT                   DPVPYPREKIPTIEIERRKNNFDEVEKTWTESVAIRQCARCLRCDYGKEQV"
FT   gene            complement(488573..489061)
FT                   /locus_tag="Spirs_0476"
FT   CDS_pept        complement(488573..489061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0476"
FT                   /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /note="COGs: COG1905 NADH:ubiquinone oxidoreductase 24 kD
FT                   subunit; InterPro IPR002023; KEGG: pth:PTH_2649
FT                   NADH:ubiquinone oxidoreductase 24 kD subunit; PFAM: NADH
FT                   dehydrogenase (ubiquinone) 24 kDa subunit; SPTR:
FT                   NADH:ubiquinone oxidoreductase 24 kD subunit; PFAM:
FT                   Respiratory-chain NADH dehydrogenase 24 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79623"
FT                   /db_xref="GOA:E1RB93"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB93"
FT                   /protein_id="ADK79623.1"
FT                   /translation="MEVLTQKEMIDQTNAIIDSFLDTRGALIPVLQNAQNLFGYLDQEV
FT                   LKQISRRLQIPYSEVAGVVGFYSYFSTVPRGEHIVRVCLGTACYVRGGKEVLSALQDVL
FT                   GIDVGETTEDRVFSLEIGRCFGACGLSPVVMIDEDVHQRVKPATVRDILFPYRTKEAV"
FT   gene            489283..492117
FT                   /locus_tag="Spirs_0477"
FT   CDS_pept        489283..492117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0477"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR000014:IPR001610:IPR003661:IPR003594:IPR
FT                   001789:IPR004358:IPR013767:IPR008207:IPR005467:IPR000700;
FT                   KEGG: dma:DMR_25470 two-component hybrid sensor and
FT                   regulator; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold domain protein;
FT                   response regulator receiver; Hpt domain protein; SMART:
FT                   response regulator receiver; ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; PAS
FT                   domain containing protein; PAC repeat-containing protein;
FT                   SPTR: Sensor protein; TIGRFAM: PAS sensor protein; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   Response regulator receiver domain; His Kinase A
FT                   (phosphoacceptor) domain; Hpt domain; PAS fold; TIGRFAM:
FT                   PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79624"
FT                   /db_xref="GOA:E1RB94"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB94"
FT                   /protein_id="ADK79624.1"
FT                   /translation="MDISRIEKFIEYVPDAVFIIEPDGMIAALNKRALRLTGLDSTALI
FT                   GISFSDLLLPEHVSLLKRLYLSGESSSDIQGRMNTVLLGREGHRVHVNLRAQGFRDQMF
FT                   SGYMVVCREVGHHLELERQRSLQHDLAMALVGIQNIEEAVNLVLDTGLKISECDGGALF
FT                   LRGAENGRWKLSSFINIEEEEITSLSFVEELNRLPDGIRQWIVFGERGSDAVLSPPPAM
FT                   RRLGIRFAMTIPVISETKPGAVLFFFSHQAKQMDVEARRSLEIIASQFGSLVARLHSER
FT                   KFRSVEGFGRSLIKSMPSGLITRNRDGIITHFNLAAEQLLGIKGDTVIGKRDLPDALFF
FT                   FDEKGNIIEHFDAPTFLVLESGKPLRNVLVRAIRPDGSTVWLSVNGEPLFGKDEEPVAA
FT                   VITMKDVSDHLRLVDELEQARQMAVTASDSKSRFLANISHEIRTPLSGIMGMTDLLLSG
FT                   PLTEDQRENLFLMKEAEELLLDIINKVLEISKIESGKLSLELEPFRLRGAINKAALPIF
FT                   MGCKEKGIVLDIDVSPSIPDRLIGDGSRLTQVLTNFLSNALKFTESGTITLTVVETSRN
FT                   ENGKIELFFSVKDTGIGIPSDAQTTIFDDFRQIDSGPAKRHQGTGLGLAISKKLVELMD
FT                   GSIGVESEGGQGSRFFFSAMFTLLDEGEPETGNEAEHVSHERRLRVLLAEDNELNQRSI
FT                   SYFLEEAGHLVTIAANGREAIEVLKREPFDLILMDVQMPEMDGMEATGIIRSHTDRLFN
FT                   PNIPIIALTAYALKEDELRFIAAGMDRFVTKPIKKELLFLAIYEMTGNTLLPVEDEAGL
FT                   RSSDPSIVPGSISDRESEELYEFLRDYQNDLDIGRQILDVFIDEYPAKKETLGQALRNR
FT                   DVELLADQLHSLTNSLSALRIFGLGNECHLAEALTKDGELEEVERRVARLLPRFDRVHE
FT                   NAIHCRQIIDDIDM"
FT   gene            complement(492119..493069)
FT                   /locus_tag="Spirs_0478"
FT   CDS_pept        complement(492119..493069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0478"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_0770 succinate dehydrogenase or
FT                   fumarate reductase, flavoprotein subunit; SPTR: Succinate
FT                   dehydrogenase or fumarate reductase, flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79625"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB95"
FT                   /protein_id="ADK79625.1"
FT                   /translation="MEHGSQRLPTVVLPLSEECDRDECQDIFVYLRPESNGILVESTIM
FT                   KVIGLKAEVANKIKLIYLANLPGEFISKTRVIEKHYRLKLLFTKKGKSLFTPFMKTQFS
FT                   QHFGISFEDADILGAFDAMRRLKMSREELFGLWVPEKDLLHVNGQTIKRYHDFFIINYD
FT                   IPAILHKNIEGTDIAVMIFRTELSAAEFHALITDLVTNLRKEGLVDVKRPFSRVFHYSN
FT                   GPFEQIRDGLGFLYDKNGNHLPLEKLRFYDYLQKKGLDREHILKTLAYPIFVFNGERAP
FT                   YHEETIYEASFSQSYAQAYQTLASAKAQLLIGKEI"
FT   gene            complement(493094..493921)
FT                   /locus_tag="Spirs_0479"
FT   CDS_pept        complement(493094..493921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0479"
FT                   /product="aminotransferase class IV"
FT                   /note="COGs: COG0115 Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase; InterPro
FT                   IPR001544; KEGG: dat:HRM2_24560 IlvE; PFAM:
FT                   aminotransferase class IV; SPTR: IlvE; PFAM:
FT                   Aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79626"
FT                   /db_xref="GOA:E1RB96"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB96"
FT                   /protein_id="ADK79626.1"
FT                   /translation="MYAIRNGQLIEEKEAVVPITQREVFFNFSVYESLKVLEGAALFAD
FT                   DHVERFMDSAKILGMTHSYRRQELLGYINLLIEKNKSDEATLKIQMIGGTTPLLFLFLS
FT                   PLPTYQTEWYNAGVSVISYRGERIFPRAKSNCLLLNYIASREAAAAGALDALLVNRKGE
FT                   VTEGTRSNFYAFEGDTLITAEDDILFGVTRKLVLKAAQKKDITVKFKMITLDDLLEGRY
FT                   EEPFISSTSMGAMPIRQIDGKRTGSQFPRVRSIHQAVKGFESEELKRIKSLLK"
FT   gene            complement(493925..494863)
FT                   /locus_tag="Spirs_0480"
FT   CDS_pept        complement(493925..494863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0480"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="COGs: COG1171 Threonine dehydratase; InterPro
FT                   IPR001926:IPR000634; KEGG: tgr:Tgr7_1148 putative
FT                   serine/threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   SPTR: Putative serine/threonine dehydratase; PFAM:
FT                   Pyridoxal-phosphate dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79627"
FT                   /db_xref="GOA:E1RB97"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB97"
FT                   /protein_id="ADK79627.1"
FT                   /translation="MIDTQDFVAARRLIRRYANLTPICTSSSLDAICKAEIVWKCESFQ
FT                   KVGAFKFRGAINAVFSLPKEEAARGVATHSSGNHAQAVALAAKMAGIPAHIVMPENAPP
FT                   VKVAAVKGYGGKVRFCPPTLEAREAGQKKVIEETGATFIHPSENLRVITGQGTALLELL
FT                   EQAPELEAVLVPVGGGGLASGSARAAALFHPGLKVYGVEPEQADDAWRSLTTGKLVRPE
FT                   HPDTIADGLRTALGPNTFSILSQHLAGIVTVSEQAILDALRLIWERMKLVVEPSAAVPL
FT                   AAFLENKVPELTGKRVGIILSGGNVSFPEWS"
FT   gene            495099..495815
FT                   /locus_tag="Spirs_0481"
FT   CDS_pept        495099..495815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0481"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="InterPro IPR007272; KEGG: tit:Thit_0076 protein of
FT                   unknown function DUF395 YeeE/YedE; PFAM: protein of unknown
FT                   function DUF395 YeeE/YedE; SPTR: Putative uncharacterized
FT                   protein; PFAM: YeeE/YedE family (DUF395)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79628"
FT                   /db_xref="GOA:E1RB98"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB98"
FT                   /protein_id="ADK79628.1"
FT                   /translation="MSDEKKPDQQSTGQSSIRRSTSSRSSGRSRKKKKNQLPIGIAVLA
FT                   VVVLIAILLGMKNELLAFFWITGIAFGYILQRARFCFTAAMRDPMLTGGTSLTRAVLIA
FT                   FAFTSIGFIAIKYGAFARGLPIPGQGYVVPVSFATVVGSFMFGIGMVIAGGCASGTLMR
FT                   VGEGFLMQVLSLFFFVIGSLWGAHDFGWWKLHVIMKGKAIFLPDLFGWIGAVIIQLLVI
FT                   VLLWIAADKWEKHKNA"
FT   gene            495835..496062
FT                   /locus_tag="Spirs_0482"
FT   CDS_pept        495835..496062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0482"
FT                   /product="SirA family protein"
FT                   /note="InterPro IPR001455; KEGG: smf:Smon_0718 SirA family
FT                   protein; PFAM: SirA family protein; SPTR: SirA family
FT                   protein; PFAM: SirA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79629"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB99"
FT                   /protein_id="ADK79629.1"
FT                   /translation="MKEVELDCYGEACPVPLVKAQNKLKELEVGDVLIVQLDHSCAMKN
FT                   VPEWARKEGHNVEVEEIDDGEWEVVIEKVK"
FT   gene            496082..496615
FT                   /locus_tag="Spirs_0483"
FT   CDS_pept        496082..496615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0483"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="InterPro IPR007272; KEGG: tit:Thit_0078 protein of
FT                   unknown function DUF395 YeeE/YedE; PFAM: protein of unknown
FT                   function DUF395 YeeE/YedE; SPTR: Putative uncharacterized
FT                   protein; PFAM: YeeE/YedE family (DUF395)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79630"
FT                   /db_xref="GOA:E1RBA0"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBA0"
FT                   /protein_id="ADK79630.1"
FT                   /translation="MAIKDNEYYKKFLKEAWPYVTGAVLLSLFQIVTLAVTGNPWGVSG
FT                   ILANWGAWLYQAVGGSVDKWYYFASEGAQRTLENGILNHGGSMRNFGIIFGALLATLLA
FT                   SGFKIKKIKSWKQVVAAILGGLLMGYGARIGFGCNIGALFSGIASFSLSGWVYAVFLFI
FT                   GAMVGSKLLVKFFM"
FT   sig_peptide     496082..496186
FT                   /locus_tag="Spirs_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            496641..497879
FT                   /locus_tag="Spirs_0484"
FT   CDS_pept        496641..497879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0484"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG0492 Thioredoxin reductase; InterPro
FT                   IPR000103:IPR013027; KEGG: tit:Thit_0079 FAD-dependent
FT                   pyridine nucleotide-disulfide oxidoreductase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; SPTR: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; PFAM: Thioredoxin;
FT                   Pyridine nucleotide-disulphide oxidoreductase; TIGRFAM:
FT                   thioredoxin-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79631"
FT                   /db_xref="GOA:E1RBA1"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBA1"
FT                   /protein_id="ADK79631.1"
FT                   /translation="MREKKREQYDVVIIGGGAAGLTAGIYCGRARLKTLIIEKALVGGL
FT                   ATYTNEIANFPGFPEPLPGLDLMNLFKKQAEGFGVKFKGTDVKSVNFEGDVKIVETFRN
FT                   IFEAKAVIVAAGGRPRVTTAKNEEKYLFDKGISFCATCDAAANTDKTVMVIGSGDAAIE
FT                   EGMFLTKFAKKVIVSVIHDEGKMDCNEIAREQALSNPKMEFKWNTLADSFEGEEQLERV
FT                   VLKNLKTGELDPVAVDTCFEFIGYLPNTEIFENILKLSKQKYVITNERMETGIPGVFAA
FT                   GDVREKELKQVSTAVGDGAIAGVGSEKYIAETEMFEKQIMQKEKVGLIYVYSAINAPSR
FT                   ELLPVLQETAESYDGKIKMNVIDLYKGKTLCDRLSCDIEPMTIFYTKNGEVSAVSTDCS
FT                   TPAVKKQLDALLA"
FT   gene            complement(497963..498397)
FT                   /locus_tag="Spirs_0485"
