(data stored in ACNUC10043 zone)

EMBL: CP002117

ID   CP002117; SV 1; circular; genomic DNA; STD; PRO; 2843290 BP.
XX
AC   CP002117;
XX
PR   Project:PRJNA40773;
XX
DT   20-SEP-2010 (Rel. 106, Created)
DT   01-SEP-2017 (Rel. 134, Last updated, Version 7)
XX
DE   Methanolacinia petrolearia DSM 11571 chromosome, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Methanolacinia petrolearia DSM 11571
OC   Archaea; Euryarchaeota; Stenosarchaea group; Methanomicrobia;
OC   Methanomicrobiales; Methanomicrobiaceae; Methanolacinia.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2843290
RX   PUBMED; 21304750.
RA   Brambilla E., Djao O.D., Daligault H., Lapidus A., Lucas S., Hammon N.,
RA   Nolan M., Tice H., Cheng J.F., Han C., Tapia R., Goodwin L., Pitluck S.,
RA   Liolios K., Ivanova N., Mavromatis K., Mikhailova N., Pati A., Chen A.,
RA   Palaniappan K., Land M., Hauser L., Chang Y.J., Jeffries C.D., Rohde M.,
RA   Spring S., Sikorski J., Goker M., Woyke T., Bristow J., Eisen J.A.,
RA   Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Methanoplanus petrolearius type strain (SEBR
RT   4847)";
RL   Stand Genomic Sci 3(2):203-211(2010).
XX
RN   [2]
RP   1-2843290
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Deshpande S., Bruce D., Goodwin L.,
RA   Pitluck S., Kyrpides N., Mavromatis K., Ivanova N., Ovchinnikova G.,
RA   Daligault H., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D., Spring S.,
RA   Schroeder M., Brambilla E., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Methanolplanus petrolearius DSM 11571";
RL   Unpublished.
XX
RN   [3]
RP   1-2843290
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Deshpande S., Bruce D., Goodwin L.,
RA   Pitluck S., Kyrpides N., Mavromatis K., Ivanova N., Ovchinnikova G.,
RA   Daligault H., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D., Spring S.,
RA   Schroeder M., Brambilla E., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (23-JUL-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; fe9d7a861d59bf25946993a34b59d5b6.
DR   BioSample; SAMN00017400.
DR   EnsemblGenomes-Gn; EBG00001219449.
DR   EnsemblGenomes-Gn; EBG00001219450.
DR   EnsemblGenomes-Gn; EBG00001219451.
DR   EnsemblGenomes-Gn; EBG00001219452.
DR   EnsemblGenomes-Gn; EBG00001219453.
DR   EnsemblGenomes-Gn; EBG00001219454.
DR   EnsemblGenomes-Gn; EBG00001219455.
DR   EnsemblGenomes-Gn; EBG00001219456.
DR   EnsemblGenomes-Gn; EBG00001219457.
DR   EnsemblGenomes-Gn; EBG00001219458.
DR   EnsemblGenomes-Gn; EBG00001219459.
DR   EnsemblGenomes-Gn; EBG00001219460.
DR   EnsemblGenomes-Gn; EBG00001219461.
DR   EnsemblGenomes-Gn; EBG00001219462.
DR   EnsemblGenomes-Gn; EBG00001219463.
DR   EnsemblGenomes-Gn; EBG00001219464.
DR   EnsemblGenomes-Gn; EBG00001219465.
DR   EnsemblGenomes-Gn; EBG00001219467.
DR   EnsemblGenomes-Gn; EBG00001219468.
DR   EnsemblGenomes-Gn; EBG00001219469.
DR   EnsemblGenomes-Gn; EBG00001219470.
DR   EnsemblGenomes-Gn; EBG00001219471.
DR   EnsemblGenomes-Gn; EBG00001219472.
DR   EnsemblGenomes-Gn; EBG00001219473.
DR   EnsemblGenomes-Gn; EBG00001219474.
DR   EnsemblGenomes-Gn; EBG00001219475.
DR   EnsemblGenomes-Gn; EBG00001219476.
DR   EnsemblGenomes-Gn; EBG00001219477.
DR   EnsemblGenomes-Gn; EBG00001219478.
DR   EnsemblGenomes-Gn; EBG00001219479.
DR   EnsemblGenomes-Gn; EBG00001219480.
DR   EnsemblGenomes-Gn; EBG00001219481.
DR   EnsemblGenomes-Gn; EBG00001219482.
DR   EnsemblGenomes-Gn; EBG00001219483.
DR   EnsemblGenomes-Gn; EBG00001219484.
DR   EnsemblGenomes-Gn; EBG00001219485.
DR   EnsemblGenomes-Gn; EBG00001219486.
DR   EnsemblGenomes-Gn; EBG00001219488.
DR   EnsemblGenomes-Gn; EBG00001219489.
DR   EnsemblGenomes-Gn; EBG00001219490.
DR   EnsemblGenomes-Gn; EBG00001219491.
DR   EnsemblGenomes-Gn; EBG00001219492.
DR   EnsemblGenomes-Gn; EBG00001219493.
DR   EnsemblGenomes-Gn; EBG00001219494.
DR   EnsemblGenomes-Gn; EBG00001219495.
DR   EnsemblGenomes-Gn; EBG00001219496.
DR   EnsemblGenomes-Gn; EBG00001219497.
DR   EnsemblGenomes-Gn; EBG00001219498.
DR   EnsemblGenomes-Gn; EBG00001219499.
DR   EnsemblGenomes-Gn; EBG00001219500.
DR   EnsemblGenomes-Gn; EBG00001219501.
DR   EnsemblGenomes-Gn; EBG00001219502.
DR   EnsemblGenomes-Gn; EBG00001219503.
DR   EnsemblGenomes-Gn; EBG00001219504.
DR   EnsemblGenomes-Gn; EBG00001219505.
DR   EnsemblGenomes-Gn; EBG00001219506.
DR   EnsemblGenomes-Gn; EBG00001219507.
DR   EnsemblGenomes-Gn; EBG00001219508.
DR   EnsemblGenomes-Gn; EBG00001219509.
DR   EnsemblGenomes-Gn; EBG00001219510.
DR   EnsemblGenomes-Gn; Mpet_R0001.
DR   EnsemblGenomes-Gn; Mpet_R0002.
DR   EnsemblGenomes-Gn; Mpet_R0003.
DR   EnsemblGenomes-Gn; Mpet_R0004.
DR   EnsemblGenomes-Gn; Mpet_R0005.
DR   EnsemblGenomes-Gn; Mpet_R0006.
DR   EnsemblGenomes-Gn; Mpet_R0007.
DR   EnsemblGenomes-Gn; Mpet_R0008.
DR   EnsemblGenomes-Gn; Mpet_R0009.
DR   EnsemblGenomes-Gn; Mpet_R0010.
DR   EnsemblGenomes-Gn; Mpet_R0011.
DR   EnsemblGenomes-Gn; Mpet_R0012.
DR   EnsemblGenomes-Gn; Mpet_R0013.
DR   EnsemblGenomes-Gn; Mpet_R0014.
DR   EnsemblGenomes-Gn; Mpet_R0015.
DR   EnsemblGenomes-Gn; Mpet_R0016.
DR   EnsemblGenomes-Gn; Mpet_R0017.
DR   EnsemblGenomes-Gn; Mpet_R0018.
DR   EnsemblGenomes-Gn; Mpet_R0019.
DR   EnsemblGenomes-Gn; Mpet_R0020.
DR   EnsemblGenomes-Gn; Mpet_R0021.
DR   EnsemblGenomes-Gn; Mpet_R0022.
DR   EnsemblGenomes-Gn; Mpet_R0023.
DR   EnsemblGenomes-Gn; Mpet_R0024.
DR   EnsemblGenomes-Gn; Mpet_R0025.
DR   EnsemblGenomes-Gn; Mpet_R0026.
DR   EnsemblGenomes-Gn; Mpet_R0027.
DR   EnsemblGenomes-Gn; Mpet_R0028.
DR   EnsemblGenomes-Gn; Mpet_R0029.
DR   EnsemblGenomes-Gn; Mpet_R0030.
DR   EnsemblGenomes-Gn; Mpet_R0031.
DR   EnsemblGenomes-Gn; Mpet_R0032.
DR   EnsemblGenomes-Gn; Mpet_R0033.
DR   EnsemblGenomes-Gn; Mpet_R0034.
DR   EnsemblGenomes-Gn; Mpet_R0035.
DR   EnsemblGenomes-Gn; Mpet_R0036.
DR   EnsemblGenomes-Gn; Mpet_R0037.
DR   EnsemblGenomes-Gn; Mpet_R0038.
DR   EnsemblGenomes-Gn; Mpet_R0039.
DR   EnsemblGenomes-Gn; Mpet_R0040.
DR   EnsemblGenomes-Gn; Mpet_R0041.
DR   EnsemblGenomes-Gn; Mpet_R0042.
DR   EnsemblGenomes-Gn; Mpet_R0043.
DR   EnsemblGenomes-Gn; Mpet_R0044.
DR   EnsemblGenomes-Gn; Mpet_R0045.
DR   EnsemblGenomes-Gn; Mpet_R0046.
DR   EnsemblGenomes-Gn; Mpet_R0047.
DR   EnsemblGenomes-Gn; Mpet_R0048.
DR   EnsemblGenomes-Gn; Mpet_R0049.
DR   EnsemblGenomes-Gn; Mpet_R0050.
DR   EnsemblGenomes-Gn; Mpet_R0051.
DR   EnsemblGenomes-Gn; Mpet_R0052.
DR   EnsemblGenomes-Gn; Mpet_R0053.
DR   EnsemblGenomes-Gn; Mpet_R0054.
DR   EnsemblGenomes-Gn; Mpet_R0055.
DR   EnsemblGenomes-Gn; Mpet_R0056.
DR   EnsemblGenomes-Gn; Mpet_R0057.
DR   EnsemblGenomes-Tr; EBT00001788222.
DR   EnsemblGenomes-Tr; EBT00001788223.
DR   EnsemblGenomes-Tr; EBT00001788224.
DR   EnsemblGenomes-Tr; EBT00001788225.
DR   EnsemblGenomes-Tr; EBT00001788226.
DR   EnsemblGenomes-Tr; EBT00001788227.
DR   EnsemblGenomes-Tr; EBT00001788228.
DR   EnsemblGenomes-Tr; EBT00001788229.
DR   EnsemblGenomes-Tr; EBT00001788230.
DR   EnsemblGenomes-Tr; EBT00001788231.
DR   EnsemblGenomes-Tr; EBT00001788232.
DR   EnsemblGenomes-Tr; EBT00001788233.
DR   EnsemblGenomes-Tr; EBT00001788234.
DR   EnsemblGenomes-Tr; EBT00001788235.
DR   EnsemblGenomes-Tr; EBT00001788236.
DR   EnsemblGenomes-Tr; EBT00001788237.
DR   EnsemblGenomes-Tr; EBT00001788238.
DR   EnsemblGenomes-Tr; EBT00001788239.
DR   EnsemblGenomes-Tr; EBT00001788241.
DR   EnsemblGenomes-Tr; EBT00001788242.
DR   EnsemblGenomes-Tr; EBT00001788243.
DR   EnsemblGenomes-Tr; EBT00001788244.
DR   EnsemblGenomes-Tr; EBT00001788245.
DR   EnsemblGenomes-Tr; EBT00001788246.
DR   EnsemblGenomes-Tr; EBT00001788247.
DR   EnsemblGenomes-Tr; EBT00001788248.
DR   EnsemblGenomes-Tr; EBT00001788249.
DR   EnsemblGenomes-Tr; EBT00001788250.
DR   EnsemblGenomes-Tr; EBT00001788251.
DR   EnsemblGenomes-Tr; EBT00001788252.
DR   EnsemblGenomes-Tr; EBT00001788253.
DR   EnsemblGenomes-Tr; EBT00001788254.
DR   EnsemblGenomes-Tr; EBT00001788255.
DR   EnsemblGenomes-Tr; EBT00001788256.
DR   EnsemblGenomes-Tr; EBT00001788258.
DR   EnsemblGenomes-Tr; EBT00001788259.
DR   EnsemblGenomes-Tr; EBT00001788260.
DR   EnsemblGenomes-Tr; EBT00001788261.
DR   EnsemblGenomes-Tr; EBT00001788262.
DR   EnsemblGenomes-Tr; EBT00001788263.
DR   EnsemblGenomes-Tr; EBT00001788264.
DR   EnsemblGenomes-Tr; EBT00001788265.