FT   CDS_pept        complement(497963..498397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0485"
FT                   /product="heat shock protein Hsp20"
FT                   /note="COGs: COG0071 Molecular chaperone (small heat shock
FT                   protein); InterPro IPR002068; KEGG: tde:TDE1029 HSP20/alpha
FT                   crystallin family protein; PFAM: heat shock protein Hsp20;
FT                   SPTR: Small heat shock protein; PFAM: Hsp20/alpha
FT                   crystallin family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79632"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBA2"
FT                   /protein_id="ADK79632.1"
FT                   /translation="MRYMINYKPAFDFDTMLNSIFTPNDRWLQNGPAVNIIEEPDQYRL
FT                   EAELPGLSENEVEVKIDDRVLTIGSQRSEEDETNREKEENKAPNYLIRERRERSFSRSF
FT                   VLPKDVDSEKISGSFNNGILTIILEKLPEVKPRKIKVQAA"
FT   gene            complement(498638..499564)
FT                   /locus_tag="Spirs_0486"
FT   CDS_pept        complement(498638..499564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0486"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="COGs: COG1893 Ketopantoate reductase; InterPro
FT                   IPR013332:IPR013752:IPR003710; KEGG: gbm:Gbem_0788
FT                   2-dehydropantoate 2-reductase; PFAM: Ketopantoate reductase
FT                   ApbA/PanE domain protein; PRIAM: 2-dehydropantoate
FT                   2-reductase; SPTR: 2-dehydropantoate 2-reductase; TIGRFAM:
FT                   2-dehydropantoate 2-reductase; PFAM: Ketopantoate reductase
FT                   PanE/ApbA; Ketopantoate reductase PanE/ApbA C terminal;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79633"
FT                   /db_xref="GOA:E1RBA3"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBA3"
FT                   /protein_id="ADK79633.1"
FT                   /translation="MTRIAILGAGALGSLYAYELSKVPSNSCFFIADGDRAKRLKKALP
FT                   TVNGARLRAEVREPNEGSPADLLIVSLKYHHLQEALASALPFVGEQTTIISVMNGVDSE
FT                   EIIAARFGQDHVVHCVALGMDALRENGKVHYTTCGRLVIGRPEKGRTDVQEDRDIGKIE
FT                   TVCRGSGIGLEVSDDILKSLWWKFMINIGVNQISAITGASYRFFQDRKSPAHALMNDTM
FT                   KEVVLVAQKKGIGLDETDIAAWYTVLDSLGPDNKTSMLQDVEAGRKTEVEMFAGILLKL
FT                   GKEVGLDLPINSFILKTILSIEGVAGK"
FT   sig_peptide     complement(499514..499564)
FT                   /locus_tag="Spirs_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            499738..501561
FT                   /locus_tag="Spirs_0487"
FT   CDS_pept        499738..501561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0487"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR003660:IPR004089; KEGG: tde:TDE0181
FT                   methyl-accepting chemotaxis protein; PFAM: histidine kinase
FT                   HAMP region domain protein; chemotaxis sensory transducer;
FT                   SMART: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; SPTR: Putative
FT                   methyl-accepting chemotaxis sensory transducer; PFAM: HAMP
FT                   domain; Methyl-accepting chemotaxis protein (MCP) signaling
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79634"
FT                   /db_xref="GOA:E1RBA4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBA4"
FT                   /protein_id="ADK79634.1"
FT                   /translation="MSIAKKIVLGSLLIVMIMGTALIATTIRLQKAAISIREVAELGDW
FT                   RLLGEQYRAQVYRLLSSAQSLLLREDERIPADDVMALRLSVSEIRKLHTTLAEVSSEIP
FT                   QLRPEVSALSDEAISYIDRIDKEVILRLFARERVDPKIVESIAHDNIDTLEVKLRDLEG
FT                   AIRTIIVDRTTDEERQAAAGIHWTVGGLLLTLLCVMLITFVLTKSIAGPVKKMGMLLSS
FT                   LADGGADLALRLPDRGNDEIARMGGSFNQFMESLTEMVSQLSGTVSEGVFIGETLQKIT
FT                   QQEQEAAFVLRNGLNRVERNHETLGESIQNTLGGARSIRDLSGDIAGQLGLQHEHINTT
FT                   TEQTAILVSDITMLSEKSLAGIELLSLFSQNLEQGMNSLSLFEEVAGKTMDALDRMGSS
FT                   LSAIEDIAGQTDVLAINAAIEAANAGEAGKGFGVVSTHIRSLSEEVGKGVGRILERLSE
FT                   AKESLTTMRALIVTNSGIFSQLEASAGKVVATFQEMHQRLGVVAESGESVGVQTHQLTE
FT                   RARSIEKMAMSADANAAKIVQEFELMKERDSGIENDLAEMVAQAAGLEHHTAMLLESSS
FT                   RNASVADTLSGLIDKFIFPELDGQGAKDQAG"
FT   sig_peptide     499738..499809
FT                   /locus_tag="Spirs_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(501632..502744)
FT                   /locus_tag="Spirs_0488"
FT   CDS_pept        complement(501632..502744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0488"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="COGs: COG0204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; InterPro IPR002123; KEGG: tte:TTE1351
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase; PFAM:
FT                   phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; SPTR:
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase; PFAM:
FT                   Acyltransferase; TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79635"
FT                   /db_xref="GOA:E1RBA5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBA5"
FT                   /protein_id="ADK79635.1"
FT                   /translation="MIPDNIDVAHRQTFQGKLLRLRRRFAKRILHWFFHHHVELTIEGI
FT                   EHIPDTGPLLVLPNHLSNLDGPMILGLFPRNIEMVGPGDFRVEFMKLAMMKLYGMTLIK
FT                   RGYTDRTGMNTIMHHLKAKRAVLMFPSGGMWEKRNLENKVGALYFSQLTGAPMLPVGIS
FT                   GAYLKGRAAFFFGKPKLVLRFGEVIPPISHEGNKRERAERLEKVSRELADKIFALLEPE
FT                   EQERYRRWARELYSFEFIMPEQANEPEKSVPSPPAMPTLAQFVHKPNLFRPMWKHARKD
FT                   MDPFRKRKSYPIKRTQKSAEAMRENLTGAFDHYIPYRLGDDAYKEILQELDQCIAYCGE
FT                   LTKAGWKRVQVRSVAYDPKTGERRKRLITG"
FT   gene            502897..504315
FT                   /locus_tag="Spirs_0489"
FT   CDS_pept        502897..504315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0489"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2211 Na+/melibiose symporter and related
FT                   transporter; InterPro IPR011701; KEGG: tna:CTN_1540
FT                   sugar:cation symporter family protein; PFAM: major
FT                   facilitator superfamily MFS_1; SPTR: Sugar:cation symporter
FT                   family protein; PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79636"
FT                   /db_xref="GOA:E1RBA6"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBA6"
FT                   /protein_id="ADK79636.1"
FT                   /translation="MKKRNYIAYGLGDLYGGGSFFIISTFSMYFLINVAGLNPLLAGLV
FT                   PGFGKIWDSVSDPLMGYISDHTKSRLGRRRVFFLIAILPIAVTFTLLWLPVSCPGQLST
FT                   FLYYVVAYLFFYSCSTMVLVPYSALSAEMTLDFTERNRLTGTRMIFSMIATLIGGLVVQ
FT                   PLINAFPSQEQGHLVMGLVFGTLFAVPYLFVFLGTWELPVVQKPLGKEKSVFRNFGSIY
FT                   QNRSFRIHIIMYICSYAAMDILMAWLKFYLIDYLRRPGFITVGLGTILVSQMAALPLYV
FT                   ALADKRGHAVSYRMGLMLWGLAIAMMAFQTPDSSVVALFINCLLIGGGMSAGVVIPFQL
FT                   LPFVTDVDTLMTGEHRAGTYAGAMTLIRKLIQGAFVLPMLGLLLNMIGYTPHPADVDLV
FT                   QSASTIFWLRGLFIVLPLLLILVGIKASTRFPITPESHAILRSELERVEAGGRREDAPE
FT                   RTKTVCQRLTGKPY"
FT   gene            complement(504323..504907)
FT                   /locus_tag="Spirs_0490"
FT   CDS_pept        complement(504323..504907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: wpi:WPa_0135 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79637"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBA7"
FT                   /protein_id="ADK79637.1"
FT                   /translation="MKDKGVLRRLTNELAEKFSSTWRLLSETTVFLSRTKLFPRYENML
FT                   RQWRHRLESSKSNPEVLQEVRDGVITLRKELRRAGYDLTLGSKDIKIEGYRNDAAVREG
FT                   FTRMVMVITDTALYYIAGQENHVQLMDYLDNQLRRMRVINIRQRHYLWYRWRANVLVLS
FT                   GSDTEMKDDFEELKQYVETNKLFMLKQLKKL"
FT   gene            504980..505705
FT                   /locus_tag="Spirs_0491"
FT   CDS_pept        504980..505705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0491"
FT                   /product="metallophosphoesterase"
FT                   /note="COGs: COG0622 phosphoesterase; InterPro
FT                   IPR004843:IPR011152; KEGG: tro:trd_1481 phosphatase family
FT                   protein; PFAM: metallophosphoesterase; SPTR: Phosphatase
FT                   family protein; PFAM: Calcineurin-like phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79638"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBA8"
FT                   /protein_id="ADK79638.1"
FT                   /translation="MKILVLSDIHGNREALETVLSECEGEYQQIWCLGDIVGYGPDPND
FT                   CIEILAGKEVVAVMGNHDLGAGRGEKWDLFSPVARTMIEWTAERLSGQSRHYLSKLPEI
FT                   AYRDGYTLVHGSPAGPVWRYILDGHSAAEAFSLMDTPACLYGHTHVPALFSLSKRALRY
FT                   HQPRYGKRMRPPGQMWLANPGSCGIPRDGDGRAAFILLDTESGFFTFRRIVYPKNRTVE
FT                   KLKRLGAPYQLIQLLQSDI"
FT   gene            505825..507822
FT                   /locus_tag="Spirs_0492"
FT   CDS_pept        505825..507822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0492"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR003660:IPR004089; KEGG: tde:TDE2783
FT                   methyl-accepting chemotaxis protein; PFAM: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; SMART: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SPTR: Methyl-accepting
FT                   chemotaxis protein; PFAM: HAMP domain; Methyl-accepting
FT                   chemotaxis protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79639"
FT                   /db_xref="GOA:E1RBA9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBA9"
FT                   /protein_id="ADK79639.1"
FT                   /translation="MSIRGKLILLVSGIIVVFLLAIGAYTISRMPLKQIQQERYVFDDL
FT                   RTRLMTLRAEMNRLDATSIEQQWKQVQEAKAAVDETFIIVKNLKTLPSLNAKIEKSVSI
FT                   ILRLDELFREKYSETEKLVGQMMDAAKDVFVFSGSIEMLDFYTNARAKSHPKIQQYQLL
FT                   ISNFISAIYVADMNLNSAVEVIGEQYSMIEDEVAKIEKKSTYTVLGIMALLFLVMVFVA
FT                   VRIANTIGKGVIKIERAISDLTDGDLTVRAEVISKDDLGRLSADLNRFIEALSTTVENI
FT                   KITSGENITVKEDLVVTINETSASVQQMSAGASSIKDQMSKLDVQIRESTKEVDVVTEG
FT                   IGGLSDALNDQVAMVEESTSSVTEMIASIGNVADITQKKRAATEKLVQTAQTGGNQLDA
FT                   TTAIIEEINGRIGEIRGTTDIIQNVAAQTNLLAMNAAIEAAHAGEYGRGFAVVAEEIRK
FT                   LAEASSLNSKQIAKVIKEMIARIQEASDAGSATKRAFADIDTEVRGVASSLDEINSSMM
FT                   ELQAGGQQILEAMTSLQDVSSKVREGGDQMGDAAGTVKDAMAQVDRISAEVLGSISEIT
FT                   AGLSEVGNAMMTVSDLTEKVSGISEAMDEAVRFFRTEENERVEDAEELESFDEEHDTQS
FT                   ALETLEVPDLASEEVEEDEKSNGTEERDTE"
FT   sig_peptide     505825..505887
FT                   /locus_tag="Spirs_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            507851..509059
FT                   /locus_tag="Spirs_0493"
FT   CDS_pept        507851..509059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0493"
FT                   /product="nucleoside:H symporter"
FT                   /note="InterPro IPR004740; KEGG: csa:Csal_0765
FT                   nucleoside:H+ symporter; PFAM: nucleoside:H symporter;
FT                   SPTR: Nucleoside:H+ symporter; PFAM: Nucleoside H+
FT                   symporter; TIGRFAM: nucleoside transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79640"
FT                   /db_xref="GOA:E1RBB0"
FT                   /db_xref="InterPro:IPR004740"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBB0"
FT                   /protein_id="ADK79640.1"
FT                   /translation="MDNTIPTLKLRLSAMMFLHYFATGASLPLMSLYLNQELGFGGSGA
FT                   GLILSFASLAAFISPLLGAFVTDRIMSAERLFALVEFLAAVAIFLLYLQRSFLPVLLCY
FT                   LFYMSLMVPATAISNTIVFHHSPDRGNSFGGIRLWGTIGWVCSGWLFSFFWLRLGKGSV