DR   EnsemblGenomes-Tr; EBT00001788266.
DR   EnsemblGenomes-Tr; EBT00001788267.
DR   EnsemblGenomes-Tr; EBT00001788268.
DR   EnsemblGenomes-Tr; EBT00001788269.
DR   EnsemblGenomes-Tr; EBT00001788270.
DR   EnsemblGenomes-Tr; EBT00001788271.
DR   EnsemblGenomes-Tr; EBT00001788272.
DR   EnsemblGenomes-Tr; EBT00001788273.
DR   EnsemblGenomes-Tr; EBT00001788274.
DR   EnsemblGenomes-Tr; EBT00001788275.
DR   EnsemblGenomes-Tr; EBT00001788276.
DR   EnsemblGenomes-Tr; EBT00001788277.
DR   EnsemblGenomes-Tr; EBT00001788278.
DR   EnsemblGenomes-Tr; EBT00001788279.
DR   EnsemblGenomes-Tr; EBT00001788280.
DR   EnsemblGenomes-Tr; EBT00001788281.
DR   EnsemblGenomes-Tr; EBT00001788282.
DR   EnsemblGenomes-Tr; EBT00001788283.
DR   EnsemblGenomes-Tr; Mpet_R0001-1.
DR   EnsemblGenomes-Tr; Mpet_R0002-1.
DR   EnsemblGenomes-Tr; Mpet_R0003-1.
DR   EnsemblGenomes-Tr; Mpet_R0004-1.
DR   EnsemblGenomes-Tr; Mpet_R0005-1.
DR   EnsemblGenomes-Tr; Mpet_R0006-1.
DR   EnsemblGenomes-Tr; Mpet_R0007-1.
DR   EnsemblGenomes-Tr; Mpet_R0008-1.
DR   EnsemblGenomes-Tr; Mpet_R0009-1.
DR   EnsemblGenomes-Tr; Mpet_R0010-1.
DR   EnsemblGenomes-Tr; Mpet_R0011-1.
DR   EnsemblGenomes-Tr; Mpet_R0012-1.
DR   EnsemblGenomes-Tr; Mpet_R0013-1.
DR   EnsemblGenomes-Tr; Mpet_R0014-1.
DR   EnsemblGenomes-Tr; Mpet_R0015-1.
DR   EnsemblGenomes-Tr; Mpet_R0016-1.
DR   EnsemblGenomes-Tr; Mpet_R0017-1.
DR   EnsemblGenomes-Tr; Mpet_R0018-1.
DR   EnsemblGenomes-Tr; Mpet_R0019-1.
DR   EnsemblGenomes-Tr; Mpet_R0020-1.
DR   EnsemblGenomes-Tr; Mpet_R0021-1.
DR   EnsemblGenomes-Tr; Mpet_R0022-1.
DR   EnsemblGenomes-Tr; Mpet_R0023-1.
DR   EnsemblGenomes-Tr; Mpet_R0024-1.
DR   EnsemblGenomes-Tr; Mpet_R0025-1.
DR   EnsemblGenomes-Tr; Mpet_R0026-1.
DR   EnsemblGenomes-Tr; Mpet_R0027-1.
DR   EnsemblGenomes-Tr; Mpet_R0028-1.
DR   EnsemblGenomes-Tr; Mpet_R0029-1.
DR   EnsemblGenomes-Tr; Mpet_R0030-1.
DR   EnsemblGenomes-Tr; Mpet_R0031-1.
DR   EnsemblGenomes-Tr; Mpet_R0032-1.
DR   EnsemblGenomes-Tr; Mpet_R0033-1.
DR   EnsemblGenomes-Tr; Mpet_R0034-1.
DR   EnsemblGenomes-Tr; Mpet_R0035-1.
DR   EnsemblGenomes-Tr; Mpet_R0036-1.
DR   EnsemblGenomes-Tr; Mpet_R0037-1.
DR   EnsemblGenomes-Tr; Mpet_R0038-1.
DR   EnsemblGenomes-Tr; Mpet_R0039-1.
DR   EnsemblGenomes-Tr; Mpet_R0040-1.
DR   EnsemblGenomes-Tr; Mpet_R0041-1.
DR   EnsemblGenomes-Tr; Mpet_R0042-1.
DR   EnsemblGenomes-Tr; Mpet_R0043-1.
DR   EnsemblGenomes-Tr; Mpet_R0044-1.
DR   EnsemblGenomes-Tr; Mpet_R0045-1.
DR   EnsemblGenomes-Tr; Mpet_R0046-1.
DR   EnsemblGenomes-Tr; Mpet_R0047-1.
DR   EnsemblGenomes-Tr; Mpet_R0048-1.
DR   EnsemblGenomes-Tr; Mpet_R0049-1.
DR   EnsemblGenomes-Tr; Mpet_R0050-1.
DR   EnsemblGenomes-Tr; Mpet_R0051-1.
DR   EnsemblGenomes-Tr; Mpet_R0052-1.
DR   EnsemblGenomes-Tr; Mpet_R0053-1.
DR   EnsemblGenomes-Tr; Mpet_R0054-1.
DR   EnsemblGenomes-Tr; Mpet_R0055-1.
DR   EnsemblGenomes-Tr; Mpet_R0056-1.
DR   EnsemblGenomes-Tr; Mpet_R0057-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF00485; K_chan_RES.
DR   RFAM; RF01133; sR3.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02163; sR-tMet.
DR   SILVA-LSU; CP002117.
DR   SILVA-SSU; CP002117.
DR   StrainInfo; 162748; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4086743
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Methanoplanus petrolearius SEBR 4847, DSM
CC                          11571
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Missing
CC   environment         :: Oil fields
CC   num_replicons       :: 1
CC   ref_biomaterial     :: DSM 11571, OCM 486
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Anaerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02924
CC   Type Strain         :: Yes
CC   Greengenes ID       :: 260
CC   Funding Program     :: DOE-GEBA 2007
CC   Isolation Site      :: Offshore oil field from Gulf of Guinea
CC   Motility            :: Nonmotile
CC   Temperature Range   :: Mesophile
CC   Temperature Optimum :: 37C
CC   pH                  :: 7.0
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumnina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2843290
FT                   /organism="Methanolacinia petrolearia DSM 11571"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="off shore oil field from Gulf of Guinea"
FT                   /db_xref="taxon:679926"
FT                   /culture_collection="DSM:11571"
FT                   /type_material="type strain of Methanolacinia petrolearia"
FT   gene            462..1775
FT                   /locus_tag="Mpet_0001"
FT   CDS_pept        462..1775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0001"
FT                   /product="orc1/cdc6 family replication initiation protein"
FT                   /note="COGs: COG1474 Cdc6-related protein AAA superfamily
FT                   ATPase; InterPro IPR003593:IPR014277:IPR015163; KEGG:
FT                   mem:Memar_0001 AAA ATPase; PFAM: CDC6 domain protein;
FT                   SMART: AAA ATPase; SPTR: Cell division control protein 6
FT                   homolog; TIGRFAM: orc1/cdc6 family replication initiation
FT                   protein; PFAM: ATPase family associated with various
FT                   cellular activities (AAA); CDC6, C terminal; TIGRFAM:
FT                   orc1/cdc6 family replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34782"
FT                   /db_xref="GOA:E1RCV1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RCV1"
FT                   /protein_id="ADN34782.1"
FT                   /translation="MENESAQVSSDKPVRRLAGGLFDKYLNNKGIFKNREVLRHSHRPH
FT                   TLPHRKDQIDSIASILAPAIRNETPSNILIYGKTGTGKTASVKYVGSELESACREMGKA
FT                   CNVIHLNCELIDTQYRVLAQIANELENIDNKPSDKPRTSIPMTGWPTDQVYAELRNLVE
FT                   AMGGVNVIVLDEIDKLVKKSGDETLYNLTRFNSELKNAKISMIGISNDLRFTNFLDPRV
FT                   LSSLSEEELVFPPYNAPQLCDILQQRADVAFMEKVLDDGVIPLCAALAAQEHGDARRAL
FT                   DLLRISGELAERENSQKVSEMNVKMAQQKIETDSMIVCISSLPTQSKAVLYSMLLLVDL
FT                   NKQLFTTGEVAQVYRDVAHVIDLDVLTHRRIADLISELTMLGVINSRVVSRGRYGRTKE
FT                   MWFSTGTAGIKETIFKDDRFIEEDLAKMDLSRYRALLR"
FT   gene            1828..2343
FT                   /locus_tag="Mpet_0002"
FT   CDS_pept        1828..2343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0002"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="COGs: COG1522 Transcriptional regulators; InterPro
FT                   IPR019888:IPR000485:IPR010916:IPR019887; KEGG:
FT                   mem:Memar_0002 AsnC family transcriptional regulator; PFAM:
FT                   Transcription regulator, AsnC-type-like; SMART:
FT                   Transcription regulator, AsnC-type; SPTR: Putative
FT                   transcriptional regulator, AsnC family; PFAM: AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34783"
FT                   /db_xref="GOA:E1RCV2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RCV2"
FT                   /protein_id="ADN34783.1"
FT                   /translation="MPRVPVNPMDEKDRMLLKLLEEDCRTAGSVLADMLDLDEEGVRKR
FT                   VQRMEEEGIIRSYSANIDWEKAGDGYVAAILELKVTPERDFGYDKIAERIAHHPQVRSL
FT                   RLISGAYDFSMLVVGKDIHEVTRFVSEQIAPMEHIKETATILIMKTYKENGFEIFEKKG
FT                   RERLPYTF"
FT   gene            2356..3513
FT                   /locus_tag="Mpet_0003"
FT   CDS_pept        2356..3513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0003"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; InterPro IPR004838:IPR004839; KEGG:
FT                   mhu:Mhun_2473 aminotransferase, class I and II; PFAM:
FT                   aminotransferase class I and II; SPTR: Aminotransferase;
FT                   PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34784"
FT                   /db_xref="GOA:E1RCV3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1RCV3"
FT                   /protein_id="ADN34784.1"
FT                   /translation="MRDFRSDRVKAIPPSGIRKFFDIAQEMEDIISLGVGEPDYDTPWN
FT                   VREAAIRSIEQGQTAYTSNSGLPELRSLISRYLFDRFGTDYSPKNEIMITTGASEALDI
FT                   AIRSVVNPGDEVLVAEPAYIAYTSGVMLSGGIPVHVPCLEKDGFRLTPDSLMEKITPKS
FT                   KVLLCNFPNNPSGGVMSRADYKAISDIIVDHDLLLISDEIYNELTYEGEPASAASVEGL
FT                   RERTITINGFSKAFSMTGWRVGYLCAPEEICSAALKIHQYVMLSAPTGAQYAAIEALKN
FT                   SWDSCKAMVNEYHVRRNLFVNSVNRAGLPCHMPKGAFYAFPSVKDTGLSDEVFAERLLK
FT                   EHHVAVVPGSVFGPSGEGHLRCSYAVSRDDLLTAVARIEEFIGKL"
FT   gene            complement(3934..6636)
FT                   /locus_tag="Mpet_0004"
FT   CDS_pept        complement(3934..6636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0004"
FT                   /product="protein of unknown function UPF0182"
FT                   /note="COGs: COG1615 conserved hypothetical protein;
FT                   InterPro IPR005372; KEGG: mhu:Mhun_1303 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0182; SPTR:
FT                   UPF0182 protein Mhun_1303; PFAM: Uncharacterised protein
FT                   family (UPF0182)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34785"
FT                   /db_xref="GOA:E1RCV4"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/TrEMBL:E1RCV4"
FT                   /protein_id="ADN34785.1"
FT                   /translation="MKLPHIAAAVLLIIGFLFLVTAGFLGEWFWFGSTGYQEVFLTIIL
FT                   ARISLFAAAFLIFFAFSFINAWFAAKTASGGAVKNRGNLWIAGALAGLAGLLAALWVSS
FT                   SWETILKYISQVPFSLEDPVFGLDIGFYIFSLPFYSLATSFAIGLLVFSILLSALSYLL
FT                   KEDWISFSESGQIFIKAGEAGPDWSGLLKRFLPQLNLLLFLLFAAIAAKLWLARYDLLF
FT                   NRSGAVFGAGYTDVHVTLPVLTLLTAVALVIGIGFLVNERLKSLSVIKYGIAAFIAIAV
FT                   VGLLASFAVQGLIVQPNELNLEKQYLENNIEYTLKAYGLSDAEETPFNVSYDLTAQDIE
FT                   DNRLTAENIRLWDWRPLKSTYEQLQLFRTYYAFNDVDVDRYEINGSYKEVLISAREMDT
FT                   GSLSSTAQTWVNTHLVYTHGYGVVMTPVDEVTSEGLPEFYIKDIPPSSEYIEIDQPRIY
FT                   FGEMTNQYIITDTDTEELDYPSGEANVYTSYSGDTGVKLSGIINRLIYGIKFGSLELVV
FT                   SGSINDESRILMHRNIVDRASAIAPFLSYDNDPYVVVADGKLYWIIDAYTSSDMYPYSE
FT                   PVGASFINGYKTSYLRNSVKTVVDAYTGEVTYYVIDPDDPVIGTYRKIFPELFRDFSDM
FT                   PEELKDHIRYAQGLFEIQADRYATYHMKDPVVFYNREDEWVIPDEVYREDREQMQPYYV
FT                   IMKLPKEDSEEFILMLPFTPIGKENMIGWMAGRSDTPDYGDLIVYQFSKQELTYGPMQI
FT                   EARIDQDTEISQAITLWSQSGSSVLRGNTLVIPIENSILYVEPLYLQATERGTLPQLKR
FT                   VIVAYDDRLTMQNTLEEALGVIFGGAVAQEAADAAESGGAGTVVTADSELLQKIAALYY
FT                   KAQDALANGDLGEYQYYIEEIGKIVTGTA"
FT   sig_peptide     complement(6571..6636)
FT                   /locus_tag="Mpet_0004"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(6726..7520)