FT                   SDALVATAVVDVLLGMYALTLPSSRSSAPRRKELFPRAAFKVFTNPGVILVGITAFLMQ
FT                   ITQRYYYFGIPPYLRSLGFSDAVMLPAMSLGQVMEAVSMLFLVILFRFFSYRTVMMLGV
FT                   TMEICRFLAFYLGTSPASALLGIAFHGPSFAFFFTVSFIYINTFADKESRAGVQQLFFL
FT                   IIEGFGTLAGSLLSGFVYDRATGVDGIVDYHHFWGVPLVLAFSVFSLTVLLRLIPGLKS
FT                   RTR"
FT   gene            complement(509028..510341)
FT                   /locus_tag="Spirs_0494"
FT   CDS_pept        complement(509028..510341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0494"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterProIPR001789:IPR003593:IPR020441:IPR002078:IPR 002197;
FT                   KEGG: aoe:Clos_1079 two component, sigma54 specific, Fis
FT                   family transcriptional regulator; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; response regulator
FT                   receiver; helix-turn-helix Fis-type; SMART: response
FT                   regulator receiver; AAA ATPase; SPTR: Two component,
FT                   sigma54 specific, transcriptional regulator, Fis family;
FT                   PFAM: Response regulator receiver domain; Bacterial
FT                   regulatory protein, Fis family; Sigma-54 interaction
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79641"
FT                   /db_xref="GOA:E1RBB1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBB1"
FT                   /protein_id="ADK79641.1"
FT                   /translation="MYTILLVDDEKNLRTSIAHFFSLEGIETEEASNGLAAQQLLMKHH
FT                   FDAVITDLKMPGMNGLELLEWIGESGPDIPVFMISAFGEVEDAVQAMKKGAVDYVVKPF
FT                   DPEELILRLRRELERRKLQKLTNTIPTDDDYTGESPAMRQLFSLARKVAPTASNVLITG
FT                   ESGTGKEVMARFLHNHSDRSKNNFQAVNLGGIPESLMESELFGYEKGSFTGADHRKIGY
FT                   FEASNGGTIFLDEVGEAPLALQVKLLRVLQEKAVTRVGGTGTIPLDIRIIAATNKDLDA
FT                   MVKARDFRDDLYYRLNVIHLQLPALRERREDIPFLAETFRSKFASSMGKTITGFSDDAM
FT                   KALQHYSFPGNIRELENMVERAMILAEPPLLERKDFPLHQEEGPQTPKGSLRELEREAI
FT                   LEALLRNNGHREKSAAELGITRRTLLNKINEYGISIPE"
FT   gene            complement(510348..511619)
FT                   /locus_tag="Spirs_0495"
FT   CDS_pept        complement(510348..511619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0495"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG4191 Signal transduction histidine kinase
FT                   regulating C4-dicarboxylate transport system; InterPro
FT                   IPR003661:IPR003594:IPR004358:IPR005467; KEGG:
FT                   ank:AnaeK_0446 multi-sensor signal transduction histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; SPTR: Sensor protein; PFAM: Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79642"
FT                   /db_xref="GOA:E1RBB2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBB2"
FT                   /protein_id="ADK79642.1"
FT                   /translation="MKQQRFIIPILTTAVALILALGSFGSLIRQSIRHDRLLVESEVGK
FT                   IASFLTEQMLTSSVSDPPPLPDHVRGFALYGSNGHAVIGRGTYPSKLDTTRFISSPHGR
FT                   TSGIPQERWIREKQGSLLLLRALGGAGMNGAGNLQGRGARVGMQSQGRLFLYLDYDTGA
FT                   FLFQSRARVFLLLFGALLFIGASASSWIFYRRVRSYERELEEKKILTELGSAARTLTHE
FT                   LKNPLAVISMQEKILRRQFGKDKDLTASLDIIGEETERISDMIDRVRLLLKQPKGRPEP
FT                   IELVPLLEERSQRLPFPVTIHDNTQARSPRIFCDKTLFVSAVENILRNGREAQGSDTPP
FT                   LSVDISLLRNSVVISFADAGKGIPYDDKEKIFHPFFTTKQNGFGVGLSLVKSFAENAGG
FT                   SIECRNKEAGGTIFRLTFPLYQKG"
FT   sig_peptide     complement(511545..511619)
FT                   /locus_tag="Spirs_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(511616..512305)
FT                   /locus_tag="Spirs_0496"
FT   CDS_pept        complement(511616..512305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0496"
FT                   /product="Protein of unknown function DUF2202"
FT                   /note="COGs: COG4902 conserved hypothetical protein;
FT                   InterPro IPR019243; KEGG: mvu:Metvu_0451 protein of unknown
FT                   function DUF2202; PFAM: Protein of unknown function
FT                   DUF2202; SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterized protein domain (DUF2202)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79643"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR019243"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBB3"
FT                   /protein_id="ADK79643.1"
FT                   /translation="MKQLSSNFAGILLCITIMLFPPILHAQRGGPPQEALPLSQILETI
FT                   EPASLSQSEREGILLMHEEEKLAHDLYEALYEAWNIPIFANIAKSEASHMEWVKLLITR
FT                   YALEEPGSEAPGEFDNKHLKQLYEELLDEGTLSLASAFEVGATVEDLDIFDLERLLQES
FT                   DNKDIKIVYQNLNKGSRNHLRSFNAQLHQIGKRYIPKHIDQQLFRAIIESENERGVVSE
FT                   PNFMFPR"
FT   sig_peptide     complement(512228..512305)
FT                   /locus_tag="Spirs_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(512314..513048)
FT                   /locus_tag="Spirs_0497"
FT   CDS_pept        complement(512314..513048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE1095 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79644"
FT                   /db_xref="GOA:E1RBB4"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBB4"
FT                   /protein_id="ADK79644.1"
FT                   /translation="MRQFNISGKILALSIVLLFGLSIGGSMIIGYWRTESSKIPTRIES
FT                   GPFAGAYDPAAIKGSYTFENIESAFKIPVAQLAEAFVFAVSGEPETTQPKSFEAYPQPA
FT                   EGEVGTDSMRLFVSLYTSIPYEAEEDTRLPYTALALLRREGKLDEARWAELKDRYGVEM
FT                   ESPNEVPKAPTSETGSTLEIKGNTTYGQLFDAGLTTLTIEEVIGIKAGNRDQVIRDHLG
FT                   AAGLEFSQYKALLQKKVDNVQK"
FT   sig_peptide     complement(512977..513048)
FT                   /locus_tag="Spirs_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(513045..513881)
FT                   /locus_tag="Spirs_0498"
FT   CDS_pept        complement(513045..513881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0498"
FT                   /product="polyferredoxin"
FT                   /note="COGs: COG0348 Polyferredoxin; InterPro
FT                   IPR017896:IPR017900; KEGG: tte:TTE1096 polyferredoxin;
FT                   SPTR: Polyferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79645"
FT                   /db_xref="GOA:E1RBB5"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBB5"
FT                   /protein_id="ADK79645.1"
FT                   /translation="MKQVKRRKKTLRTFVQIFFFIVIALITVNHALEEKGMATIPLFAS
FT                   ASTHAVCPFGGVVTLGQLFTSGTFISKIHESSIVLMIAAFLIAILFGPAFCGWVCPFGT
FT                   VQEFVGKIGKKIFGNRYNRILSPKIDRPLRFLRYVVLLWVLYSTTVTGKLIFADYDPYY
FT                   ALFNFWSGEVAISGIVILFIILLLSLLVERPFCKYACPYGALLGLFNLVRIFGIRRRDS
FT                   SCINCKACDKACPMNITVSTAEKVRNHQCISCLKCTSEAACPVPRTVEFAGGGKEA"
FT   sig_peptide     complement(513789..513881)
FT                   /locus_tag="Spirs_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(513975..514448)
FT                   /locus_tag="Spirs_0499"
FT   CDS_pept        complement(513975..514448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0499"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hsa:10929 splicing factor,
FT                   arginine/serine-rich 2B; SPTR: Splicing factor,
FT                   arginine/serine-rich 2B"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79646"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBB6"
FT                   /protein_id="ADK79646.1"
FT                   /translation="MKLFGKMAIITVGLLFMSVALFANGTREAVPVRGVAGSGSRFAAP
FT                   LEQLNAEGTLVMEDGQYLFRSGGKLYTISAPGYPRSGFLPKEGTTMEVEADLYAPLDIC
FT                   PVANDGHLVVRRATVEGREYELMTASRGFGPSGRGRSGGYGRSGRGYGMYRAN"
FT   sig_peptide     complement(514380..514448)
FT                   /locus_tag="Spirs_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(514617..515876)
FT                   /locus_tag="Spirs_0500"
FT   CDS_pept        complement(514617..515876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0500"
FT                   /product="aminotransferase class-III"
FT                   /note="COGs: COG4992 Ornithine/acetylornithine
FT                   aminotransferase; InterPro IPR005814; KEGG: hor:Hore_14780
FT                   4-aminobutyrate aminotransferase; PFAM: aminotransferase
FT                   class-III; SPTR: Aminotransferase class-III; PFAM:
FT                   Aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79647"
FT                   /db_xref="GOA:E1RBB7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBB7"
FT                   /protein_id="ADK79647.1"
FT                   /translation="MAHINTDKNSEYLGPEKIIELKQKYLIPCSYHFYRRPPQIVRASG
FT                   TKVYDSTGKVYTDFFAGVSVMSCGHCNPQINNRVIQQLNTLQHTTSIYLTQPVVELARR
FT                   LAEILPGTICRSFFCNSGSEANESALLAARLFTQKRKFIAMEGSLHGRTFLTTGVTAIP
FT                   MWRTDPFVDEVPVSFASDESAVMELLLNEGPETAALIVEPIQGNGGIRPLPPSFFDRIA
FT                   AELKRQKVLLISDEIQSGFGRSGKMFAIEHYPVEPDMITGAKALGNGFPIGFFAARPDI
FT                   AAAFTKPSASTLGGNPVSCTAGLAVLDFIKSEKLVSRAAEYGDLLMSELRQVAKAAPFL
FT                   NAPRGLGLMVGMEVGAYQGKAAPDITDEILEAMKEKGFLIGKNGVNRNVLAFQPPLIIE
FT                   KAEITAMADALGQTASHILG"
FT   gene            complement(515857..517845)
FT                   /locus_tag="Spirs_0501"
FT   CDS_pept        complement(515857..517845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0501"
FT                   /product="peptidase U32"
FT                   /note="COGs: COG0826 Collagenase and related protease;
FT                   InterPro IPR001539; KEGG: gym:GYMC10_0623 peptidase U32;
FT                   PFAM: peptidase U32; SPTR: Peptidase U32; PFAM: Peptidase
FT                   family U32"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79648"
FT                   /db_xref="GOA:E1RBB8"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBB8"
FT                   /protein_id="ADK79648.1"
FT                   /translation="MTVIVDWDPLPQGGEEETVLIRYTTAMSRVYNNKQIELLAPAGTF
FT                   EIFKELMHSSCDAVYCGGSQLNMRMIRKGYNLSREELREAVFLAREADKNIYITVNSLL
FT                   DENELAEAEEYLIFLEEIGPDAIIIQDTAILSLINRLKLSIPLHASVMMNVHNTEMINV
FT                   LEAHGIKRVVLSREMPLSEVKAIAKQTNVELEYFTHGDMCVAHGSLCYYSSYLFGMSSN
FT                   RGRCLKPCRWPYTQPTQPQGASGHPFPLAVKDMNLYAHLWELLDAGVVSFKIEGRMRSK
FT                   EFITGLVDTYGRAFDAFLADPLGQMRPESSAVEPFKKRDFSTGYAFGVPGLENINTRGE
FT                   GTGDFYSTKKMFSTPTKEREVDAVQTEKLRARLLEIQRTLKPSPGQPGLSVRVNSIEQG
FT                   RRVLKSGSGIRRIYLSSEPFAPVMPFTLSELDGFQKECRKSDITLFLAFPRMVTDSQFS
FT                   LFRAYLAQKPSVDGFLLSNLGLFRLFEGEEYQLTCDSSMNIYNPQAAAFYEEAGAKGWT
FT                   SSIELPAPSLIRLPTLAAAAGCTGEAELIYHGLPDVMYLDHDVSGRKADSWFLETEAGR
FT                   LQIKRDYWNHYHLLPVKELTLMPLTDIFMKSGYDLLRLELQAYGPEETSSIMKAALTCM
FT                   DHPEKGDLVLESLQAQSKGCTYGAYQY"
FT   gene            complement(517928..518329)
FT                   /locus_tag="Spirs_0502"
FT   CDS_pept        complement(517928..518329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aco:Amico_0361 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79649"
FT                   /db_xref="GOA:E1RBB9"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBB9"
FT                   /protein_id="ADK79649.1"
FT                   /translation="MIKRKLLVRSVGFIIVVLIAVLLYINGKGYTLLLDNKDMEIDGIS
FT                   YQALEMVTVQIDHHEPVELYPRDRDMVLVPGKGHKATVTIYDKQYNEIAAKKLSFHIKG
FT                   KGEMFLLSFPALAQDAERWVIPFTPPSPQ"
FT   gene            complement(518326..519480)
FT                   /locus_tag="Spirs_0503"
FT   CDS_pept        complement(518326..519480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0503"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG1172 Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems permease components; InterPro
FT                   IPR001851; KEGG: aco:Amico_0360 inner-membrane
FT                   translocator; PFAM: inner-membrane translocator; SPTR:
FT                   Inner-membrane translocator; PFAM: Branched-chain amino
FT                   acid transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79650"
FT                   /db_xref="GOA:E1RBC0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBC0"
FT                   /protein_id="ADK79650.1"
FT                   /translation="MKERKATSASKVSPLKRVKLLISEYPVPTLFIIISILAIPASGFS
FT                   AGYLIQELITRLVRNSFLVLSLIIPIMAGMGLNFGMTLGAMAGQIALIFVTDWNIIGLN
FT                   GLFLAMILSIPMSLLFGYATGQILNKAKGREMVTSFILAFFANGIYQLIVLYGMGSVIR
FT                   IGSNALVLSRGYGIRNAVNLINVRQVMDNLIPLKIFGINIPLATFMFITLLCLFILWFK
FT                   KTKLGQDMRAIGQDMAVADAAGIAVEKTRITAIIISTVLAGIGQIIYLQNIGTMNTYNS
FT                   HEQIGMFSIAAILIGGATVSKAKIGNVFLGVILFHLMFIVSPMAGKNLIGSAMLGEYFR
FT                   VFISYGVISIALVLHAWKRLKEQERARAGAGLQGGDSPTEEAEA"
FT   gene            complement(519484..520533)
FT                   /locus_tag="Spirs_0504"
FT   CDS_pept        complement(519484..520533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0504"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG1172 Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems permease components; InterPro
FT                   IPR001851; KEGG: tai:Taci_0122 inner-membrane translocator;
FT                   PFAM: inner-membrane translocator; SPTR: Inner-membrane
FT                   translocator; PFAM: Branched-chain amino acid transport
FT                   system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79651"
FT                   /db_xref="GOA:E1RBC1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBC1"
FT                   /protein_id="ADK79651.1"
FT                   /translation="MESIRTFIERVGWPRIIIAIFLFTLFIAAPFVEVKVSTSISDTLI
FT                   RFGMNGVMVLAMVPMVQSGCGLNFGLPLGIISGLLGAVLTIELGITGFPAFLTAIAITT
FT                   PFALLFGFGYGKLLNRVKGNEMVIATYVGFSSVAFMCIMWLLLPLKSPTMVWGYGGEGL
FT                   RTTISTEGFYLHVLNDFLAVHIGKDFSFPTGMILFLAVICLFVWAFFHTKTGTAMTAVG
FT                   SNPDYARAAGISVDKMRTISVMMSTWLGGVGILVYQQSFGFIQLYMGPFYMAFPAVAAI
FT                   LIGGASVHKASIYNVLIGTFLFQGILTMTPSVMNSIINTDMSEVIRIIVSNGMILYALT
FT                   RVTRSGSRG"
FT   gene            complement(520538..522139)
FT                   /locus_tag="Spirs_0505"
FT   CDS_pept        complement(520538..522139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0505"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1129 ABC-type sugar transport system ATPase
FT                   component; InterPro IPR003593:IPR003439:IPR017871; KEGG:
FT                   tai:Taci_0121 ABC transporter related protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79652"
FT                   /db_xref="GOA:E1RBC2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBC2"
FT                   /protein_id="ADK79652.1"
FT                   /translation="MNTTPLLELRSITKDFFGNQVLTDVSFNLERGEILGLVGENGAGK
FT                   TTLMKIIFGMGVIRETGGYGGKILLEGEEVSFQSPFDALKAGIGMVHQEFSLIPGFSAT
FT                   ENILLNRESTRYNFLVEIFNDRMRTLDREDMQKRALEAIRLLGIDLDENMPVSEMPVGH
FT                   KQFTEIARELARKQIKLLVLDEPTAVLTESEAEILISAVRNLAKRGISVIFISHRLDEI
FT                   IALCDKVVILRDGEIVEEKHVTETSVEQIAEAMVGRSLEGYAPVPRESELKEEAVLEVA
FT                   HLWVDMPGETVRDVSFSVRSGEIFGIGGLAGQGKLGIPNGIMGLYKAGGIVTFEGKQVL
FT                   LNDPNAALMAGMSFVSEDRRGVGLLLEEPLDWNIAFTAMQTQDRFIKPILGGLIKWRDD
FT                   KAIEELAQEYIDSLQIRCTGPWQHAVELSGGNQQKVCLAKAFAVKPKLLFVSEPTRGID
FT                   VGAKKLVLDTIRRYNRENGITVIMVSSELEELRSLCDRIAIVDEGRIGGIKPATEKSTE
FT                   FGLMMVGRSRRAQAEV"
FT   gene            complement(522225..523445)
FT                   /locus_tag="Spirs_0506"
FT   CDS_pept        complement(522225..523445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tai:Taci_0120 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79653"
FT                   /db_xref="InterPro:IPR024258"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBC3"
FT                   /protein_id="ADK79653.1"
FT                   /translation="MKKSLIILACLLLATGMLFAGGNQEQAAATGSEGAAFHIGVVTGT
FT                   VSQSEDDLRGAERLIEEYGAVADGGMIQHITYPDNFMQEMETTITQIVGLADDPLMKAI
FT                   VVNQAIPGTTEAFRRVKEKRSDILLIAGEAHEDPLVIESAADLAVNNDFVARGYLIIHT
FT                   AKEMGAKTFVHISFPRHMSYETLARRRAIMEVACNDLGLKFVFETAPDPTSDVGVAGAQ
FT                   QFILEKVPAWVDKYGEDTAFFCTNDAHTEPLLKQLIEYGGSFVEADLPSPLMGYPGALG
FT                   IDLSAEQGDFPAILKKVEQTIVEKGGTGRFGTWAYSYGYTTTAGLGELAKRVIEGNAKL
FT                   TSLPDLMSAYNKYTPDAQWNGSFYTDANTGVRAKNHVLIYQDTYVMGRGYMHTTDIKVP
FT                   EKYFTVK"
FT   sig_peptide     complement(523386..523445)
FT                   /locus_tag="Spirs_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            523987..524289
FT                   /pseudo
FT                   /locus_tag="Spirs_0507"
FT   gene            complement(524921..525706)
FT                   /locus_tag="Spirs_0508"
FT   CDS_pept        complement(524921..525706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0508"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="COGs: COG1414 Transcriptional regulator; InterPro
FT                   IPR005471:IPR014757; KEGG: afl:Aflv_1569 transcriptional
FT                   regulator (IclR family); PFAM: Transcriptional regulator
FT                   IclR; regulatory protein IclR; SMART: regulatory protein
FT                   IclR; SPTR: Transcriptional regulator (IclR family); PFAM:
FT                   IclR helix-turn-helix domain; Bacterial transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79654"
FT                   /db_xref="GOA:E1RBC4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBC4"
FT                   /protein_id="ADK79654.1"
FT                   /translation="MSSDADKYTIKAVERSFEILDYISERNHPVSFQEITGALNLNNNM
FT                   AFRLLASLQNSGYLQKDEGSNCYFISLKSLKLSRNALRSIELRKIAFPYMEMLWSQYPN
FT                   ANINIAVYYQGEVLVIDRIDSQNLPRTYFTPGRVLPFHCSGLGKILTCTLPEEEINQLI
FT                   TEKGLKQYTVHTITSPEALKQELIKVRKEMVGRDRNEFISGDNCTAVPIFDKNRRIIAG
FT                   LSASALESYMSAEEIDQMFPKLQETAHRISAVMGYDDII"
FT   gene            526369..527253
FT                   /locus_tag="Spirs_0509"
FT   CDS_pept        526369..527253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0509"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /note="COGs: COG2084 3-hydroxyisobutyrate dehydrogenase and
FT                   related beta-hydroxyacid dehydrogenase; InterPro
FT                   IPR006183:IPR006115:IPR002204:IPR006398; KEGG: dsy:DSY4169
FT                   tartronate semialdehyde reductase; PFAM: 6-phosphogluconate
FT                   dehydrogenase NAD-binding; PRIAM: 2-hydroxy-3-oxopropionate
FT                   reductase; SPTR: 2-hydroxy-3-oxopropionate reductase;
FT                   TIGRFAM: 2-hydroxy-3-oxopropionate reductase; PFAM: NAD
FT                   binding domain of 6-phosphogluconate dehydrogenase;
FT                   TIGRFAM: 2-hydroxy-3-oxopropionate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79655"
FT                   /db_xref="GOA:E1RBC5"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006398"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBC5"
FT                   /protein_id="ADK79655.1"
FT                   /translation="MKIGFIGLGIMGKPMVRNLLKAGYEVTVYDIVAVNMDDAVQAGAY
FT                   RGTSPANIAAGSDLVITMLPNSPHVKSVVLGENGVLTGAKSGLKYVDMSSIAPLASKEI
FT                   GKACAEKGVRMLDAPVSGGEPKAVDGTLSIMAGGEQALFDEVKPVLECMGASVVLCGDI
FT                   GAGNTTKLANQMIVAGNIAILAEALTLAKKAGVNPQTVFEAIQGGLAGSTVMQAKAPMM
FT                   IASDFKPGFKIDLHIKDLNNAIATGHDIGSPLFLTTSVQEMFEMLHADGCGQDDHSGLA
FT                   KYYAKISGTTIGA"
FT   gene            527255..528175
FT                   /locus_tag="Spirs_0510"
FT   CDS_pept        527255..528175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0510"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="COGs: COG0329 Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase; InterPro
FT                   IPR002220:IPR020625; KEGG: bld:BLi03702 hypothetical
FT                   protein; PFAM: dihydrodipicolinate synthetase; SPTR:
FT                   Dihydrodipicolinate synthase; PFAM: Dihydrodipicolinate
FT                   synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79656"
FT                   /db_xref="GOA:E1RBC6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBC6"
FT                   /protein_id="ADK79656.1"
FT                   /translation="MNSEFIKGIIPPIVTPVTVDEQIDEQALRNQIDFMIDGGIDGILA
FT                   FGSNGEFYMFGQEEMRFVLSVLIDQVRGRIPVYMGIGAIRTSTCINLAKMGLDLGVDGI
FT                   SVLQPMFLKPTEDELETHLSSIAESISGTPMLLYNNPGRTGYGMSQDMVWRLAHTYENI
FT                   VGMKDSSGDMTQTIEFIRRNRDVGFRVMSGKDTLIYSGMCAGAVGAVCSTANFLPDLVC
FT                   SIYRKFIAGDCQGSLEAQWRLNPIRLQMDKSSFPVATKDYANLLGHEVGRPVLPSKCSP
FT                   EPIMAQLGKCLKDNGFLLAEHGTSS"
FT   gene            528203..528679
FT                   /locus_tag="Spirs_0511"
FT   CDS_pept        528203..528679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afn:Acfer_1103 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Tripartite
FT                   tricarboxylate transporter TctB family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79657"
FT                   /db_xref="GOA:E1RBC7"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBC7"
FT                   /protein_id="ADK79657.1"
FT                   /translation="MYRKYKDVVSAVIIFMAGLIYFILSFSIRQYGDAAVDSSFLPRIL
FT                   GGLLLLLSSVQIVSGIRKANAISVSDKDSMVGHVGYLPVVLTLLLMFAYAAGMKPLGFL
FT                   LSTIAFVFFQALVLIPKKQRNYIVISIVSVVFSVAVYLVFTRVFSLVLPHGILG"
FT   gene            528692..530179
FT                   /locus_tag="Spirs_0512"
FT   CDS_pept        528692..530179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0512"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="COGs: COG3333 conserved hypothetical protein;
FT                   InterPro IPR002823; KEGG: afn:Acfer_1102 protein of unknown
FT                   function DUF112 transmembrane; PFAM: protein of unknown
FT                   function DUF112 transmembrane; SPTR: Putative
FT                   uncharacterized protein; PFAM: Tripartite tricarboxylate
FT                   transporter TctA family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79658"
FT                   /db_xref="GOA:E1RBC8"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBC8"
FT                   /protein_id="ADK79658.1"
FT                   /translation="MILQSFLAVVSPVCFLWILLGTVVGIIFGAIPGLTATMAIVMFIP
FT                   VTYSLPPVVSIALLMSLYIGGISGGLIPAILLNIPGTPASIATCFDGRPMAVNGEGGKA
FT                   LGYGVVFSFFGTVLSVLALVLISPLLAALAIKFGPFEYSAVTIFSLSLIITLSAENLVK
FT                   GLITGIIGLIFATVGMAPIDSVTRYTFGTVNLRSGFDILTVLVGIYAIPEILAAAENSR
FT                   MLNKIDTSAIGKVSIRGFGFSFKDFVGQIWNATRSALIGIGLGILPGIGNGTSNILAYS
FT                   VAKNQSKHPEKFGTGIPDGIVATESANNATIGGTIIPLLTLGIPGDSTAALLLGAFIIN
FT                   GITPGPLIFQQNGNIVYAVYFAMILASIAMLLFELFGINLFVKILQIPKHLLFPIVFIL
FT                   CAIGAFGLNNRLFDVYVLICFGIVGYFLKKSDYPLPPLILGFVLGPIFELNFRRALSYS
FT                   QGSFLPFLTQPIALAFLVLTIVSVGFGISKRRRRGAF"
FT   gene            530219..531190