FT                   /locus_tag="Mpet_0005"
FT   CDS_pept        complement(6726..7520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0005"
FT                   /product="PHP domain protein"
FT                   /note="COGs: COG0613 metal-dependent phosphoesterase (PHP
FT                   family); InterPro IPR004013; KEGG: deg:DehalGT_0610 PHP
FT                   domain protein; PFAM: PHP domain protein; SPTR: PHP domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34786"
FT                   /db_xref="GOA:E1RCV5"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:E1RCV5"
FT                   /protein_id="ADN34786.1"
FT                   /translation="MPASYIHTTPHIDNFHREREDDPGTIMFDMHVHSTYSNDSIIDIR
FT                   TIVGSWKKTGILPLVCDHDSITGSEKVYSEIRRTDPDIPLILAEEILTADGEIIGAFLN
FT                   EEIAPGLSAEETLDLIEEQGAISIVPHPFCTFRSTAIDNGALNRIAERIDIIEGYNART
FT                   PDAGENRMGQVFAGRFGKPVSVGSDAHTPVELATNYIRINPFSTPAELFRSLPGGTVHF
FT                   SPAPQEVHEFTIMFKKLRRECGIAGLQGNIETLLQNAGILYP"
FT   gene            complement(7637..8605)
FT                   /locus_tag="Mpet_0006"
FT   CDS_pept        complement(7637..8605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0006"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="InterPro IPR000014:IPR000700:IPR013767; KEGG:
FT                   mhu:Mhun_2968 putative PAS/PAC sensor protein; PFAM: PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   SPTR: Putative PAS/PAC sensor protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34787"
FT                   /db_xref="GOA:E1RCV6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1RCV6"
FT                   /protein_id="ADN34787.1"
FT                   /translation="MKKSLLINNTILFSTLLIFVISLQMLSMGITFVFPHLFYIPILIS
FT                   AYYYPKKGIYAAAGISLFYVIPVIFFFSGDIIVIFSALIRMLMFIVIAALVSYLVERSL
FT                   GNQEENEHLMEFQNRIIENPRVMVTVSDSENQIIIWNKGAENITGYPKSEVLGRSDIWR
FT                   QILSDNEDIEELKSRIRKIKSNLGNIDGIPLPLVRKDGEIRYVVVSLQAMNSKQEDISK
FT                   ILGIAVDITENRRLEAENRAALNQIENNVSKMYILNDQIRNPLAIILGQIEINQSTSRQ
FT                   IICEQVIQINDIISQLDRDSIESTKIIDYLRKHYGFFNEEQ"
FT   sig_peptide     complement(8519..8605)
FT                   /locus_tag="Mpet_0006"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            8867..9868
FT                   /locus_tag="Mpet_0007"
FT   CDS_pept        8867..9868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0007"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="COGs: COG0104 Adenylosuccinate synthase; InterPro
FT                   IPR001114:IPR018220; KEGG: mem:Memar_0005 adenylosuccinate
FT                   synthetase; PFAM: adenylosuccinate synthetase; PRIAM:
FT                   Adenylosuccinate synthase; SMART: adenylosuccinate
FT                   synthetase; SPTR: Adenylosuccinate synthetase; TIGRFAM:
FT                   adenylosuccinate synthetase; PFAM: Adenylosuccinate
FT                   synthetase; TIGRFAM: adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34788"
FT                   /db_xref="GOA:E1RCV7"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="UniProtKB/TrEMBL:E1RCV7"
FT                   /protein_id="ADN34788.1"
FT                   /translation="MSCIIIVGGFFGDEGKGKIVAHVAHEDKPSIISRGGVGPNAGHTV
FT                   QVGDKEYGIRMIPSGFVYPKARLMIGSGVLVDPNVLKKEIEMLDVDDRVFIDKRCSIIE
FT                   EEHIKQDKGNEHLSKTIGSTGTGCGPANVARVNRVAKQAKDIPELQKYLIDASYEINSA
FT                   LDRGENVLLEGTQGFGISLYFGTYPFVTSKDTSASQIAADNGVGPTRIDDVIVVFKAYP
FT                   TRVGAGPFGTEMSKEESMKLGIQEFGTVTHRERRIGCWDGAMARYSAMVNGCTIAAITG
FT                   IDHIDPECYGATEYSQLTEKALEFIKQAEKDIGAPVKLISTGPEMNQIIDIR"
FT   gene            9880..10071
FT                   /locus_tag="Mpet_0008"
FT   CDS_pept        9880..10071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0008"
FT                   /product="protein of unknown function DUF343"
FT                   /note="InterPro IPR005651; KEGG: mem:Memar_0006
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF343; SPTR: Putative uncharacterized protein; PFAM:
FT                   Trm112p-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34789"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:E1RCV8"
FT                   /protein_id="ADN34789.1"
FT                   /translation="MKMSTYEILCCPVCKGDLELKVVEKTVLESGEEDVIEGTLRCQKC
FT                   GVDYPISGGIPNLLPQNK"
FT   gene            10095..10619
FT                   /locus_tag="Mpet_0009"
FT   CDS_pept        10095..10619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_0007 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34790"
FT                   /db_xref="GOA:E1RCV9"
FT                   /db_xref="UniProtKB/TrEMBL:E1RCV9"
FT                   /protein_id="ADN34790.1"
FT                   /translation="MSVHIRLNRKGINSIEMPESADAEVGESLVLKMINHGAPLHLTVS
FT                   TINGKRFTHFIHENLYVDDNLVLRIPILSVAPPGSFRIEIITGYGTVKEELTVNVHDQE
FT                   IELPEGMEEIPDIEEKKSIISGKDTLVILCAVLAWISYASGFFYPGLIPVIVPMVLLTA
FT                   GVVIGWFFRSS"
FT   gene            10598..11527
FT                   /locus_tag="Mpet_0010"
FT   CDS_pept        10598..11527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0010"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="COGs: COG1270 Cobalamin biosynthesis protein
FT                   CobD/CbiB; InterPro IPR004485; KEGG: mem:Memar_0008
FT                   cobalamin biosynthesis protein CobD; PFAM: cobalamin
FT                   biosynthesis protein CbiB; SPTR:
FT                   Adenosylcobinamide-phosphate synthase; TIGRFAM: cobalamin
FT                   biosynthesis protein CobD; PFAM: CobD/Cbib protein;
FT                   TIGRFAM: cobalamin biosynthesis protein CobD"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34791"
FT                   /db_xref="GOA:E1RCW0"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:E1RCW0"
FT                   /protein_id="ADN34791.1"
FT                   /translation="MVLPVLIIWLSLLADRVAGDPPNRYHPVAWLGRFIGWWGRPAVYP
FT                   EKIRRFAGFFMGILTAVLFSLPFFILDFYLPVWAAIVAAPFLLKICLAWRCLEEHVANV
FT                   EKALSLDGDGRSEVGMLVSRDPDSLSEEEVLSAAYESMSENLTDSIVSPLFYYSLLGLG
FT                   GAAFFRASNTMDAMLGYRDERIKIGWFPARLDDLLNFIPARLAGLSLVIWFAVKGSLGD
FT                   ARAVLKRDRKKRAGPNGGVTMSLIAGGCGIAFIKPGVYVIGDKKRSLKEAGADIRDAVR
FT                   AATIISAVILSLVLLAAGGIVFRFLLCL"
FT   gene            complement(11562..12380)
FT                   /locus_tag="Mpet_0011"
FT   CDS_pept        complement(11562..12380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0011"
FT                   /product="Exosortase EpsH-related protein"
FT                   /note="COGs: COG4083 membrane protein; InterPro IPR019127;
FT                   KEGG: mpl:Mpal_2092 cytochrome oxidase, subunit I,
FT                   putative; PFAM: Exosortase EpsH-related; SPTR: Cytochrome
FT                   oxidase, subunit I, putative; PFAM: Transmembrane
FT                   exosortase (Exosortase_EpsH)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34792"
FT                   /db_xref="GOA:E1RCW1"
FT                   /db_xref="InterPro:IPR014522"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:E1RCW1"
FT                   /protein_id="ADN34792.1"
FT                   /translation="MLEAIVAGLSFAGFLGFLLPLPYKKWFAAVGWTALVGILFANFPQ
FT                   YFAENNIIYPLIAFLALPALWVTVKKLNEENGVVFCMTRAAAIGFLVFAPFAYIEPLGD
FT                   WLIGVNISILESIFGFIGFSYTLAEWNLFMHDIYSVRIILGCTGIQAMALMLGIAWSVP
FT                   STIRQKALTFAVIVPVIFIMNLIRNLFVIIAYSEQWFPFLPWIASNGELGYESYFWSHN
FT                   IISEFGLSLLTVIIVGLAMITIIPDLKAFFIDLLRLYNAEFRKMLGKPTK"
FT   gene            12542..13711
FT                   /locus_tag="Mpet_0012"
FT   CDS_pept        12542..13711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0012"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterPro IPR011495:IPR003594; KEGG: mpl:Mpal_1776 signal
FT                   transduction histidine kinase; PFAM: histidine kinase
FT                   dimerisation/phosphoacceptor; ATP-binding region ATPase
FT                   domain protein; SPTR: Signal transduction histidine kinase;
FT                   PFAM: Histidine kinase; IclR helix-turn-helix domain;
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34793"
FT                   /db_xref="GOA:E1RCW2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RCW2"
FT                   /protein_id="ADN34793.1"
FT                   /translation="MDVQIEESKRELSRVLELLKDEPRGLSITDISRALKLNRNSVSKY
FT                   LNMLLISGHVELRSIGVAKVYFLSKRVPISAMLDYSSDAIVVLNRNMEIVVANESFLSL
FT                   TGSEFRDIIKMKIAGSGIPVVTDPGVYKEIVNSFKSDSSSSEMEWGDGSGEYFYRIKFI
FT                   PTVFDEGSPGLTVIIEDISQIKKTLLVKERMLEEVHMRVRSNLAVVNSLLNIQSGKLRN
FT                   PEAVGVLASTQRRIQALALVHENLGLSESGYILKVEDYIRELSADLVEGLGIGKGNIVV
FT                   KTDAIDVDLYLDEAVYCGFIINELLMNSYMHAFPEGAAGEISVSLGEDDGIYRFSYADN
FT                   GRGFPPGMNLESPESTGIMIIRRLVEDQLGGIIEIHPGHGVVFEIAFGK"
FT   gene            13720..14121
FT                   /locus_tag="Mpet_0013"
FT   CDS_pept        13720..14121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0013"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789; KEGG: lbl:LBL_2788 histidine kinase of
FT                   a two-component regulator system; PFAM: response regulator
FT                   receiver; SMART: response regulator receiver; SPTR:
FT                   Histidine kinase of a two-component regulator system; PFAM:
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34794"
FT                   /db_xref="GOA:E1RCW3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1RCW3"
FT                   /protein_id="ADN34794.1"
FT                   /translation="MSGDVERSADDPVKILIVEDDAIIAMDMEQVLNGKGYKVVGRVDR
FT                   GEKALDAVEEKKPDIVLMDINIKGSLNGIDVAKMLLNDIHIKVIYVTAYSDVNMKEKAF
FT                   ETEPVGYLIKPVRETELIDMIRQATGGDS"
FT   gene            complement(14793..15410)
FT                   /locus_tag="Mpet_0014"
FT   CDS_pept        complement(14793..15410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0014"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="COGs: COG1280 Putative threonine efflux protein;
FT                   InterPro IPR001123; KEGG: mtp:Mthe_1638 lysine exporter
FT                   protein LysE/YggA; PFAM: Lysine exporter protein
FT                   (LYSE/YGGA); SPTR: Lysine exporter protein (LYSE/YGGA);