FT                   /locus_tag="Spirs_0513"
FT   CDS_pept        530219..531190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3181 conserved hypothetical protein;
FT                   InterPro IPR005064; KEGG: asu:Asuc_1849 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR:
FT                   Uncharacterized protein UPF0065; PFAM: Tripartite
FT                   tricarboxylate transporter family receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79659"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBC9"
FT                   /protein_id="ADK79659.1"
FT                   /translation="MKKRLMIVAVFVLCLTSVWANGQKEKGTDDWPSKPIQMIVPFRAG
FT                   GDSDFNARVYAKYLEDVLGQSIVVVNVDGGGGSIGATEAKNATPDGYTVFLGDVALALN
FT                   EASSLTDFGYEAFECAGIVGKNSGEYLTVRSDFPADSAPELIALTQEEPNKYKLAANTG
FT                   ATTYYAASVLKKLGAQFNIVNAGSSSERVASLKGGHIDAMFNSMGTIKDYVQNDDFKIL
FT                   GSAASERAQAYPDYPTMKEQGIDLAYDITYVMYFPKGTDPEIAQKFHAACKIVSENPEY
FT                   AEEIFKAYGQFPYVADIDTSLKLLKEERDKFMAFKDEFSTGK"
FT   sig_peptide     530219..530278
FT                   /locus_tag="Spirs_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            531275..532474
FT                   /locus_tag="Spirs_0514"
FT   CDS_pept        531275..532474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0514"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; InterPro IPR001176:IPR004839:IPR004838;
FT                   KEGG: gym:GYMC10_4661 aminotransferase class I and II;
FT                   PFAM: aminotransferase class I and II; SPTR: Aspartate
FT                   transaminase; PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79660"
FT                   /db_xref="GOA:E1RBD0"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBD0"
FT                   /protein_id="ADK79660.1"
FT                   /translation="METNKQLFAEPEHLHSVGFSPVRQVMEKMRTLERQGHQVIPFQIG
FT                   EPDFDTPRCIVEATKQALDAKFTHYAPNRGSVEFRKAIGQLLFQKGLQYDPETEILVTV
FT                   GGAEAIFDGVFAFLDKGDEVIVPTPSFMNYRNDIAMAGGRFVELPLRAEDSFQINITAL
FT                   KQAITPKTKMLIINNPSNPTGIIFTPDVLKQVAKIAVRYNLIVFSDEIYDEIVYDGTPC
FT                   VSIATFPGMRERTIVMNGFSKSFAMTGWRVGYLAAPPSVITTMLKVHQYVSTCIPTFIQ
FT                   EGLASSMLSAECQADRRAMVAAFSRKRKLLLEGLSTIPQLRFSVPHGAFYVFVDVSSSG
FT                   VDGSQFADRLLAERHVAVVPGIGFSPSASRFVRFSFATSEENIREGVERIRRFVGSLAK
FT                   "
FT   gene            complement(532648..534744)
FT                   /locus_tag="Spirs_0515"
FT   CDS_pept        complement(532648..534744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0515"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR003660:IPR004089:IPR016160; KEGG: dba:Dbac_1421
FT                   methyl-accepting chemotaxis sensory transducer; PFAM:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein; SMART: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SPTR:
FT                   Methyl-accepting chemotaxis sensory transducer; PFAM: HAMP
FT                   domain; Methyl-accepting chemotaxis protein (MCP) signaling
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79661"
FT                   /db_xref="GOA:E1RBD1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBD1"
FT                   /protein_id="ADK79661.1"
FT                   /translation="MKLSIATKIGGSFAIMILLALFVGGVGIFSLERYRRSVDSATNAH
FT                   MINEMILEVRKTEKNYLLRKNSSDIDLLKKQMQGITSLAEETAAILADKENKALMREVG
FT                   TGGEAYKKAFDEMTASIDRENQAVGVWVDVGNIFTDTTDRIQNSVIAPKVAEAMQSRDF
FT                   DTLMKWQRIETYLANSVIAKFWQVRYHALAYAYTDKSDERWEQFNTVIDEFEANLTRWE
FT                   EISTGEEQIGSAVTVIRKALADYREASQNFRNESLTQRKLEESLVESARSGQDLIQKAL
FT                   DNLEADRTNARLQARSLTLTFLIIVLLFGVILAILITRSITIAMTQGVAFAKEIAKGNL
FT                   SARLSYNSKDEIGALADAMREMVAKLRDIVQDVNSASEGVRTGSEEISSAAQQLSQGAT
FT                   EQASAAEQVSSSMEEMSSSIKQNADNSTQTERIAKKVAEDAETGGKAVFETVAAMRQIS
FT                   EKIQVINEISRQTNLLALNAAIEAARAGEQGKGFAVVAAEVRKLAERSQSAASEIITLT
FT                   KNSVSVAEDAGKLLEQIVPEIRKTADLVQEISAASGEQDSGASQINQAIIQLDQVIQQN
FT                   ASFSEELASMSEELAGQAANLSDTISFFSLTEDRSGTRIEQKKSLPSPPKSITAPKKIK
FT                   KPAARKKEQTGIVPAKPQPSQAKEKAKDKQETKPVTGIPMSAILGDKPVPGGPDKLDDD
FT                   FEEF"
FT   sig_peptide     complement(534670..534744)
FT                   /locus_tag="Spirs_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(534840..535529)
FT                   /locus_tag="Spirs_0516"
FT   CDS_pept        complement(534840..535529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0516"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="COGs: COG0566 rRNA methylase; InterPro IPR001537;
FT                   KEGG: ter:Tery_2249 tRNA/rRNA methyltransferase (SpoU);
FT                   PFAM: tRNA/rRNA methyltransferase (SpoU); SPTR: tRNA/rRNA
FT                   methyltransferase (SpoU); PFAM: SpoU rRNA Methylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79662"
FT                   /db_xref="GOA:E1RBD2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBD2"
FT                   /protein_id="ADK79662.1"
FT                   /translation="MSEAKSDEALIAYLKQFVTTRRWERIISILEERTRYITVVLEDIY
FT                   QPHNASAVLRSCEGFGIQDVHVIENRNRFTISSGVALGTSGWLDIHRYREEGAGNTLKA
FT                   VHELKAKGYRIVATSPHAQDINLEDFDISAGKSAFLFGNELEGVSQEAMALADEFMKIP
FT                   MRGFVESFNISVSCAIVLHHLSWKLRELDPALWKLNEEEKSQILLTWLRKSVKSADSLE
FT                   EHFRQQQ"
FT   gene            535646..536278
FT                   /locus_tag="Spirs_0517"
FT   CDS_pept        535646..536278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dat:HRM2_02050 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79663"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBD3"
FT                   /protein_id="ADK79663.1"
FT                   /translation="MYKEIGHVAGKGPDKNVSRNISPAARKRRDGFYLYRLRSSRRLFS
FT                   RIYCSFILWFLGRALASASLRDREIQQELEFLPENFGFALQVAEKGPAMVVVKNRDKTA
FT                   SYLGGAAAMRGRKLALIMRVKTLASAVLLFTFREGTAVSMARDRFATDGPLPETCAIVR
FT                   ALNRLETLLLPGCLARRAVKRYRKPSGLFWLRVSIYLGTFFGRGGNR"
FT   gene            536275..538161
FT                   /locus_tag="Spirs_0518"
FT   CDS_pept        536275..538161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0518"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="COGs: COG1454 Alcohol dehydrogenase class IV;
FT                   InterPro IPR001670:IPR018211:IPR000408; KEGG:
FT                   dat:HRM2_02030 Adh3; PFAM: iron-containing alcohol
FT                   dehydrogenase; SPTR: Adh3; PFAM: Iron-containing alcohol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79664"
FT                   /db_xref="GOA:E1RBD4"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBD4"
FT                   /protein_id="ADK79664.1"
FT                   /translation="MKDFRNPTKLNAGLKALDTLAGELASRSSFRPLFLLSPELGASFR
FT                   RLLRRGTELRELLLVCVPEAVGDAELVQLKDMLLEKECDGVVAVGGFPALSAARRIALQ
FT                   GTDALPVVALPCGSYCGSGVGHMSEEAVADVDVAILDPRLFRDGCGNKFSAKQNRLADT
FT                   SSCSLHGQVWAHVGNDLWAGSLSAHSSVMKRYLQALSLVVWELSSCPIAANDSPSSILP
FT                   AKRVPAYFEFTGRGRVVSGHGALSQLPELLADAGGARPMLLSDPGVAAAGLTARVERLL
FT                   SGAGIPPAVVDTAIPSDSDIETVRRLGYRYRESHCDSIVAVGGGSVIDTAKGVNILAGY
FT                   GGERLSDFAGAGKINRRLPPLIALPSTSGTGSEATLVAVIADHSEGKKLLYTSPFLQPD
FT                   IALLDPELTSSLPPFLTAATGMDALTHAVEAWFCLGHNPVSDRHALTAISLIGKHLLHV
FT                   VANPDDVSGRTALAQASNLAGLAFSNSMVGMIHSLGHSVGAACGVHHGMAMAILLPLGI
FT                   EYNLSRIGGDLGPVLEALTGTSSSPAGPALIAEVRRMNEELHRITEGRHPRSFSEIRDR
FT                   EGTPLVREEDLPRIAMLSQGDGSVLYNPEELDYDDALRVLKAAYEGGSLHAS"
FT   gene            538182..539159
FT                   /locus_tag="Spirs_0519"
FT   CDS_pept        538182..539159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0519"
FT                   /product="Protein of unknown function DUF1722"
FT                   /note="COGs: COG3272 conserved hypothetical protein;
FT                   InterPro IPR007553:IPR013560; KEGG: sat:SYN_02271 putative
FT                   cytoplasmic protein; PFAM: Protein of unknown function
FT                   DUF1722; protein of unknown function DUF523; SPTR:
FT                   Hypothetical cytosolic protein; PFAM: Protein of unknown
FT                   function (DUF523); Protein of unknown function (DUF1722)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79665"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBD5"
FT                   /protein_id="ADK79665.1"
FT                   /translation="MKKTFPRPKLFVSRCLGFDACRYNGLKIIDRSVELLKSHADIVTA
FT                   CPELAIGLGVPRKPIRVVEEEGRRMLYQPATENDYAAAMEAWLGDYLDALGPVDGFILK
FT                   AKSPSCGPWGVKRFTSRYQPGTSKIGAGFFGGEVVHRFLGCPIEEEGRLRNFTIREHFL
FT                   TFLFTLASFRDSVLRPGAGAKDLVRFHTTNKLLFLAYNQRIMREMGKLVARAGSESFEY
FT                   LTEEYRVSLGRLFSKPPKPNAMINAFEHAFGGLSDKLSPAERSFFIDTLEEYRDERIPV
FT                   STIVHLLVGWALRFGNDYLLEQSLIAPFPSDLVEITDSGKGRNR"
FT   gene            539274..539981
FT                   /locus_tag="Spirs_0520"
FT   CDS_pept        539274..539981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0520"
FT                   /product="GntR domain protein"
FT                   /note="COGs: COG2186 Transcriptional regulators; InterPro
FT                   IPR000524:IPR008920:IPR011711; KEGG: cpy:Cphy_1561
FT                   regulatory protein GntR HTH; PFAM: GntR domain protein;
FT                   regulatory protein GntR HTH; fatty acid responsive
FT                   transcription factor FadR domain protein; SMART: regulatory
FT                   protein GntR HTH; SPTR: Transcriptional regulator, GntR
FT                   family; PFAM: Bacterial regulatory proteins, gntR family;
FT                   FCD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79666"
FT                   /db_xref="GOA:E1RBD6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBD6"
FT                   /protein_id="ADK79666.1"
FT                   /translation="MGDCIPRKAKSLKEQCINYLEERIISGDFPSGHRLPSERALAGML
FT                   RVSRPVVHESVVELSNRGFITILPRRGCIVNDFRTTGSSELLSSLFRYASGSLRPDILS
FT                   GMAEMRLLFETEMARLAALRRSNEGIVRLKAALRQEVKVAESVDWRGKVIAEADYAFHH
FT                   AIALAGENIVYQMLMNSFRTLYLNVLSRFYGKRFDLRPILDKHRALLANIVEGKGEDAA
FT                   WEMKGLLTMNKAV"
FT   gene            540014..540622
FT                   /locus_tag="Spirs_0521"
FT   CDS_pept        540014..540622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0106 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79667"
FT                   /db_xref="GOA:E1RBD7"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBD7"
FT                   /protein_id="ADK79667.1"
FT                   /translation="MDTRRIIEHRLYRVKKIVYSGIAMILAIALNILLIRLNLLFDSPL
FT                   YLNTIGSFSVILLYGLVPALFTAFFTHLIGALFFSWQVAFFPFLFSHLVVLVLFYMLLR
FT                   RNNFVTIVDVVIAVAIIAFANTLTSSTIAALLYHGISGHSSDYLIIGFMSAGVSPFWAG
FT                   FWGRFPINLVDKGLTLFLVYGLKRMIESGRGREKKDILP"
FT   gene            complement(540628..541689)
FT                   /locus_tag="Spirs_0522"
FT   CDS_pept        complement(540628..541689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0522"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro IPR000160;
FT                   KEGG: tpp:TPASS_0981 possible sensory transduction
FT                   histidine kinase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein; SPTR: Sensory
FT                   transduction histidine kinase, putative; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain; TIGRFAM:
FT                   diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79668"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBD8"
FT                   /protein_id="ADK79668.1"
FT                   /translation="MTEAQNQPKSNEELEKELFDIRQLLEISKSLSSQLDLSSLLDSIL
FT                   YICMGQMRVTQAALFARNDLDSKSLRLTRNQEGFLLDHNRDYQISIDDPLSFQFLHEPR
FT                   CYTLEESRSLCPSAPALQIIGLLSPTLLIPLIARGHLTGIILLGERIQGGLYTPKEERY
FT                   LLDISRLASSALYNAILFEMSTTDMMTHLRFRHYFTTVVSDKLMEKGDFYSFSIIMLDI
FT                   DHFKKVNDTYGHTAGDEVIKSVSRIIRDNLRQQDMGVRYGGEEFLVFLEEVPETTAYDI
FT                   AERLRKKVGTCHEELMACSEQVTISAGVAHYRPSVDKNIEACIHRADVALYYSKRNGRN
FT                   RTTCASEIEQLEQ"
FT   gene            541761..542432
FT                   /locus_tag="Spirs_0523"
FT   CDS_pept        541761..542432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0523"
FT                   /product="nuclear protein SET"
FT                   /note="COGs: COG2940 Proteins containing SET domain;
FT                   InterPro IPR001214; KEGG: dol:Dole_0979 nuclear protein
FT                   SET; PFAM: nuclear protein SET; SMART: nuclear protein SET;
FT                   SPTR: Nuclear protein SET; PFAM: SET domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79669"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBD9"
FT                   /protein_id="ADK79669.1"
FT                   /translation="MMEMNRNIRQHFFDTGLMWLTRPRLESEQLRKLTPEFMLSLDYFL
FT                   ENREEFLALERLYGNAVRNGVLASFGIASVDKDIGLGLFAAEPLKREDFVGEYTGIVRE
FT                   AREIDADEIDAAGHYPDDWAWDYPVDIPGLPPLEIDAATEGNPLRYVNHSLFPNLRPDH
FT                   FLLDGVWVIIFVADRDIERGEELTIDYGDAYWSDGFRELVLREGELEKLGLRDHIDHME
FT                   S"
FT   gene            complement(542489..543244)
FT                   /locus_tag="Spirs_0524"
FT   CDS_pept        complement(542489..543244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0524"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1126 ABC-type polar amino acid transport
FT                   system ATPase component; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: bpu:BPUM_3298
FT                   glutamine ABC transporter ATP-binding protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79670"
FT                   /db_xref="GOA:E1RBE0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBE0"
FT                   /protein_id="ADK79670.1"
FT                   /translation="MTRFKEPLIRVEAIGKWYGELHVLKGLSLDVAEGEVVVIIGASGS
FT                   GKSTLLRCMNFLEIAQQGKIYLDGEHIKPINKVLNRVRQDMGMVFQHFNLFPHMSVLQN
FT                   VIEGPVHVKGMPKKEARELGLHLLEKVGLEDKPETYPAMLSGGQKQRVAIARALAMQPK
FT                   VMLFDEPTSALDPELVGEVLGVMEELGKEGMTMVVVTHEMWFAKEAAHRVVFMDEGTIL
FT                   EEGTPEKIFSNPVEERTQAFLKQILPPDA"
FT   gene            complement(543231..543908)
FT                   /locus_tag="Spirs_0525"
FT   CDS_pept        complement(543231..543908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0525"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="COGs: COG0765 ABC-type amino acid transport system
FT                   permease component; InterPro IPR000515:IPR010065; KEGG:
FT                   dsa:Desal_3318 polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Polar amino acid
FT                   ABC transporter, inner membrane subunit; TIGRFAM: polar
FT                   amino acid ABC transporter, inner membrane subunit; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component; TIGRFAM: amine acid ABC transporter, permease
FT                   protein, 3-TM region, His/Glu/Gln/Arg/opine family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79671"
FT                   /db_xref="GOA:E1RBE1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBE1"
FT                   /protein_id="ADK79671.1"
FT                   /translation="MEHIFPWDFSVIPAKFLLFRDAALLTLEITTLGILTGLVLGLIAA
FT                   LGTISRNKVAHGVSSAYIFLIRGTPLLLQLFIIYYGLTTVVTIPPFPSAIIALGVHNGA
FT                   YIAEIFRGSIQSIHYGQMEAARSLGMPRRKAMRRIILPQAFKRAVPSLGNQFIIALKDS
FT                   SLASTIAVPELLLKGRQLGSSTFMYMEMLIIVAIWYLIMTSVLTIGVHRLEKRLRVSDR
FT                   DQI"
FT   gene            complement(543921..544694)
FT                   /locus_tag="Spirs_0526"
FT   CDS_pept        complement(543921..544694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0526"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="COGs: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain; InterPro
FT                   IPR001320:IPR001638:IPR018313; KEGG: dsa:Desal_3319
FT                   extracellular solute-binding protein family 3; PFAM:
FT                   extracellular solute-binding protein family 3; SMART:
FT                   extracellular solute-binding protein family 3; ionotropic
FT                   glutamate receptor; SPTR: Extracellular solute-binding
FT                   protein family 3; PFAM: Bacterial extracellular
FT                   solute-binding proteins, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79672"
FT                   /db_xref="GOA:E1RBE2"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBE2"
FT                   /protein_id="ADK79672.1"
FT                   /translation="MKRITSVLLMIALLLPAATLFAGGKQESSDNTISFAGSGGYPPFN
FT                   FITENGDVEGFDVDVAAEIAKRMGKTLEYKTTAWDGIIEGLRAGRYDGILGSMGITEER
FT                   EKVVDFSDPYYYSGPQLIVRKDSGIDGPSELSADNTIGLVTGTTFEGDANALGVKVKLY
FT                   EDDNQTLMELLNGRVDGVLTDRIVGLNAIGKLKGGDKLTLVGSVLRTEKMGIAFQADDD
FT                   ELRETVNTILAEMRSDGTLKRISGKWFNGEDITVE"
FT   sig_peptide     complement(544629..544694)
FT                   /locus_tag="Spirs_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            545158..546096
FT                   /locus_tag="Spirs_0527"
FT   CDS_pept        545158..546096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0527"
FT                   /product="Cache domain protein"
FT                   /note="InterPro IPR004010; KEGG: ilo:IL0202
FT                   methyl-accepting chemotaxis protein; PFAM: Cache domain
FT                   protein; SPTR: Methyl-accepting chemotaxis protein (HAMP,
FT                   Cache domains); PFAM: Cache domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79673"
FT                   /db_xref="GOA:E1RBE3"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBE3"
FT                   /protein_id="ADK79673.1"
FT                   /translation="MEQIRCSIKTKLNLSIGSAVLFFLALLLVISYGLFKDSALKSTEA
FT                   LSLALLDGTDKQIDAFFGELERITRSVAEFPSVRGVETERMQLEFLATVRARKRMLRAV
FT                   YLGTAEGQMYEWGYGPGFVDNAPVFPSDYDPRERPWYKAALTAGDYTITRPYLYASVPA
FT                   IGITAVIPVRTEGGRFVGVLGVDVMLSDLQQIVDEMDMHHIGKVVLLNKEQVPIVNQFA
FT                   EGVFDPSVVPSEGDGSFIHTFGGQLFYVASKQNRSSGWTLLLALPYRNIMERPMATIRL
FT                   MIMLDVMLMLFLFVALGALSTALSFIRYSPS"
FT   gene            546099..546896
FT                   /locus_tag="Spirs_0528"
FT   CDS_pept        546099..546896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0528"
FT                   /product="histidine kinase"
FT                   /note="COGs: COG4585 Signal transduction histidine kinase;
FT                   InterPro IPR003594:IPR005467; KEGG: rca:Rcas_4226 integral
FT                   membrane sensor signal transduction histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; SPTR: Integral
FT                   membrane sensor signal transduction histidine kinase;
FT                   manually curated; PFAM: Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79674"
FT                   /db_xref="GOA:E1RBE4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBE4"
FT                   /protein_id="ADK79674.1"
FT                   /translation="MIRTVESGKQDISMAVDTGDEIALLADELNALVVRVNDYSRKMEE
FT                   EVRRRTKQLTALQQENLRLRVIEEKERIYGYLHDSLGARLTNIFLSNSVAQNSHDPELL
FT                   KNMHERIEDNTQLAIGDLKEILAGADTDTRRIIDFRRLVTHTLGDRLKLRYITFQCNIE
FT                   DSDPLNELPYALRFELENILQELVSNVLKHSGAKSVTLDISVHDGVVRIAFEDDGKGFD
FT                   PSEASIGFGIRNMMNRVRGMGGRFSLDSKPGGGTRVSIEVEAR"
FT   gene            546893..547543
FT                   /locus_tag="Spirs_0529"
FT   CDS_pept        546893..547543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0529"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterPro IPR001789:IPR000792; KEGG: cpi:Cpin_4160 two
FT                   component transcriptional regulator, LuxR family; PFAM:
FT                   response regulator receiver; regulatory protein LuxR;
FT                   SMART: response regulator receiver; regulatory protein
FT                   LuxR; SPTR: Two component transcriptional regulator, LuxR
FT                   family; PFAM: Response regulator receiver domain; Bacterial
FT                   regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79675"
FT                   /db_xref="GOA:E1RBE5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBE5"
FT                   /protein_id="ADK79675.1"
FT                   /translation="MIRIMICEDEREAREGFRYLLGLDEEIRVVGAFASAEQLIDSIRE
FT                   VGTPDVVMMDIGLPEMSGIEATRIIHEKWPQINILILTIFEEEEKILSAIQAGASGYVL
FT                   KNTRPGELTSQIKALYRGGSPISPQIARTLLGELRKEKSPADHVDYNLTPRELDVVKGI
FT                   IAGYTYREIADRYNISGSTVKKHILHIYKKLNVSSRVEFMKKMYGPNGPLSAL"
FT   gene            547662..548954
FT                   /locus_tag="Spirs_0530"
FT   CDS_pept        547662..548954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0530"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="COGs: COG1301 Na+/H+-dicarboxylate symporter;
FT                   InterPro IPR001991:IPR018107; KEGG: aco:Amico_0277
FT                   sodium:dicarboxylate symporter; PFAM: sodium:dicarboxylate
FT                   symporter; SPTR: Proton/sodium-glutamate symport protein;
FT                   PFAM: Sodium:dicarboxylate symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79676"
FT                   /db_xref="GOA:E1RBE6"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBE6"
FT                   /protein_id="ADK79676.1"
FT                   /translation="MSAQEKKGVMDWYFKSNLLVRILIGLVLGAIAGIIFGSSILWIAP
FT                   FGDLFVRLLKMIVMPVIFATLVVGAASISPARLGKVGIKIVLFYLLTSAFAVAIGLIFG
FT                   NLFHPGTGLDLASVANASGRELVKPSLTSTLLNIVPTNPFSAIAGGDVLPTIFFAIIFG
FT                   IGISYLKISENDRIKQAGDVLFRVFDGAAEVMYMVVRWVLQYAPVGVFALIAVVFAKQG
FT                   AAAVGPLGKVTLAVYIALIVHVFLVYGGLLTANKLNLFHFLSGAKEAMLTAFVTRSSSG
FT                   TLPVTMKCSEENHGVDRNIYSFTLPLGATINMDGTAIYQGVCALFIGFAIGLPLNFTQQ
FT                   ITIIITAVLASIGTAGVPGAGAIMLLMVMDSVGLPITEGSPVAAAYAMILGIDAILDMG
FT                   RTCINVTGDMTGTLLIAKSEKQVDMSKWQKK"
FT   sig_peptide     547662..547757
FT                   /locus_tag="Spirs_0530"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(549026..550228)
FT                   /locus_tag="Spirs_0531"
FT   CDS_pept        complement(549026..550228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0531"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR001958:IPR011701; KEGG: sti:Sthe_3125 major facilitator
FT                   superfamily MFS_1; PFAM: major facilitator superfamily
FT                   MFS_1; SPTR: Major facilitator superfamily MFS_1; PFAM:
FT                   Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79677"
FT                   /db_xref="GOA:E1RBE7"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBE7"
FT                   /protein_id="ADK79677.1"
FT                   /translation="MEHWQRNLYTVWFTQILSLTGFGFVLPFIPFFLQELGVTDPVELK
FT                   QWVGWISAVPGISMGIAAPIWGALSDRYGRKLMMLRAMATGTIILAIMSTVQSPMSVLL