FT                   PFAM: LysE type translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34795"
FT                   /db_xref="GOA:E1RCW4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E1RCW4"
FT                   /protein_id="ADN34795.1"
FT                   /translation="MFTLPEFFVLSFLIGLTGALVPGPTLVATINESLKSGWTAGPRVT
FT                   SGHIAIELAIAIAVIFGISAVLSEYTSEIAVAGGAVLVIFGLMNILSSRNIKIGRSGSV
FT                   QPGTAPFLAGIITSATNPYFWIWWLTTGAGFLLEGLKGGIIFAAAFMIGHWFSDLGWFT
FT                   FVSAGVSKGKNVMPERMYRGIIFACGIFLIGFGLWFISGTLG"
FT   sig_peptide     complement(15330..15410)
FT                   /locus_tag="Mpet_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(15476..16228)
FT                   /locus_tag="Mpet_0015"
FT   CDS_pept        complement(15476..16228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0015"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems ATPase components; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: mem:Memar_2331 ABC
FT                   transporter-related protein; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: ABC transporter-related protein;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34796"
FT                   /db_xref="GOA:E1RCW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RCW5"
FT                   /protein_id="ADN34796.1"
FT                   /translation="MILSINGIEFSYRSRDVLRDVSFDVQPNEIMTILGPNGVGKTTLL
FT                   KCINKIHHPKAGSILIEDEDIMKMDLLNVARRVGYVPQHCEKGRLTAYDAILLGRRPHI
FT                   TWNTSDNDLKIVDAAIKRLRMEDLAMRYIDEMSGGELQKVSVARALVQEPKLMLLDEPT
FT                   SSLDLKNQQEILRIIKAVVRGHSVSAVMTMHDINTALRFSDKFVLLKDGQIYAAGGPEI
FT                   ITPESIREVYDVDVHVENFKNSPIVIPV"
FT   gene            complement(16225..17301)
FT                   /locus_tag="Mpet_0016"
FT   CDS_pept        complement(16225..17301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0016"
FT                   /product="transport system permease protein"
FT                   /note="COGs: COG0609 ABC-type Fe3+-siderophore transport
FT                   system permease component; InterPro IPR000522; KEGG:
FT                   mma:MM_2068 iron(III) dicitrate transport system permease
FT                   protein; PFAM: transport system permease protein; SPTR:
FT                   Iron(III) dicitrate transport system permease protein;
FT                   PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34797"
FT                   /db_xref="GOA:E1RCW6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E1RCW6"
FT                   /protein_id="ADN34797.1"
FT                   /translation="MEIHLNGGEIPENYSRYIGKKITFIIAGIVLLFILLIISISVGAV
FT                   GIPPLEVAQTLFGANLSTQWDTIIWNIRFPQAISAIIAGAALAVAGVAMQSILRNPLGS
FT                   PYTLGISNAAAFGAAFSVIVLGTGTMHSTGADAVVIDNPYITTIIAFIFAMIATGVILL
FT                   LSKIRGASPEIMVLAGVAIGSLFTAGTMFLQYFADDTQLAAVVFWSFGDVARAHGTELI
FT                   LMGVATVICSIYFVMNMWNYNAIDAGDETAKGLGVNVERVRLVGMIVASFLSAIVISFL
FT                   GVIGFVGLVCPHMARRIVGDDHRFLIPATIVFGGVLLLASDTAARLILAPHVLPVAILT
FT                   AFLGAPVFIYLLLKGYKR"
FT   gene            complement(17319..18410)
FT                   /locus_tag="Mpet_0017"
FT   CDS_pept        complement(17319..18410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0017"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR002491; KEGG:
FT                   mac:MA0952 iron transport periplasmic binding protein;
FT                   PFAM: periplasmic binding protein; SPTR: Iron transport
FT                   periplasmic binding protein; PFAM: Periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34798"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E1RCW7"
FT                   /protein_id="ADN34798.1"
FT                   /translation="MAVTAFFAGCTGTDSTAGETSGGSAVSETVTITDALGREVTVPKN
FT                   PESVVCSGSGTLRLLTYLEAQDKIVGVDDIEIEEQQLEGRPYAIANTQFKNYPLIGEYR
FT                   GADDPEKIIACNPEVIFKSNPTSASEIDELQDKTGIPVVALTYGSLSVERSDLYQSLTI
FT                   MGEVMGKEDRAKDVIEFFNSSIADLNGRTESVAEDDKISTYVGGISYRGPHGFQSTEPS
FT                   YPPFIFVNAYNVAGEMGTEHADVAKEKIIEWNPEVLFVDLGTLQTTPSAIDELKTDESY
FT                   QTLDAVKSDKVYGVLPYNYYASNYGSVLADAYYVGSVLYPDQFADIDPAEKADEIYTFL
FT                   VGEPVFDELNAYYDNLGFTQIKL"
FT   gene            complement(18837..19928)
FT                   /locus_tag="Mpet_0018"
FT   CDS_pept        complement(18837..19928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0018"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR002491; KEGG:
FT                   mbu:Mbur_1047 Fe3+-hydroxamate binding protein; PFAM:
FT                   periplasmic binding protein; SPTR: Iron complex/Vitamin B12
FT                   ABC transporter substrate binding protein; PFAM:
FT                   Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34799"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDB5"
FT                   /protein_id="ADN34799.1"
FT                   /translation="MALTAIFAGCTSDGSTAGETPGGSTVSETVTITDALGREVTVPKN
FT                   PESVVCSGSGCLRYLTYLQAEDKIVGVDDIETEETKFDARPYALANPQFREYPLIGEFR
FT                   GADDPEKIIACNPDVIFKTYVTSASDADELQDKTGIPVVALNYGDLGVNRADMYQALTL
FT                   MGEVMGKEDRAKDIIGFFNSSIADLNARTESVAEDAKISTYIGGIAYRGPHGFQSTEPS
FT                   YPPFMFVDAYNVAGEMGTEHADVAKEKIIEWNPDVLFVDLSTLQTTPSAIDELQTDESY
FT                   QTLDAVKSDEVYGVLPYNWYTSNHGSVIADAYYIGTILYPEQFSDIDPAAKADEIYTFL
FT                   VGEPVFDEMNIAFNNTAFTRIAV"
FT   gene            complement(20237..21079)
FT                   /locus_tag="Mpet_0019"
FT   CDS_pept        complement(20237..21079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0019"
FT                   /product="Methyltransferase type 11"
FT                   /note="InterPro IPR013216; KEGG: mfs:MFS40622_1775
FT                   methyltransferase type 11; PFAM: Methyltransferase type 11;
FT                   SPTR: Putative uncharacterized protein; PFAM: Ribosomal RNA
FT                   adenine dimethylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34800"
FT                   /db_xref="GOA:E1RDB6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDB6"
FT                   /protein_id="ADN34800.1"
FT                   /translation="MKPEKRDLKYKINWQDARKSILDERFKGPKLSFDPKIKEKSAADF
FT                   SKKISEGDFEYGRKTAEIFAGFLEPSYEVLEIGPGPGTVTVPLSKLVKSITSIDLSLRN
FT                   IEFLRKNLTEKGCTNVEVINKNWLRMDDYELENSYDLVFCSHFLWMIPDLEEHINKMEN
FT                   ASRRYCAIVQPAGRDKLVKDVFTVITGQEYGGEFEPDADYFAYVIIRQWGRLPNVSHFS
FT                   YSNTMTIDEKVRSIASFIGRFVEVDKERVEKIRELVAPHAEDGIFRETMNAVVMWWEI"
FT   gene            21411..23192
FT                   /locus_tag="Mpet_0020"
FT   CDS_pept        21411..23192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0020"
FT                   /product="APHP domain protein"
FT                   /note="COGs: COG1572 conserved hypothetical protein;
FT                   InterPro IPR011635; KEGG: mba:Mbar_A3553 hypothetical
FT                   protein; PFAM: APHP domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF3344); CARDB"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34801"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR021779"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDB7"
FT                   /protein_id="ADN34801.1"
FT                   /translation="MALCLALICLFFVTPGLALYDFEGIPLDIASQGEVAGSIYSAGTY
FT                   GLTEPPVACSFTLPGEPVWAEVYTGVWGGTEKYSGTAEISINSLKIFKYSLYGEQDMNE
FT                   NVYCTGHGVYWISQDATDLLHSGENRVVVNTSRGESGSRMDGRVYAVFVVAAVGDNSGY
FT                   ITQYWIAEGNENLHGEGWSGSNPTVHDTSSYTFSGADLTGMQSAELTTVLLAGTRYQPD
FT                   YMTFNSNDLGQPETDTSHYPEGATDIGDEICFDAEGGSGTESRYVDVESFDVTDYVKDV
FT                   NTVVFERGRDSNGDGVIDPSSAISEGEDYIHPCLAVLSVKKKKASLLQDMGIAGITTAN
FT                   MYAGATGTLTAEVRNYGENTGSQAVVAFYVDGEKIGTATADTGSSGVGYAVIEWAATGG
FT                   EHEISAKLESPADSVSSNDEYSLACNIEDLPDLSLKVSSPVSAESGEAAVKQSPSFFMI
FT                   PVLGAAGAAAVWGRRKKPGKIMAATLVCMLVLCPVLVQPSFAAGLEYREYVLPVEVLNE
FT                   GGAVDPGVSLTVYLDGEKAAYTTLEDGIDGGDSESVEISIFTTPGSHKVRIVVDEEGSV
FT                   DELDEGNNSFEAVYEFP"
FT   sig_peptide     21411..21464
FT                   /locus_tag="Mpet_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            23179..24162
FT                   /locus_tag="Mpet_0021"
FT   CDS_pept        23179..24162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0021"
FT                   /product="cell surface glycoprotein"
FT                   /note="KEGG: mac:MA1751 cell surface glycoprotein; SPTR:
FT                   Cell surface glycoprotein; PFAM: Protein of unknown
FT                   function (DUF3344)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34802"
FT                   /db_xref="InterPro:IPR021779"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDB8"
FT                   /protein_id="ADN34802.1"
FT                   /translation="MSSRNLLPSAAIIFFLIFTGTVSASYSGDEPLSPVFYDELNGGYV
FT                   FSTGDSIYSGQMNPGNYYNASFDIAIPSDAEPVFSRLYVYWAWSNLEKAAIYPSISISA
FT                   TPAGTHEFTLAERYVDSKGFVSSYDFFSGTDSYEVTGIGAGENSFSVTAGNSAADNSTF
FT                   VIEGMGLLVVYESPSSPLVQIWADEGCDMLYSDYGITPEMATATAVFNGTVDTGSVKSA
FT                   RIELVAPSGGYTRSDIPEKNVVLFNRDTDGSLPGFLESLISAIFPGYNGKEWIDCFDSD
FT                   ELRQVGIESRDVGPYLKGSNNIVRVRDRGDYMLFTNAILSIEKEEK"
FT   sig_peptide     23179..23250
FT                   /locus_tag="Mpet_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            24170..24832
FT                   /locus_tag="Mpet_0022"
FT   CDS_pept        24170..24832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0022"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1136 ABC-type antimicrobial peptide
FT                   transport system ATPase component; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: mac:MA1752 ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: ABC transporter,
FT                   ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34803"
FT                   /db_xref="GOA:E1RDB9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDB9"
FT                   /protein_id="ADN34803.1"
FT                   /translation="MNPIVETSGLCKRYNESVSALSNVDFCIERGEFAAIVGRSGSGKS
FT                   TLMNIIGCLDSPTSGTVRINSCDIDYANPASLVKIRRTVIGFVFQQFNLIPNLTARENI
FT                   EYPLLFNYHPPAERLERVDYLLAQVGLMNRGDHYPQELSGGEQQRIAIARALVNKPLLV
FT                   LADEPTGNLDSGTGESILGLIKDLNRTQGTTFVIVTHDSDLASHADRTISISDGMVV"
FT   gene            24835..26046