FT                   LRLCQGFFTGTVTAAATLVAAGTPSDKLSSSLGLLASSTFIGYIIGPTIGGLSAEYLGY
FT                   RVSFLIGSGVMLTSFILVLFLVREPKEGRKQRNKENGKRGISAFSEAVRALPWKQIGPL
FT                   LIILFLLRAARSMPTPFLPIQVQLLRGKVEGAAAIMGAISGVIGLVTAISGILLGKLGD
FT                   RHPRLKLISIFALAASILVLPASVMNSIMGFTIFFVAGSFFAGGLEPLMQSHLTSLTSA
FT                   ENRGTLFGIQTTVGSLGWAISPLIGSVLSIHFSIPSVFVAMSGFLLLASFVARINYKKH
FT                   R"
FT   gene            550315..551556
FT                   /locus_tag="Spirs_0532"
FT   CDS_pept        550315..551556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0532"
FT                   /product="rRNA (guanine-N(2)-)-methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="COGs: COG0116 N6-adenine-specific DNA methylase;
FT                   InterPro IPR000241:IPR002052; KEGG: sfu:Sfum_1764 putative
FT                   RNA methylase; PFAM: putative RNA methylase; PRIAM: rRNA
FT                   (guanine-N(2)-)-methyltransferase; SPTR: Putative RNA
FT                   methylase; PFAM: Putative RNA methylase family UPF0020"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79678"
FT                   /db_xref="GOA:E1RBE8"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBE8"
FT                   /protein_id="ADK79678.1"
FT                   /translation="MSPQNERETFRGLAVKRRGSKPWERDLKRYLRGPRHRWIVTAPFA
FT                   FRPSLRRELEDLALQSIEKHGAGFCFEARISEIYPVLMRLQCASRLFLLVDSFRAGAAE
FT                   ELYRRIVTLPWELLLHDGIALSVHVSLRRCRIEHEGAAEHTLYQALERRAEEAGLSLSV
FT                   SNDAPSQMIELFGEDNHFELRLDACGEQLYRRGYRPLVGPAPIRENIAASLLQWYRIEC
FT                   GPFSLFVDPMCGSGTFPIEAWAMASHFPLAGHRRFSIFLWPVFSKAAWNWEAHRLYGEA
FT                   DITAADEPLFWGSDKDPKMVHISRLNGERAGAAGNIGFLHEDFFHLSPQDLFSSDHVSR
FT                   VEGNRGALLAINPPYGVRLKGDDNLFVRIIDRKKRIWQGWDLLLLAPRSLALPPGKKSI
FT                   DFENGGIPMKCILF"
FT   gene            complement(551553..552404)
FT                   /locus_tag="Spirs_0533"
FT   CDS_pept        complement(551553..552404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0533"
FT                   /product="protein of unknown function DUF125 transmembrane"
FT                   /note="COGs: COG1814 Uncharacterized membrane protein;
FT                   InterPro IPR003251:IPR008217; KEGG: hor:Hore_01890
FT                   uncharacterized membrane protein; PFAM: protein of unknown
FT                   function DUF125 transmembrane; Rubrerythrin; SPTR:
FT                   Uncharacterized membrane protein; PFAM: Rubrerythrin; VIT
FT                   family; TIGRFAM: Tat (twin-arginine translocation) pathway
FT                   signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79679"
FT                   /db_xref="GOA:E1RBE9"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039376"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBE9"
FT                   /protein_id="ADK79679.1"
FT                   /translation="MDMIAEMQRNEITEYQVYRKIAKREKDPENQKVLLRIAEEEKRHH
FT                   DIWARYTGGNAKPKRFKVWFFPFLARLLGLTFAVKLMELGESSAAQAYTKLAETVPEAK
FT                   GIVDDEERHEAELLRLLNEQRLEYVGSIVLGLNDALVELTGALAGLTFAFRNGSMIAAA
FT                   GLITGIAASFSMAASEYLSNQSEGNHEKALTSAVYTGIAYIVTVTLLILPFFIFSNSYV
FT                   SLGVTLLVAALIILGFTFYISVAKELPFRRRFLEMISLSFGVAAISFALAALVRTVFGI
FT                   DA"
FT   gene            complement(552472..555630)
FT                   /locus_tag="Spirs_0534"
FT   CDS_pept        complement(552472..555630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0534"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR000014:IPR001610:IPR003661:IPR003594:IPR
FT                   004358:IPR013767:IPR013655:IPR005467:IPR000700; KEGG:
FT                   mgm:Mmc1_2953 multi-sensor hybrid histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS fold-3 domain protein; PAS fold
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS domain
FT                   containing protein; PAC repeat-containing protein; SPTR:
FT                   Sensor protein; TIGRFAM: PAS sensor protein; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   His Kinase A (phosphoacceptor) domain; PAS fold; TIGRFAM:
FT                   PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79680"
FT                   /db_xref="GOA:E1RBF0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBF0"
FT                   /protein_id="ADK79680.1"
FT                   /translation="MTMPKPLIITLRKSLYPFIFGSILALLVTIIPLQTLTAYRFHRDQ
FT                   QKIVTATIASTIQKYLTVADTSLTFLSKQPTERMNDHLTSFQESFKIFSKIAFADTDGT
FT                   VVAANSKIQAHQDVSNLLHEAVPTPGLTSLSTGPIISPHTGKLCIFLVHPLEGQGNIIA
FT                   ELNNNYLFDQMMQTIGMVNIENLVFVTDQSGNLLLHPDPRLLQQKANWGDLPVIHDIRQ
FT                   NDGETSAFVSIGERLYIAVARSIPETHWILTYAVPISATALEIIGSLVLTTLLFLFFIG
FT                   SVLIILKRTLENNIVRPLTQMQHIIEQSVIEKTPQTIGVIANSFSELETMRKVFNRLSK
FT                   TIRQKTLSLIEFKRAVREAGHAIYMTDREGIITYTNPAFERITGYSWEEAEGKTPNILN
FT                   SGMMPESYFARLWESILAGELWEEEIINRKQDGTIYYAHQTIAPIFSDFGMVISFVAIQ
FT                   NDVTQQRESERRLWESETLYRNLFETAADSILLINPETLGISECNQATIESLGYGKDEI
FT                   KQLSYLDIQPPDHQQRVKELVQGISEFDQATFDTQHTTKTGELREVNVHMTLLNLDQRK
FT                   LLLAIMHDVTERRQAERTIQQSERKYRMLAENSSDMISQHAPGGIYLYVSPACIRLLGY
FT                   EQEELLGRQVEEIIHPEDIERVIEIGKNHLGSPSERITTLVYRIQKKDGSYTWFETHSR
FT                   RTDSQEIIAISRDISERIAMERGLEEANKAKSMFLANMSHEIRTPLNAVLGFNDLIARN
FT                   TSDPKLKEYAAQIDLSGKNLLTLIGDILDFSKVEAGGVQFNYDFFSPHHLVREIIALFE
FT                   MEAKKRGIDLITKERTPIPKQIKLDEDRVRQILINLVSNALKFTEKGSVCLEIHAAYIK
FT                   QKDQRCNLTFSVIDTGIGIPEKEQHVIFEAFRQQEGQSTRKYGGTGLGLAISKNLAEGM
FT                   EGSIDVKSNVGSGSTFTLSFDSVEWRSADDEEGALQPDEKHRKEHDSKRQSSIVLPASL
FT                   QKQWEAVRLVRAIDEIADFAELLKREASKEEHPELIDFANQLERACDELDIEEIEYLLE
FT                   KTGP"
FT   sig_peptide     complement(555526..555630)
FT                   /locus_tag="Spirs_0534"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            555701..556717
FT                   /locus_tag="Spirs_0535"
FT   CDS_pept        555701..556717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0535"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="COGs: COG2334 Putative homoserine kinase type II
FT                   (protein kinase fold); InterPro IPR002575; KEGG: dps:DP2064
FT                   hypothetical protein; PFAM: aminoglycoside
FT                   phosphotransferase; SPTR: Aminoglycoside
FT                   phosphotransferase; PFAM: Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79681"
FT                   /db_xref="GOA:E1RBF1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBF1"
FT                   /protein_id="ADK79681.1"
FT                   /translation="MENEKPPAGIFDYIEPDGIISAVEISYGINLDGTWSAFPSYVNRV
FT                   YGLRDEDGNRYVVKLYRPGRWSVSAIEEEHGFLLECAAEEVPVVAPLSGVDGRTLHFLE
FT                   CPAISGSYPFALFPLRSGRLFETDRDEDYLRIGSLIGRLHRISRQGKAHVRQEWLPSLS
FT                   KNHLEMLLEQNLVSSSLRRHFEGLCLHCIETIEPLFSHQPLLRLHGDCHRGNILERPGE
FT                   GLMLIDFDDMSNGPAVQDLWLLLPDRIGACEYQFSLLQEGYGQFSALSPGSALLIEPLR
FT                   FMRMLHYLAWTAHQQCDHDFSLRHPQWGSEAFWIRELADFEEQFDYIRKILDSSYTG"
FT   gene            complement(556705..557469)
FT                   /locus_tag="Spirs_0536"
FT   CDS_pept        complement(556705..557469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0536"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="InterPro IPR009875; KEGG: efa:EF0505 hypothetical
FT                   protein; PFAM: type IV pilus assembly PilZ; SPTR: Putative
FT                   uncharacterized protein; PFAM: PilZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79682"
FT                   /db_xref="GOA:E1RBF2"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBF2"
FT                   /protein_id="ADK79682.1"
FT                   /translation="MSNPSLLGRKVFFLYPHSVIKDEMIEEIVSEEYEAYVLKDHNRAA
FT                   RLMKAFPGSVLFINIDSTMKEPEWERYILEMKNSDQYDDPRIGIFTYDENQELAKKYLI
FT                   DYSLPAGFIRLKLGFAETKKILLDVLKANEAKGRRKFVRALCAKDAQATINVSRDGSII
FT                   QGKLLDISSAGAACAFPQEGLFSPKSYLSDIQLQLRGARIMLNAIVMGTRQDDARVHVI
FT                   LFDPKSTDGEKRRRVFRYIRGNLQRFIESYPV"
FT   gene            557537..558058
FT                   /locus_tag="Spirs_0537"
FT   CDS_pept        557537..558058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0537"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="COGs: COG0693 Putative intracellular
FT                   protease/amidase; InterPro IPR002818:IPR006286; KEGG:
FT                   oih:OB0506 intracellular proteinase; PFAM: ThiJ/PfpI domain
FT                   protein; SPTR: C56 family peptidase; TIGRFAM: intracellular
FT                   protease, PfpI family; PFAM: DJ-1/PfpI family; TIGRFAM:
FT                   intracellular protease, PfpI family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79683"
FT                   /db_xref="GOA:E1RBF3"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBF3"
FT                   /protein_id="ADK79683.1"
FT                   /translation="MLHVVSLIHDQFEDLELWYPVLRLREAGASVLLAGEKAGVEYHGK
FT                   YGVPAHADISFDEIDPDSIDALLVPGGWAPDKLRRFPKVLDAVRAMFRQEKVVGQICHA
FT                   GWVLVSAGVLNGYRVTSTPGIRDDMTNAGAIWLDEPVVVDRNLVSSRRPPDLPDYLKAL
FT                   VKLLQEKTVR"
FT   gene            complement(558067..558948)
FT                   /locus_tag="Spirs_0538"
FT   CDS_pept        complement(558067..558948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0538"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: dal:Dalk_4084 protein of
FT                   unknown function DUF6 transmembrane; PFAM: protein of
FT                   unknown function DUF6 transmembrane; SPTR: Putative
FT                   uncharacterized protein; PFAM: EamA-like transporter
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79684"
FT                   /db_xref="GOA:E1RBF4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBF4"
FT                   /protein_id="ADK79684.1"
FT                   /translation="MDSKKTAVLALFAAPMLWGGALVAGRVVSAEMPPISAAFVRFVVT
FT                   TTLLALFLRIRGGKLPKPEKNILPALIAAGMTGVALFNVFLFSALATVSAGRSAVIIAM
FT                   TPAVVAMISAIIYKEKHQKLFPLALILAFLGAAIVISEGDPPSLFRTPPGKGELFMIGC
FT                   VFSWAAYSFAGKHVLKSFPPLPAIMYSSFFGALLLAIPAFLEGGLPRVFSASPSAWAGL
FT                   LYMSIGAAGVAHVFYYYGISKIGPSKSAIFMNLEPISALFFGMVLLGEEITMPLAIGSV
FT                   LVLSGVSLSVKE"
FT   sig_peptide     complement(558862..558948)
FT                   /locus_tag="Spirs_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(559085..559210)
FT                   /pseudo
FT                   /locus_tag="Spirs_0539"
FT   gene            559423..560340
FT                   /locus_tag="Spirs_0540"
FT   CDS_pept        559423..560340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0540"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu0156 hypothetical protein; SPTR:
FT                   Unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79685"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBF5"
FT                   /protein_id="ADK79685.1"
FT                   /translation="MKQLRLFSIIIMVLFILSCSTIPYSGMEVISETEGYNYFIRNKES
FT                   NSLIIYINGSGYKSVLGLRDHNHKWTETTLSNPLSQHFRDSYNILIPEKLDFSPGEIYL
FT                   DNPEVLSKSTVQALGLRYSGKIDSFLRKNNFDEIILIGTSEGGALLPFIYENLEYKNEI
FT                   DKMVIWSGGGLSQLKEFQILRDSSVEMPDQYRELCGQVTEMADTISKDPEAIDRYYLGH
FT                   PYIRWSSFFEYEPIELIKGIKIPILFIHGELDWSTPVESTRIIEDSNISDLFDFYYYPK