FT                   /locus_tag="Mpet_0023"
FT   CDS_pept        24835..26046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0023"
FT                   /product="protein of unknown function DUF214"
FT                   /note="COGs: COG4591 ABC-type transport system involved in
FT                   lipoprotein release permease component; InterPro IPR003838;
FT                   KEGG: mba:Mbar_A2787 putative ABC transport system permease
FT                   protein; PFAM: protein of unknown function DUF214; SPTR:
FT                   Putative ABC transport system permease protein; PFAM:
FT                   Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34804"
FT                   /db_xref="GOA:E1RDC0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDC0"
FT                   /protein_id="ADN34804.1"
FT                   /translation="MGRYADYARIAFKQLMRKKGRIILTALGIAIGVAALVGIVSLGEG
FT                   IRSQSIDMIKEQSDLTFIEVTPDIRDGTVIPLTDSKVKALSGISGIVTAVPAVKASFAT
FT                   TRQTYLGIVGMESGGFEELLEPEYSSGGPYDGKGIVLGHDIEEKLRRNEGLREGDDLTV
FT                   LIRDYGESGAPEDRTEVFAVNGVLGERDDEFDNLVLMDIDTLMEIKGYGDSYDLVYVRV
FT                   DSPDNVLEVAESIKKMGLGVSGAFEEIESVNKLMDTVILVLSFFTGVSLIIGALMIVNT
FT                   MVISVFERTREIGITMAVGASRKDVICLILLECLYLGIIGGIIGDILGIGLSAGINIVG
FT                   KPFIISQLGEGFSSFYDSDITLITGWLLLEGLVIAVILSVLSGIYPALKAANLNPVDAI
FT                   RAGR"
FT   gene            26043..30743
FT                   /locus_tag="Mpet_0024"
FT   CDS_pept        26043..30743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0024"
FT                   /product="PEGA domain protein"
FT                   /note="InterPro IPR013229; KEGG: mac:MA1768 hypothetical
FT                   protein; PFAM: PEGA domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: PEGA domain; Protein of
FT                   unknown function (DUF3344)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34805"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR021779"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDC1"
FT                   /protein_id="ADN34805.1"
FT                   /translation="MTILDRGGKMKDNTMKLKKTYLTACILGFILCLLVASPASADQYV
FT                   GGEKPVTVQSGIVSGDLWFDSLYGIAGGSSNQPNSAEKTFKIPDYTDIKWARLYVVVYC
FT                   GNMKNNYQGQAIVSFDGGRGKKGLGTETLNKEYVYEIDGGVTPVSINGHCNRVTSDYLM
FT                   WYDVTDKINSRDVTAYVSTDKAPGYTGTFDGRIKLITLVVAYDDGDMDEVYYWVNQGHD
FT                   VHSYYVEESGMTYTGKTEFDTKELPDDFQIDSATLSVVHLASENGIYTFNDELLDTEPS
FT                   TGTYSGYQQWDVTDSVSSIGGKSEMTYARLGTSVSDWTDKGAFYKIPLAFLSVKQGEMG
FT                   ISVESNPRGAEIYIDGEDQEMVTNSLINLPEGSYSVSVHKDFYYDPDPVYVDVDEGEIA
FT                   TVSFNLEPNSYEGKEFEVYKKGTVKGGVAIANASKYSGLLKRGKSTKYSLDVSLPEGST
FT                   VEYARLYLYSAESCNTSVKEDVVPEMEVRFGGRELDGEKSYRDLKVDGGSKYTIETTCY
FT                   DVSRDVGGSGEYDVSIKNSGEDSNDVFALYGASLVVVYSNPDSPSASYWIAEGCDAVMA
FT                   SDEYEIDTEDSTTTVTFTGDADSVTNGTLYVVSTGADGIDSEENRIIFNDFEAFDLLNA
FT                   GSSDVSTASVDVKPYLKSSKNELSIQSYQSGDSGDYMENRIAVLVLEHPDTSAAEEESY
FT                   GYTGKELEVYDKGSLNGGVEVVNASSYTGLLNKGDSREYSLDVSLPEGSGVVGARLYLY
FT                   STWSHDTVEKEGVSPNIGTEFNGKEISIEKSYRDRKGEGIYNYILETTCYNVSDEVEGS
FT                   GKYSVSVKNTGGKDDAFALYGASLVIVYSDPDSPLTSYWIAEGCDTLLASDEFGTDTEN
FT                   CTTSVKFSGGVSSVASGTLYMISTAASGLEGDENRLVFNDYEGFNLLEGGSSDISTAVL
FT                   DVGPYVRNSGNRLYVQSYVSGDKGDYMENRVAVLVLKHSGGTGMTEETGDEEESGVLSP
FT                   GQTSATYPLSLSGGRTGAEHIVFGNGTIVLLVYEGSSLAYSSGMPVDSITIKKSDAGNF
FT                   SWAYTIGPSGAKSDIPVLIEAAVPESVGSGDPELVYYDEESGETRETVSKYDRESGTLS
FT                   ARISELGTYAIVYSQGNSGSSDLIFPLNIIADAISSFLGGGESGGEIQAEPGAILNSTT
FT                   AAPTESVADVSAKPEVIEIDPTLNDFEVRISSSPSSAKIFLDGNYTGKTTPAVFTLRGG
FT                   DHLLELELEDFDPYSEEFLLSENTTVNADLQTGIKLVKERKYDGFIGISDLGGIGGVYV
FT                   TSYPDGATVYVNGYNTEMVTPCVFYGLKEGLNTIKVKKTNIEYSESSKKVWVDSGSVMP
FT                   VSFDVLPSSGNSADIDSIEYDGYYFTINGHLPEYELPKVVAVGSANSFITFYEDGKYLS
FT                   HNIHAYSDKELNDIRPREYRFGKILVESDPDGAEIYVDGYDTGYSTPYAIDGLSDGAHY
FT                   VEVSKPGYIRGGEEILLTPDEAEYDAKLKIDLESYIYGSLEVTSNPSGAKIYLYNRDTG
FT                   KTTPYTFRYMDIGGITVKVVGEESTETVEDVIINPLETTLCHVDLD"
FT   sig_peptide     26043..26165
FT                   /locus_tag="Mpet_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            30932..31189
FT                   /locus_tag="Mpet_0025"
FT   CDS_pept        30932..31189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34806"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDC2"
FT                   /protein_id="ADN34806.1"
FT                   /translation="MKIMLLHAQEVFSLGDPTLAKGGGITVRKCELQILRAMSISFFTL
FT                   FHGCAGCSWQLPVRVSPETAAGGALSKVDCPETLKPAAFR"
FT   gene            31226..32536
FT                   /locus_tag="Mpet_0026"
FT   CDS_pept        31226..32536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0026"
FT                   /product="cell surface protein"
FT                   /note="KEGG: mba:Mbar_A2136 cell surface protein; SPTR:
FT                   Cell surface protein; PFAM: Protein of unknown function
FT                   (DUF3344); CARDB"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34807"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR021779"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDC3"
FT                   /protein_id="ADN34807.1"
FT                   /translation="MNGKAINGSIKKIALISIFLIFLVGTASALPDLYVSSASTNYKYA
FT                   GEIYANENNSMVVTVCNAGDQTASDAVVSLSVTDAASNPVVVNYPIGDIAASACATVTL
FT                   IDPTIRTSQGSTVTYTVQVNCTNAESNYDNNTLTTSGYEVLFNGYKGKRYWTGASDITT
FT                   KHTYEGNINMTYYNQTEAKYASTSWGTRSEVWTPANLVVPDGSTVLGAWLYVSYNWDNT
FT                   STGMAGFGMKFNDNASVIPLNNYTDQSNIGSYGDKKYGLISLNVTDYYDANGYNYLNMT
FT                   QSTSGYVQALYPSSLVVVYANANESQRQIFINEECDELAITEFPNYNYNVTSEEATEYV
FT                   PFEEYIDKYSAVSATLYSFVASAGHPTGGPDGEGNMFFNDYTVGTYLWEGTSYSAFPYI
FT                   ADVKGYLSDAGDDNVASIQATSRTGMLNIEQVLVVEY"
FT   sig_peptide     31226..31312
FT                   /locus_tag="Mpet_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            33082..41019
FT                   /locus_tag="Mpet_0027"
FT   CDS_pept        33082..41019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0027"
FT                   /product="PKD domain containing protein"
FT                   /note="COGs: COG3291 FOG: PKD repeat; InterPro
FT                   IPR000601:IPR013517:IPR011635; KEGG: mac:MA3699 cell
FT                   surface protein; PFAM: PKD domain containing protein;
FT                   FG-GAP repeat protein; APHP domain protein; SMART: PKD
FT                   domain containing protein; SPTR: Cell surface protein;
FT                   PFAM: Protein of unknown function (DUF3344); FG-GAP repeat;
FT                   PKD domain; CARDB"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34808"
FT                   /db_xref="GOA:E1RDC4"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR021779"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDC4"
FT                   /protein_id="ADN34808.1"
FT                   /translation="MRGVIGTQKNNAVHRVFLFYMVVLLCIVLMIIPAMAGGPEWTLNT
FT                   SWSAPDVGSSSSAAFADLDGDGDYDLMIGAVSGVTYGYENTGSSSGPEWTAKSSWNTPD
FT                   IGSVASPAFADLDGDGDYDLMIGASDGITYGYENTGSPGSPEWTAKSSWNTLDIGSASK
FT                   PAFADLDGDGDYDLMIGISTGFTYGYENTGSPGSPEWTAKSEWDSPDDIGSTSNPTLTD
FT                   LDGDGDYDLMIGESQGVAYGYENTGSSGSPEWTAKSEWDSPDVGNSAAPALADLDGDGD
FT                   YDLMIGASDGITYGYENTGTMGVMAPVAGFSVSPTSGDAPLTVHFTDESTNDPTEWSWD
FT                   FGDGDTTNSTEQNPIHTYATSGTYSVTLIATNSAGDGTKLETDYITVTNAVTPVAAFSA
FT                   ESTSGNVPLTVKFNDLSENSPTSWLWDFGDGDSTNATKKNPVHTYATAGTYDVSLTATN
FT                   LAGSGINVATSYITVTDVIPVANFSAEPTSGYSPLTVIFTDESTGYPTLWSWDFGDGDT
FT                   TNSTEPNPVHTYAEAGTYSVTLTTTNSAGDGIESKTDYITVTDLVAPVADFSAETISGN
FT                   VPLTVQFNDLSENLPTSWSWDFGDGDTTNSTQHNPIHTYIASGTYSVTLTATNIAGNGV
FT                   ESKTDYITVESLVPGESAPVASFTTNSSLGRVPFTVQLTDTTTGNVTSWYWDFGDGGNS
FT                   TEQSPVHTYVTEGTQTATLSATGPGGTTKATVTMTVDAPLNTGSYNGGVPLTTVQEGIV
FT                   SGGLWYDSWPGFGTYAEKTFTLPDYKEIKWARLYACVYSSSMDGTTSFSMTMDIDADGE
FT                   EGYEIQENEAYSVDYSGVPAWLNDHVNRVTSDYFMWYDLTDAINGSEVNVKATGGGSDG
FT                   RIKHITLVVAYDDGDEDKIYYWVNQGHDSANYNYDNYIGSTKFSTSSLSGFDTANLTSI
FT                   YAASVDGVYTFNEESLSSGSPVLSGGYFGYDDWNVTGYLNSGQDSTFEYTKSDSGTFYK
FT                   IQLALLTVSGAESSGGTAPGTDFSANVTSGAPPLTVKFTDESTGSPNSWSWDFGDGETS
FT                   DEQNPVHTFGASGYYTVTLTAGNSYGTNTEEKSSYISVLRAGTDISITESVVPLVSSAV
FT                   FAREPNTVRILSLKNGGNETVTDIEIDLYASDVFGPVNRTTVASLESGEALQVQIIDPT
FT                   IRESEGSTIVYTAVVDPDNKIPEVDETNNNKSGPAKPVKYNGYKGKALYWEDGSNITTK
FT                   YTYELNGDIIHSFGNSSYVSGSAGGSSWLSHTVDWTAEDLPVPDDSKVVAARLYIPYTW
FT                   DNSYQVPYNISVTFNGNDTSYDYLDTDVSNFGAYSDFYYGLLSYDVTDLYEKNSKNSAT
FT                   FTRSEGDAKLSLYGFTLAVIYENSTSTRKQIFINEGFDLLGASLTSYGTTPEESTAWVE
FT                   FSGMDINVSNVDSTKLITFVPAGAGWDNNPGEGNLIVNGETVAEYVWDYSGGSGAVVGE
FT                   GGGGQVAVDTRDIRSNLLSSGNVIGIQSYPDSNSPCMAASQQFLVIDYGIVPEANFTAS
FT                   PVDGNVPFDVKFTDNSTAGATSYEWDFGDGGNSTEQNPTHKYTYPGTYSVRLNVSNENG
FT                   TTTCLAERLINAAWPSIPSAGFSSNVSVGKSPLAVNFTDRSTNSPTSWLWEFGDGSTST
FT                   EQNPSHTYTAARLYTVNLTAYNSDGNSTVTKPGYVEVVDIPELPGYNDIYVKTANAPAY
FT                   DKQANGTYYIGTCENGGGLSDLHISTSPDSPDGSTYLTANRTGEFYVTYTGDRGFQDDI
FT                   ILLLAVNGTVPDDFSLDMSASGNKWTPSDTGEKPENIASSSINRAFAKADFTYGLQDWK
FT                   PAAGNQDYPLFSGEDMNETCNTFRVMFIDLKSGVLSGALGLDYADTKNNGSIRVDYSFT
FT                   NLTSFATFNVYGWNQNNSGQQAIIDTNSVSSGYSVYIAPVSEDNGIVPDFNVSTTSGEI
FT                   PLSVAFTDLTSVTPTSRLWEFGDGANSTEENPSHTYTMPGVYSVNLTISNSKGTNNTLK
FT                   VNYISVNNTAPPAADFTSDKTSGMEPLTVKFTDNSTGNITSWKWEFGDGGTSIEQSPSH
FT                   TYNDAGNYSVRLTVKNSRGTDNILKRNYIAVAKLSGESPAADFGLVPATGSAPLVVVFT
FT                   DKSANTPTSWKWDFENDGIIDSTAQNPSYTYRNTGTYSVALTVSNKFGSDMVVKENAIT
FT                   ISGVKNSSKTATISNSGTLTENSDGSREYSINTSDAGISGNDIVINSGNCVITIKSDKT
FT                   PVENGGSYVSSNVTGIELKTDPVETTMDSVGSVSGSVNVSLNGIPGSASLEVILDEGDS
FT                   GVGTAFQLAAGSSGLDVSKVAYTMNILKTNLKNGQDVKEARITMSVPVSWVDANGGISS
FT                   IKIIRIAEDGMKEVLNTTYIGMSGGLMVFEGYSPNGLSLFGLAATEENSSGTVSSSDSS
FT                   GSDRIVTSRGRLDYKNSENPSEVQSSEEGKVLADTTVPSDDGLVAVFLSKGTLALDKSG
FT                   NSIDEIVIEKSDEDSVPENEDSPVYEFMGRAYDFKPSGATFSPGIDIIFYLSSLGEYQA
FT                   FDGREPVIRYYNKAGKKWEDLKTTFDEDTMTVSATASHFSIYGLFAASETGLSGEQDAS
FT                   AEQTSNAATQEGTAAPINSQTGASSASSAILVLFTVGFVSVVSLGTYRFRKSRMEEVVF
FT                   GEEE"
FT   sig_peptide     33082..33189
FT                   /locus_tag="Mpet_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            41116..42852
FT                   /locus_tag="Mpet_0028"
FT   CDS_pept        41116..42852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mem:Memar_1430 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34809"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDC5"
FT                   /protein_id="ADN34809.1"
FT                   /translation="MADVVGIYWLPLLILALVAGSAGAGCWILGQENVSVISDTAGSIN
FT                   DSANATRFDWTAFRNTNRTIVDDMKVGLDMNDPAEEKDIGYFSGRVMEEINRSVSYETS
FT                   DAADSIKYELFFIIRDPAYEYKGPAAMAENFHVSVFKTTTDPLISNPSYLSHEYVVKYN
FT                   ITFEPDSSQEKMKDTIWWYESDASRIVRYLTNSSIGDDIAVIVITFNDTEGDGALTFVL
FT                   EAEDLEELEKYWDNDDDYISYFDWSNIVSGKEDLVYYEDPSRAIDLPAGVLSSGITDSL
FT                   YASGIDENLKYDLRSQSYELMESVDGIRRSVSAGNIEETQKNSEELMELSREFSSGIIN
FT                   YSVDDESRALIDEYLSGVRSLSRVGSHYWDKALLPDEIYNEESIEDLREGIEQINNALE
FT                   SIGEIGYNPEELQIVSSSSPGIYSDCLPAGTAFHYKDAAKNNDISIKITNYYLKSRLLL
FT                   KEGTSMEYREAGFGKRYIGVVVDIMHLGYRGKGSPQITTPDLSSFVFYYDGNPYTPVNI
FT                   GSYIGDMGEVYTKTTLNRLERYESLIIFEIDKGDDFDPEKAYVGVDLGEYGKQVWQLSS
FT                   EI"
FT   sig_peptide     41116..41187
FT                   /locus_tag="Mpet_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(42868..43314)
FT                   /locus_tag="Mpet_0029"
FT   CDS_pept        complement(42868..43314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0029"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="COGs: COG1720 conserved hypothetical protein;
FT                   InterPro IPR001378; KEGG: mem:Memar_0340 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0066; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   protein family UPF0066; TIGRFAM: conserved hypothetical
FT                   protein TIGR00104"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34810"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDC6"
FT                   /protein_id="ADN34810.1"
FT                   /translation="MDTFEVKPIGRVIKSPYKERGDAPRQGRLEPDKEAEIEIFEEYRA
FT                   GLGGLPGISHLYVLLWFDRAERDTLIGRPPHLGGEERPVFCTRSPARPNPIGLDIAEVL
FT                   SVEGGIIRVAGMDALEGTPVIDIKPYTPSIDCITGAKDHFKEKK"
FT   gene            complement(43328..43942)
FT                   /locus_tag="Mpet_0030"
FT   CDS_pept        complement(43328..43942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0030"
FT                   /product="formylmethanofuran dehydrogenase subunit E
FT                   region"
FT                   /note="COGs: COG2191 Formylmethanofuran dehydrogenase
FT                   subunit E; InterPro IPR003814; KEGG: mem:Memar_2371
FT                   formylmethanofuran dehydrogenase, subunit E region; PFAM:
FT                   formylmethanofuran dehydrogenase subunit E region; SPTR:
FT                   Formylmethanofuran dehydrogenase, subunit E region; PFAM:
FT                   Prokaryotic dksA/traR C4-type zinc finger; FmdE, Molybdenum
FT                   formylmethanofuran dehydrogenase operon"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34811"
FT                   /db_xref="GOA:E1RDC7"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="InterPro:IPR026328"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDC7"
FT                   /protein_id="ADN34811.1"
FT                   /translation="MKKEIKSFEEAAEFHGHVCPGLAIGYRAAEVGLDELLSGRSEDEE
FT                   LVCIAENDSCSIDGIQFVTGCTFGKGNLIFRDHGKQVYTFILRDKSDAVRISQKPEFAM
FT                   NSAPEAPQLMKKFFSGETSEEETARYHKMRSDMVEQYLTRPADEIFVIEHVKAEIPEKA
FT                   RLFNSVKCAECGEVVSESRARVKNGKIVCIPCSNEYAGINR"
FT   gene            complement(43997..44620)
FT                   /locus_tag="Mpet_0031"
FT   CDS_pept        complement(43997..44620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0031"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="COGs: COG1309 Transcriptional regulator; InterPro
FT                   IPR001647; KEGG: mvn:Mevan_0270 TetR family transcriptional
FT                   regulator; PFAM: regulatory protein TetR; SPTR:
FT                   Transcriptional regulator, TetR Family Member; PFAM:
FT                   Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34812"
FT                   /db_xref="GOA:E1RDC8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDC8"
FT                   /protein_id="ADN34812.1"
FT                   /translation="MEDGNHKKRPIADKRKAILDSALALFTERGFHGTPTSLIASEAGV
FT                   ATGTLFHYFATKEELIEELYLDIKREAGNEVGRGTEIRGDLDSDLMKISSNYFFWGIKN
FT                   PAKIKFMEQFCLSPYVPADTREEGISNFLFLSEIIESGIKSGQIKPLPVELTIRMATKF
FT                   LNALIEYAAAPGQGCDADELFGLAYPVLEDGLRNRAIAFPDKTG"
FT   gene            complement(44622..45842)
FT                   /locus_tag="Mpet_0032"
FT   CDS_pept        complement(44622..45842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0032"
FT                   /product="aldo/keto reductase"
FT                   /note="COGs: COG1453 oxidoreductase of the aldo/keto
FT                   reductase family; InterPro IPR017896:IPR017900:IPR001395;
FT                   KEGG: mpd:MCP_1379 aldo/keto reductase family protein;
FT                   PFAM: aldo/keto reductase; SPTR: Aldo/keto reductase family
FT                   protein; PFAM: Aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34813"
FT                   /db_xref="GOA:E1RDC9"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDC9"
FT                   /protein_id="ADN34813.1"
FT                   /translation="MLYRKVPKTGDELSILGYGCMRFPQKNGRIDYEYTKELLVHAMES
FT                   GINYLDTAWGYHNGQSEEVVGKILEETGSRDRVRIATKLPHWLASSREDMDGYLDKQLK
FT                   RLRTGHIDYYLIHDLTKGGWEKIKTMGFADFLDKAKKDGRITYAGFSFHDDIETFKEIV
FT                   DGYDWDFCQIQYNLIDTTNQAGTEGLEYAASKNLAVMIMEPLRGGNLARIQPAEVGKIW
FT                   EEAKTRRTPAEWALRWLWNRPEVTVVLSGMTETDQLDENLRIAEEGLPGSLTEEELELA
FT                   KRAGEKYREIMKVGCTGCSYCMPCPFGVNIPACFEIYNSYHMFDDKRHEKFMYMSRLGG
FT                   LLNKKSAASLCRNCGRCVKACPQHIDIPNELKKVKNDMEGPVMKIIVPVSRIYVPLRKK
FT                   LDLLRKR"
FT   gene            46104..48302
FT                   /locus_tag="Mpet_0033"
FT   CDS_pept        46104..48302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0033"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR000014:IPR001610:IPR003594:IPR004358:IPR
FT                   005467:IPR000700:IPR013656:IPR013767; KEGG: mem:Memar_1347
FT                   multi-sensor signal transduction histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; PAS domain containing protein; PAC
FT                   repeat-containing protein; SPTR: Multi-sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34814"
FT                   /db_xref="GOA:E1RDD0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR033425"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDD0"
FT                   /protein_id="ADN34814.1"
FT                   /translation="MLPEKNTLKINKRDGIFFLSLLLFTIFVSLSNFYSFLLFHTVAEL
FT                   FSVVIASAIFIIAWNSRNYIDNKYLLIIGIAFLFIGIIDFVHTMSYSGLNLISGLNQNI
FT                   QVQLWIAARYLEAVTFILAPLLMFKKTGVYRQFILYAIVTAAILYSVFISGTFPVCYIS
FT                   GSGVTQFEIYSEFLISAMLVLALWLLYVRRESFDRKVFLFIGASLFFSLFSEFSFTFYI
FT                   STYWFSNIFGLICKIISFGLIYYAIVETGIRRPYSVIFRNLKKRENELKIERDRFDQYL
FT                   DIAEAIFLVLDREGKVMLINRKGCEVLGYEKEEIRGFDWFEKFMPEGDGDAMRSLFTQD
FT                   IEGGMSHVKIEGHILTKSGELKTILWQNSLIRDEKDEVTASVSSGEDITEKKSIERDLR
FT                   LKNVAIETLINGIVILDMNANITYANFSFAHMYGYSSPAEITGMSSSVFFRNSIDLKSV
FT                   IDTIIKEGGYVGEIKSKKKSGEDIIVQISAYFLKPEDSTESCIYVSLVDVTERERIKEA
FT                   LASANMKLNILSGITRHDILNEVTVAIGYLDMMNDASPEEKDDFIKKTYIAVEGIRRQA
FT                   EFTRDYQDMGLSSPLWQNPGKVVKEYLASNGEYGGIDVKIDAENVEIFADPMLPKVFGN
FT                   IMSNSLVHGEKVSKITISSSKDDSENLIVTIEDNGVGISAEKKKSLFKPGIGRNHGFGL
FT                   YLVKEILSITGIGISEAGKEGEGAKFVITVPPDDWRGT"
FT   sig_peptide     46104..46196
FT                   /locus_tag="Mpet_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            48343..48909
FT                   /locus_tag="Mpet_0034"
FT   CDS_pept        48343..48909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0034"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: mbn:Mboo_2291 methyltransferase type 11; PFAM:
FT                   Methyltransferase type 11; SPTR: Methyltransferase type 11;
FT                   PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34815"
FT                   /db_xref="GOA:E1RDD1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDD1"
FT                   /protein_id="ADN34815.1"
FT                   /translation="MSERGYVHGYSETESERLSVQAATLNELLYGDTPYPAGSLVLEAG
FT                   CGTGAQTPVITKNSPGAVIISVDISQKSLEVAKNRTTAEGRAGEYLNCDIFGLPFPGDS
FT                   FDHIFVCFVLEHLRDPVDALTALMRVLKPGGTITVIEGVGEDAVSSGMMTKEEWDEGIS
FT                   ALYRTAEEDGTFCYTFFKATGTRPV"
FT   gene            complement(49054..49293)
FT                   /locus_tag="Mpet_0035"
FT   CDS_pept        complement(49054..49293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_1554 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34816"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDD2"
FT                   /protein_id="ADN34816.1"
FT                   /translation="MREDEIVEKIIETNRDVKWIRAEIAGIKENDKELERRVSAIEALH
FT                   LPARTGIVSERQVSAGIGAGAGSIAALILRLLGG"
FT   gene            complement(49350..49853)
FT                   /locus_tag="Mpet_0036"
FT   CDS_pept        complement(49350..49853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2954 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34817"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDD3"
FT                   /protein_id="ADN34817.1"
FT                   /translation="MTDFIETSNSRSAVRELAQPIADITTFSAIIQSVIDENPFGCTEY
FT                   SGNGATVPGVARNREHYIAKVVFEDTAGEKIGTLSVKCPSISAMESAAGAIVADADLAV
FT                   AVGGDPVRDEANDTWSCQLKCHDANSDIYYVTFTRTKVRISGYEDDSVLSTVETWADSV
FT                   AALA"