FT                   MEHSPSSVSELKKVLKDIEKWLIG"
FT   sig_peptide     559423..559500
FT                   /locus_tag="Spirs_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(560554..560627)
FT                   /locus_tag="Spirs_R0009"
FT   tRNA            complement(560554..560627)
FT                   /locus_tag="Spirs_R0009"
FT                   /product="tRNA-Met"
FT   gene            560751..561938
FT                   /locus_tag="Spirs_0541"
FT   CDS_pept        560751..561938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0541"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterPro IPR003594:IPR011495:IPR005467; KEGG: mth:MTH985
FT                   sensory transduction histidine kinase; PFAM: histidine
FT                   kinase dimerisation/phosphoacceptor; ATP-binding region
FT                   ATPase domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; SPTR: Sensory transduction histidine
FT                   kinase; PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79686"
FT                   /db_xref="GOA:E1RBF6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBF6"
FT                   /protein_id="ADK79686.1"
FT                   /translation="MKNLNQKNCGSVCSRADFFASLAVRYLQFPLGEIDYQQVGHDLVS
FT                   LSGAQSVFLNLYVADKHCIETKAFASSLTGGAVPSCGPSFVGRSWPMDDAVGKTFRSSE
FT                   LTSINAETGGGLDTMVHSLFSRFGEVGLWALGLLHDGRFLGNFFMVFEKEEQKPDRKGI
FT                   DAFTEIVVRLLLRKEKERQLQQNLTEKDLILRESHHRIKNNLSLISSLVALQGELLSPE
FT                   LASLLYPIISRINAIVLIHEQLHEAGSDGKQVRFETYVRRLVGELADSFRSDDSGITLS
FT                   ILRADHAFFEDGTAIPLGIILTELVMNSFKHAFKGLPGGRIDVSFMCEDQTAQLIVQDD
FT                   GRGMVSSDIPKQNSAGASLGLVLVESLTAQLQGHWEQSIGENGRGLKNTVAFPLP"
FT   gene            561961..563157
FT                   /locus_tag="Spirs_0542"
FT   CDS_pept        561961..563157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0542"
FT                   /product="RelA/SpoT domain protein"
FT                   /note="COGs: COG2357 conserved hypothetical protein;
FT                   InterProIPR019734:IPR007685:IPR001440:IPR013105:IPR 013026;
FT                   KEGG: tde:TDE1711 RelA/SpoT domain-containing protein;
FT                   PFAM: RelA/SpoT domain protein; TPR repeat-containing
FT                   protein; Tetratricopeptide TPR_2 repeat protein; SPTR:
FT                   RelA/SpoT domain protein; PFAM: Region found in RelA / SpoT
FT                   proteins; Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79687"
FT                   /db_xref="GOA:E1RBF7"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBF7"
FT                   /protein_id="ADK79687.1"
FT                   /translation="MDVPIMYPDRKRLEVAYRKRLPCLEQEREDLELQLKNLLQAEEIK
FT                   ATVKGRIKAFDSYYAKLLRKLSSMPMQSLSEQEIDTLIQDLVGVRILTPFLESVTDIER
FT                   LVRSRFSVFEVERKGEEQSFCEFGYRSIHLNIRLDSGQICEIQIRTILQDAWAEVEHEL
FT                   VYKGSFSPFDEPLKRKLAALNATLSLSDIIFQEVRDYQRKLNKELKHRRETFERQIKTE
FT                   LSGTPPLTRMENPPSYENIDDLDQSLLHALQVHNSGDYSGAVVLYGKILAGSLSKEIRV
FT                   ITLMHRGMARFADADYAGAEEDFLAALSSEGHRGKAHYYLGILYRVTGRPGQALNAFSA
FT                   ALEVNPYHFESLLGSARALYDLGDTEEALSYCNNALRLMPDDEAALVLRRTVARKLGL"
FT   gene            complement(563138..564049)
FT                   /locus_tag="Spirs_0543"
FT   CDS_pept        complement(563138..564049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0543"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctc:CTC02044 Ser/Thr and Tyr protein
FT                   phosphatase (dual specificity)#; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79688"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBF8"
FT                   /protein_id="ADK79688.1"
FT                   /translation="MDVPNRISKQPAVWGAFIFMTRKKSFKASFRVIHVIARHFFLLQF
FT                   ARKLRLIKTPVVDVDHPLDRKIPFSPKHVKLYLSFTYLWIRSLLFLYREFGEPVLQDIS
FT                   DYVDGISELYLESAKVYRRCMSTTDRPKHVGGPYFRLIHLSDPHLLCVPSLHVEIVSYN
FT                   FHKICDIIDRYAEDPTRYENEKHYLWEQAISITDSILFLKQHSVNCVAAGLFVLSSGKS
FT                   RVSPELARKVITHLLSKPDNGIEAEEEIRNYIMALYNRFEEEGKKQPFDKVLLNFLYTY
FT                   RNAAADIQSNEKSESKVKVQVF"
FT   gene            complement(564053..565246)
FT                   /locus_tag="Spirs_0544"
FT   CDS_pept        complement(564053..565246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0544"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG0535 Fe-S oxidoreductase; InterPro
FT                   IPR007197:IPR000385; KEGG: sfu:Sfum_2252 radical SAM
FT                   domain-containing protein; PFAM: Radical SAM domain
FT                   protein; SPTR: Radical SAM domain protein; PFAM: Radical
FT                   SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79689"
FT                   /db_xref="GOA:E1RBF9"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBF9"
FT                   /protein_id="ADK79689.1"
FT                   /translation="MKHNFSVVPEVLLKDPDMAKLLVSGFGRKRKAALVDRRFHPKTSK
FT                   EMSLLTFRITPLCNLRCVMCNQRGETGVLKGDYAIQEAKKLVPIERYKRLIDEVSPHKP
FT                   LFYVWGGEPFIYPDIMEFGKYVVEKGNLLSVNTNGTFLKARAEQIVRDRWHALFVSLDG
FT                   FEDINDTIRGSGSYKKVVEGFAEINKQKKLQGSNRPYMGIVTTISRLNYRYLDKLAEAA
FT                   RDFGIAWHIINLGTYTNSSIIEQHKRFMKEKLDSDIHCLDGFANGYNEGIDGELFAEVL
FT                   KRVHSMKNGYPIITVPAIKPEKIDTYYTQLEQPVRDQCSIPWFQGNIDYNGDVYFCSDY
FT                   PDYVLGNIMKEDSFYQIYNNERARRFRHVLKESKKGLMPGCVRCYQNMLFGKKIIGY"
FT   gene            complement(565251..566075)
FT                   /locus_tag="Spirs_0545"
FT   CDS_pept        complement(565251..566075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0545"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro IPR002347:IPR002198;
FT                   KEGG: sus:Acid_0989 short-chain dehydrogenase/reductase
FT                   SDR; PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   Short-chain dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79690"
FT                   /db_xref="GOA:E1RBG0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBG0"
FT                   /protein_id="ADK79690.1"
FT                   /translation="MESTQKGYALITGGGAGLGLEMAKLLAARSYPLILCGRRKEVLAS
FT                   GAQECLTCGAPKVKTISCDLVEAQAAERLAEEVSAVCTEEDTPLEILVNNAGRGLFGPV
FT                   IKQNKDDLAAMIKLNIESLANMCRLFVPMLTDRGKGNVLNVGSIAGGQPMPFFAGYGAT
FT                   KSFVHTFTLALRAELYGSGVSVTLLEPGFIRTGFDKAAGIESQKYRSFSFRKGMSADRV
FT                   ARSAVRALLAGRARVIPGFGNRISAFFGALLSDTLIATIMRISVMGLTGKKE"
FT   gene            566167..567402
FT                   /locus_tag="Spirs_0546"
FT   CDS_pept        566167..567402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0546"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="COGs: COG4585 Signal transduction histidine kinase;
FT                   InterPro IPR003594; KEGG: cac:CAC0864 histidine kinase-like
FT                   ATPase; PFAM: ATP-binding region ATPase domain protein;
FT                   SPTR: Histidine kinase-like ATPase; PFAM: Histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79691"
FT                   /db_xref="GOA:E1RBG1"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBG1"
FT                   /protein_id="ADK79691.1"
FT                   /translation="MGAMHEKKMERERLFAIFLIGVSLLSHMGAGLFFGVQEQHVDYLR
FT                   IHWHLPFYLLLAISAVLSILINLKIDSGKKQVILLIDVLLFFLIGYPLGPHLDIEIILG
FT                   INLITILVFSFSDLYGEKIALIIIVVTLMLQAPYSLWFTQVPAPSMENMIFAAFILVVF
FT                   TLFLSILKRVMNRLHHEEIRSRKYNRALDELTNNSFDYQHISRQNAMELIRTEKQYITR
FT                   EVHDIISYAMTNQLMLVQAAMSIKDKNSPVVDELLEKAKNEINGGMSKTRAALGELRDQ
FT                   EFDQEDVNLLVEQLIAKFKNFSHIDVQFRKDEFFSRLPRAYNQTIFHIIQQCMTNTYLH
FT                   SSADTIEILCEHEGRCVVVVVKDNGTNSRGFREGIGIKGMRERIEMLGGVLKISALSLG
FT                   FTVRAEIPIAEG"
FT   gene            567402..568073
FT                   /locus_tag="Spirs_0547"
FT   CDS_pept        567402..568073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0547"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterPro IPR001789:IPR000792; KEGG: cac:CAC0865
FT                   two-component response regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: response
FT                   regulator receiver; regulatory protein LuxR; SPTR: Response
FT                   regulator; PFAM: Response regulator receiver domain;
FT                   Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79692"
FT                   /db_xref="GOA:E1RBG2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBG2"
FT                   /protein_id="ADK79692.1"
FT                   /translation="MVVDTVRVLLVDDQLLFLESLKIVLENLSEEIEVCGLASSGHEAI
FT                   SLAATCRPDVILMDVSMPEMDGIEASARIKAERPDVNIIMLTTFEEKGKVQEAIKLGIN
FT                   GYLLKNLKPELLIQYILLSAEGGVFLSTEVADRLCRQGGDEKAGDEQAERCLDEEDSSY
FT                   KFLTRREKEVLKYLAMDMTNMEIAEKIHVGYQTIRNYISVIYSKLNVSNRMEVIKKIQE
FT                   L"
FT   gene            568180..569481
FT                   /locus_tag="Spirs_0548"
FT   CDS_pept        568180..569481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0548"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059:IPR006061; KEGG:
FT                   mmw:Mmwyl1_1651 extracellular solute-binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; SPTR:
FT                   Secreted sugar-binding protein; PFAM: Bacterial
FT                   extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79693"
FT                   /db_xref="GOA:E1RBG3"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBG3"
FT                   /protein_id="ADK79693.1"
FT                   /translation="MKKGFLSLWILLVMITIGTFFSCSKENDEAAAEKKNEVEKVALRM
FT                   GSWRMDDVAQMEAVLAEFTKTHPGIEILFQPTNPPDYNATLRLQLESGTGPDIMYARSY
FT                   ATGIQLFEDGYLSDLSSLSGLDTTYSEGNQAPWMTKDGKNFAIPFTAVSHGVFYNKDIF
FT                   KELGLSIPESWSDFLSVCKTIKAAGYIPVANSLGDEWDINEVVFMNLAPNFIGGREGRL
FT                   AYDEGKTPFNDKKVVALFQAMASLAPYLPEGFEALTYNDSNALFATGQAAMYFDGSWTL
FT                   GTFSDVDFDWGVFAPPAPDGQKVHYICFHPDAGMAINSSTKYPEEAKIFLEWLGSPEGA
FT                   QVLAENLPMGMFPMSNIAVEIEDPHAKEFLSLNDGRQLDVRWAWPELLGGDPSGYNLMM
FT                   EGSIGVITGRITPKQAADNLQEGLAKWYPPAQKW"
FT   sig_peptide     568180..568251
FT                   /locus_tag="Spirs_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            569551..570477
FT                   /locus_tag="Spirs_0549"
FT   CDS_pept        569551..570477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0549"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG:
FT                   hau:Haur_4034 binding-protein-dependent transport systems
FT                   inner membrane component; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; SPTR: ABC-type
FT                   sugar transport system permease component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79694"
FT                   /db_xref="GOA:E1RBG4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBG4"
FT                   /protein_id="ADK79694.1"
FT                   /translation="MQRYIEGRSQPFSWFLYILPALLVYLIFLAYPLFSSMLTSFMTGN
FT                   HAQIQTFVGFDNYVRLFTEEELSTRYFSAFRNTVVFFAIHMLVQNVLGMLFANFLQNKH
FT                   LKGRKFYQTIIFIPATLAIIVTGYLWKLILNPQWGAFNLILKALGSEHANFPWLGTPGV
FT                   SLVVISLVSSWQWVGIPTMFFISALGNIPDELYEAAAISGASPWQVFTNIKLPLILPTV
FT                   GVVSTLTFVNNFNAFDVVFAMENVNGAPDYSTDILGTFFYRTGIAGQHPIGIPDRGMGA
FT                   AVATVTFVVLIIGVALIRRITVKRDEV"
FT   gene            570480..571328
FT                   /locus_tag="Spirs_0550"
FT   CDS_