FT   gene            complement(50019..51176)
FT                   /locus_tag="Mpet_0037"
FT   CDS_pept        complement(50019..51176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0037"
FT                   /product="PEGA domain protein"
FT                   /note="InterPro IPR013229; KEGG: mem:Memar_1516 PEGA
FT                   domain-containing protein; PFAM: PEGA domain protein; SPTR:
FT                   PEGA domain protein; PFAM: PEGA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34818"
FT                   /db_xref="GOA:E1RDD4"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDD4"
FT                   /protein_id="ADN34818.1"
FT                   /translation="MGLISGGSLTVEYKTDQTPYSTVRVSKSGYTTVTQSLPSPPGPSG
FT                   TVDVYITLQAVSSSSGTLNIYSSPSGGSVYIDKVYKGTTPFSISLSPGTYGVQVDKSGY
FT                   MTTSETVIISAGQTITRSYTLQQKTSYGSLLITSEPDNAYAYVDGTYAGMTAITVNNLL
FT                   AGNHNVRLTAPGYNEWTATQYVKAGEVMTVHGTLTPSSSNNGYVRVISYPGEAEVYLDG
FT                   AYMGKTNDEGVPGAYTLTVSPGTHKISVELTGYRDYDQTVTVSAGQTVTVDANLIQISQ
FT                   PVTGEISVSTTPSGANVYVDNQYEGITPLTIPGVNPGSRDVLLRLSGYEDAKDTVNVQP
FT                   GGTSTIDVALTPAGSAKATPGFGFLAAISALGAAGLVVSRRRGRS"
FT   gene            51214..51825
FT                   /locus_tag="Mpet_0038"
FT   CDS_pept        51214..51825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nve:NEMVE_v1g122540 hypothetical protein;
FT                   SPTR: Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34819"
FT                   /db_xref="GOA:E1RDD5"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDD5"
FT                   /protein_id="ADN34819.1"
FT                   /translation="MHLTTYHPIPGVGFGVAVRVGAAVVEVGVAVVGVGVGVGVAVVGV
FT                   GVAVVGVGVAVVGVGVAVVGVGVAVVGVGVAVVGVGVAVVGVGVAVVGVGVAVVGVGVA
FT                   VVGVGVAVVGVGVAVVGVGVAVVGVGVAVVGVGVAVVGVGVAVALSASAGTADIIRTRK
FT                   IIHKTRENRFTIISQNRKLLYLNDLKYEYPFPGIPAAGDC"
FT   gene            51994..52215
FT                   /locus_tag="Mpet_0039"
FT   CDS_pept        51994..52215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lch:Lcho_0558 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34820"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDD6"
FT                   /protein_id="ADN34820.1"
FT                   /translation="MVYTLWIHFFQEYIVDMDLSGTVRVKEYQAFLKTKRWELAGYYVR
FT                   AMCRIIINKGGFAAAAGKRYGPGTGRPV"
FT   gene            52257..53042
FT                   /locus_tag="Mpet_0040"
FT   CDS_pept        52257..53042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0040"
FT                   /product="Dolichyl-phosphate beta-D-mannosyltransferase"
FT                   /EC_number="2.4.1.83"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: mem:Memar_1468
FT                   dolichyl-phosphate beta-D-mannosyltransferase; PFAM:
FT                   glycosyl transferase family 2; PRIAM: Dolichyl-phosphate
FT                   beta-D-mannosyltransferase; SPTR: Dolichyl-phosphate
FT                   beta-D-mannosyltransferase; PFAM: Glycosyl transferase
FT                   family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34821"
FT                   /db_xref="GOA:E1RDD7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDD7"
FT                   /protein_id="ADN34821.1"
FT                   /translation="MMPDDSCSSEYDLTVIIPTYNEEGNIREIVSQVDSVCRSSNINEE
FT                   ILVVDDDSPDRTQIIVSEMQESMNNLHILVRYEDHGLSQSLHAGIYKAESCLVQCIDAD
FT                   LSHPPEKIPVFYNLLKNENYDMVIGSRYIPGGETFDWPLYRKIISSGAALIGRSFIPIV
FT                   KDSGSGFFAINRRILEDVNLKPRGFRMGFEILGKARWENVTEIPIVFRDRVAGVSKIKP
FT                   SVFSDFLLQCMHIAYYNFILHKSGNIIKSWKRFLFGRKN"
FT   gene            53240..54763
FT                   /locus_tag="Mpet_0041"
FT   CDS_pept        53240..54763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0041"
FT                   /product="Oligosaccharyl transferase STT3 subunit"
FT                   /note="COGs: COG5305 membrane protein; InterPro IPR003674;
FT                   KEGG: mem:Memar_1469 glycosyl transferase family protein;
FT                   PFAM: Oligosaccharyl transferase STT3 subunit; SPTR:
FT                   Glycosyl transferase, family 39"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34822"
FT                   /db_xref="GOA:E1RDD8"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDD8"
FT                   /protein_id="ADN34822.1"
FT                   /translation="MGNKSKKSDPKKAEISTDTLGDDKYKVSSFKDLNSENLRLVILNN
FT                   RYAQLLILLVAIGFALRFYNLGFNSIWLDEGTTFGYAKMGFVEIWNAVIAEFHPPLFYW
FT                   LEHMMNVFGDSEFVLRFIPALFGVLAIPVFYLIGSEVVNRDVGIITALLVTFSPFQIYY
FT                   SQDARAYTMILLFFSISLLAYIYALKTREMKWWIIFGIASAIAFWAHYYTIIGTGVIVL
FT                   HAIVTNYRELLKNTPFRKGFLVSIILFVILSIPLLLLIYERYLELSASAPTYGVLGPQL
FT                   ITSSIISFSGFEWWSGVLFAVLFIIGVLYLYKKSVSYMALVVGLLLIPLIFSVILSAKI
FT                   TMNPRYLIFLLPVFYLGIASAYMPVKELIKNDKFIYAFMAVLVLVNIPFMATYYTSYTK
FT                   NDWRGFSGQLGNVTEAGDVIVVLPGYMTQPLDYYYSNETDGTIELLASSGEELEAIYSE
FT                   YPDRTLFFVVTGDINAKNPEGDAVEWLNDNTGYMGQNMGIYLFAIVPQE"
FT   gene            complement(54786..56438)
FT                   /locus_tag="Mpet_0042"
FT   CDS_pept        complement(54786..56438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0042"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2227
FT                   2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1 4-benzoquinol
FT                   methylase; InterPro IPR005242:IPR013216; KEGG:
FT                   fpl:Ferp_2454 hypothetical protein; PFAM: Methyltransferase
FT                   type 11; conserved hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Methyltransferase domain;
FT                   Uncharacterised protein family (UPF0104); TIGRFAM:
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34823"
FT                   /db_xref="GOA:E1RDD9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDD9"
FT                   /protein_id="ADN34823.1"
FT                   /translation="MPEKKGFGKAVRISQYILALSIILLILYFSGIQNVLEIFSQINPV
FT                   FIIPAIAAYLVNNILMSFRIKKILTDIDKKIRLKFVFFSHMAGMLASDFTPARSGYLFV
FT                   AYALKKHGISTKSGLATITSAYIYDLFFKIIVASIGIVYIYSNIFDGGVFQTLLIAAAL
FT                   MAGILILYITIMYPSAGIIRFSKNIKILQKLIDLGGESKKVQKHYRYIILITIMGWIMK
FT                   GFEWFFIALALNIVQISFMDALILNPFLTLFSFVPLTPAGWGIQEAGIVGLFALMGISS
FT                   VYAVSFSLMTRFVEVFVDLLGIKSFFTKDLRKESLEEFYNTIDGDIDEKSYNSDLLVQK
FT                   YWQQRKTEEIKNCLDIDKNDVIIDIGCGSGVQIRETGASDAKMVLGIDLNRNALKFARE
FT                   KGIPNSDYILADAEHLPVRSGKVDKIICAEIIEHLISPDKMVSEIKRVLNKGGEIVITT
FT                   PNEFSFWGVYEMMWDLFGRGRNYGETHLMFFSPKELRLLFSDFSRAETKTIFFVSPFVA
FT                   LLKSEKLLDLSQRFDGLFERANIGLSLILYAKK"
FT   gene            complement(56474..56902)
FT                   /locus_tag="Mpet_0043"
FT   CDS_pept        complement(56474..56902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0043"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="COGs: COG0662 Mannose-6-phosphate isomerase;
FT                   InterPro IPR013096; KEGG: mth:MTH352 hypothetical protein;
FT                   PFAM: Cupin 2 conserved barrel domain protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34824"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDE0"
FT                   /protein_id="ADN34824.1"
FT                   /translation="MIIRDIKKAEYFTSGDGCTLCELLHPEREAEKNPGEGLSINASIA
FT                   HAFVRAGDRTVPHRLKESAEIYYIIAGSGIMHIDEDAEAVGPGQAVYIPPGSVQWIESC
FT                   GPCDLELLAIADPFWREDDEEILPEKCGSRQGISITRD"
FT   gene            56972..57454
FT                   /locus_tag="Mpet_0044"
FT   CDS_pept        56972..57454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0044"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="COGs: COG0652 Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase) - cyclophilin family; InterPro IPR002130; KEGG:
FT                   mem:Memar_0036 peptidylprolyl isomerase; PFAM:
FT                   peptidyl-prolyl cis-trans isomerase cyclophilin type;
FT                   PRIAM: Peptidylprolyl isomerase; SPTR: Peptidylprolyl
FT                   isomerase; PFAM: Cyclophilin type peptidyl-prolyl cis-trans
FT                   isomerase/CLD"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34825"
FT                   /db_xref="GOA:E1RDE1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDE1"
FT                   /protein_id="ADN34825.1"
FT                   /translation="MAEKKVKLETNLGDIVIKLYEDMPVTAGNFEKLVSEGFYDGIIFH
FT                   RVIRSFMVQAGCPNGTGTGGPGYNIKDEFVKGHSNLRGTISMANTGMPDTGGSQFFINL
FT                   VDNTYLDWDNSQTPSKHPVFGEVVEGMDVVDKIAMQPVDRMDRPRNETKIIRATVL"
FT   gene            complement(57435..57986)
FT                   /locus_tag="Mpet_0045"
FT   CDS_pept        complement(57435..57986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0045"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_1554 drug resistance transporter,
FT                   EmrB/QacA subfamily; SPTR: Drug resistance transporter,
FT                   EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34826"
FT                   /db_xref="GOA:E1RDE2"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDE2"
FT                   /protein_id="ADN34826.1"
FT                   /translation="MPDNSAVTAAAGILCAGLLIQAAFFFFISLPAAPVLPAFACIAVV
FT                   VMQSKRSKDGLLGADYIKTGLAGLAAGILSMPFASSAAVAAAGVIACPVGTLAALAVFM
FT                   EMTKKEENFAAMFSVFSGSLVAGMFIIAAGFAGEKLHGPATVLGEFIPLLIVSLLAGLL
FT                   CQGIIIALKKDNSGIKGPSP"
FT   sig_peptide     complement(57867..57986)
FT                   /locus_tag="Mpet_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(58000..58944)
FT                   /locus_tag="Mpet_0046"
FT   CDS_pept        complement(58000..58944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mla:Mlab_0156 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34827"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDE3"
FT                   /protein_id="ADN34827.1"
FT                   /translation="MTFEETIIFYNPEHADEFTLKLKKSGFRAKTKRVSTLVKETICTG
FT                   KIDDFISLFNEEKKKHDNGSDKTDVQALMTDMYSEIIDELELRKNRLSGFFGSAHPGDC
FT                   ISDIPGFNGCGSWTEAGDDEANPENDEERGNKTLFHLLNENGLLESGSGKWILKNTAEP
FT                   GEIITAVPSDMMLEASSQEKRSRYSINTIINVMSGVETHVTLPPEFSISAEPEMIDQIM
FT                   DKYDVDEESILKLKENGYIKSLLAERIIEYLKEKERTPFDELFREMKNLKFTIDNTNDE
FT                   FRFDLDEKFLKDMLGEMKKMDLIKSKGNHFRSA"
FT   gene            complement(58999..59460)
FT                   /locus_tag="Mpet_0047"
FT   CDS_pept        complement(58999..59460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpd:MCP_1390 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34828"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDE4"
FT                   /protein_id="ADN34828.1"
FT                   /translation="MLISTGKRLAVFLAVALLAAVLVAAGCLSAESSRVIIVPENSYWS
FT                   PAMSSVIGIGLSADYSGSGNVTYKWTADYGDFLLWTPEIVPCGSPCTGTDTVWWTYITE
FT                   DSIPSVSDLPGEVRITVDAIDQGTGDTLAESSLILERDENGGYSISLDG"
FT   sig_peptide     complement(59371..59460)
FT                   /locus_tag="Mpet_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            59573..61069
FT                   /locus_tag="Mpet_0048"
FT   CDS_pept        59573..61069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0048"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG1311 DNA polymerase II small subunit/DNA
FT                   polymerase delta subunit B; InterPro
FT                   IPR011149:IPR004365:IPR004843; KEGG: mbn:Mboo_0035 DNA
FT                   polymerase II small subunit; PFAM: metallophosphoesterase;
FT                   nucleic acid binding OB-fold tRNA/helicase-type; PRIAM:
FT                   DNA-directed DNA polymerase; SPTR: DNA-directed DNA
FT                   polymerase; PFAM: DNA polymerase alpha/epsilon subunit B;
FT                   OB-fold nucleic acid binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34829"
FT                   /db_xref="GOA:E1RDE5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR011149"
FT                   /db_xref="InterPro:IPR024826"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDE5"
FT                   /protein_id="ADN34829.1"
FT                   /translation="MTGMRDEIISKFLAADLQVHPEVVLYLLESDDPDLIDGIIANVPP
FT                   EAFVALPAHIPGFKVEGFEPPRPRIKSEEPLPETAKPAVSKKSETDGERFMPEGDVDVV
FT                   YGLPAPGNGGVDFNDFVFYFRDRYEKLARYLRKRGEAIPISALTQTDRYRQDDVSVIGM
FT                   VSDLRNTANGHRMAVLEDPTDSINVLFNNKRDVFEEAEKLIPDEVVMVRGKLSSDGNLF
FT                   FADTMMRPDIPLNNAPFKSRTPGKAVFISDVHVGSDTFLYDEWDRFSEWLHDFDAQYLL
FT                   IAGDLVDGIGIYPDQDKELIIADIDRQYKEFGRMVSALPRDMQIIISPGNHDAIRGSEP
FT                   QPALPERFSKYFPENVVLVENPAFVRLQGVGILMYHGRSYDDLISMIPGASYTKPEDMM
FT                   VEMLKRRHLACTYGMRTPILAAKEDNLIIDPVPEILHTGHVHICGVVNYRGVLCMNTGT
FT                   WQSQTLFQKQMNIQPTPARAMVVDLQTLEPKIFDFMDKAE"
FT   gene            complement(61218..62255)
FT                   /locus_tag="Mpet_0049"
FT   CDS_pept        complement(61218..62255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0049"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpl:Mpal_0166 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34830"
FT                   /db_xref="GOA:E1RDE6"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDE6"
FT                   /protein_id="ADN34830.1"
FT                   /translation="MTEYSGSNRKKTAWCPLTETLQTTLTEPSSGYAPVRSVQPGGGGD
FT                   GVGRRIGRGAGIATRSIKTLINDRKLLWYPLLAGFALFLMYLTEMAFKAYAIMTCSGSY
FT                   GYWSLGYHYGFVLTFVVELIFFFCLNYIFAAIVIDISKNPENPGAVRKSLYSAKNYLKT
FT                   IAGWSVILAVVATAIYAFVLQQPWHAHLYPALGTTMFQIPFVYYVPILPLATVTAVIEK
FT                   ILVAVPLFVLTLYVIPLLVLEKRSLSGAIAGLAGFFRRTWIEIIVCFLIFATVVVGITL
FT                   LSPLICMTPLFVDYDYHFFAEYAIPMAAICFLFLALLWTAAASVFTTTGIAAVDLYKLG
FT                   KKGRG"
FT   gene            complement(62252..62992)
FT                   /locus_tag="Mpet_0050"
FT   CDS_pept        complement(62252..62992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0050"
FT                   /product="Protein of unknown function DUF1673"
FT                   /note="InterPro IPR012874; KEGG: mem:Memar_0918
FT                   hypothetical protein; PFAM: Protein of unknown function
FT                   DUF1673; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF1673)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34831"
FT                   /db_xref="GOA:E1RDE7"
FT                   /db_xref="InterPro:IPR012874"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDE7"
FT                   /protein_id="ADN34831.1"
FT                   /translation="MTIRISETIHKWMGWCPAKTAMKSSMGISGYGIRKGETPGSPDRI
FT                   SSDRIVDYVPTWTSLLQFLVFGTEIAAIVAFLKFVNKYYPGTDILLLLCIMLVTGYLII
FT                   YSDIKRTTIESGPDVITVKRPGFRTVHIQKSDINNAEIIDNHRPVPQFVLAILGLIIIP
FT                   VFSVVSIYGRYVEWISGEILTPLFIAYLGFFIVISIFFLVIYNYARIRKRYPKSFVITT
FT                   KKNKQLVIYGKSFEELVEIRENLL"
FT   gene            complement(62989..63435)
FT                   /locus_tag="Mpet_0051"
FT   CDS_pept        complement(62989..63435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM_1204 hypothetical protein; SPTR:
FT                   Conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34832"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDE8"
FT                   /protein_id="ADN34832.1"
FT                   /translation="MFLPTDEKQFAFWAMRRSGMANIAIAKQLGISRQAVSRALIQMDE
FT                   KIEAVLRDMARANSIAVEKVNAERGVLIGRSIPFRTAAIIFVSEKHGIQVWFEHEGDCG
FT                   SCERYTECIELLWDYAGELGVKIEKTDDPTKMADELFGKVRAMI"
FT   gene            complement(63697..64446)
FT                   /locus_tag="Mpet_0052"
FT   CDS_pept        complement(63697..64446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbn:Mboo_0367 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34833"
FT                   /db_xref="GOA:E1RDE9"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDE9"
FT                   /protein_id="ADN34833.1"
FT                   /translation="MELTGVARGLDRVLYIILFVVLVFFSLMNLFVFIINWETWFFGIR
FT                   LAGLNAGIVLFIYFLVPAILAYLLYMYPGKTAITSILSVFFFVFTFISSSITTIQLSNG
FT                   VKSFNGFMAIFVVISLAVLAGHLIAGRFYDREEYHKENNNEGEVSKTDLEGIMGKNPIY
FT                   DLLIPAIAAFFIVLLFGIAMLIPALFLLIVISVIMISKRATGTGERSKRERLNMHYARL
FT                   LFAMGIMMIIFVILLYFVPVFFMTNRG"
FT   gene            complement(64597..64803)
FT                   /locus_tag="Mpet_0053"
FT   CDS_pept        complement(64597..64803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpl:Mpal_1984 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34834"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDF0"
FT                   /protein_id="ADN34834.1"
FT                   /translation="MSPKLTGIFSEGDTREFKEWIEKQFGSESERKAEISNIKTEIAML
FT                   RHTVERMEKKIDNIERILEKVSE"
FT   gene            complement(64842..65240)
FT                   /locus_tag="Mpet_0054"
FT   CDS_pept        complement(64842..65240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpl:Mpal_1985 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34835"
FT                   /db_xref="GOA:E1RDF1"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDF1"
FT                   /protein_id="ADN34835.1"
FT                   /translation="MNFKTVREFHWVTKIVILLTVFVVLVIPIIAFVASMLGFSVSNLG
FT                   LFMLSCTSILMYLFPIILVVIVIYMIITRVKGWIEKYMDAVLAKMDMLASRNNVEESNA
FT                   KLAVMGSRIEEIEKKVDNISDILEKVAE"
FT   sig_peptide     complement(65142..65240)
FT                   /locus_tag="Mpet_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(65230..65544)
FT                   /locus_tag="Mpet_0055"
FT   CDS_pept        complement(65230..65544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0055"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="InterPro IPR001845; KEGG: mpl:Mpal_1986
FT                   transcriptional regulator, TrmB; PFAM: regulatory protein
FT                   ArsR; SMART: regulatory protein ArsR; SPTR: Transcriptional
FT                   regulator, TrmB; PFAM: Bacterial regulatory protein, arsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34836"
FT                   /db_xref="GOA:E1RDF2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDF2"
FT                   /protein_id="ADN34836.1"
FT                   /translation="MLNPATVTELAKLLSFLGNEQRLNILRAIAHEEKFAREISEEVGI
FT                   SRPLVNIYLKQFEKAGLVTGTNHVGEEPPYLKRYYKAVPFEFALSLDLISKLEMKEDEF
FT                   "
FT   gene            complement(65730..66095)
FT                   /locus_tag="Mpet_0056"
FT   CDS_pept        complement(65730..66095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0056"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbn:Mboo_0380 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34837"
FT                   /db_xref="GOA:E1RDF3"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDF3"
FT                   /protein_id="ADN34837.1"
FT                   /translation="MTKKIFGVPAKKMVNLLASLVCGAVGTVFLGFGLNERISEYGIFF
FT                   RIVSPLQLSLIGIGFVFLVVVVFLVREAFRDGFFDPESAWEDGIRFCEANILIWLVLFC
FT                   LGVILPLIAALLLVFLW"
FT   sig_peptide     complement(66006..66095)
FT                   /locus_tag="Mpet_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(66228..66500)
FT                   /locus_tag="Mpet_0057"
FT   CDS_pept        complement(66228..66500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dmo:Dmoj_GI23746 GI23746 gene product from
FT                   transcript GI23746-RA; SPTR: GI23746"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34838"
FT                   /db_xref="GOA:E1RDF4"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDF4"
FT                   /protein_id="ADN34838.1"
FT                   /translation="MESNTAASRAGWATLLAIIVIALIILALFFLEYLVIGFLLLVGAI
FT                   VILALAAIIVTAVMIIPFYAMKGTVVEEGSYMMDDVKAVENERKD"
FT   gene            complement(66540..67232)
FT                   /locus_tag="Mpet_0058"
FT   CDS_pept        complement(66540..67232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0058"
FT                   /product="protein of unknown function DUF124"
FT                   /note="COGs: COG2013 conserved hypothetical protein;
FT                   InterPro IPR002838; KEGG: mem:Memar_1861 hypothetical
FT                   protein; PFAM: protein of unknown function DUF124; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF124; TIGRFAM: conserved hypothetical protein
FT                   TIGR00266"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34839"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDF5"
FT                   /protein_id="ADN34839.1"
FT                   /translation="MKYSITGDNLQFVTMEIENAETVWAEAGAMVYMSANMEMKAELEG
FT                   GLFKGIKRKLAGESFMVTNFTSHGGPGVVAFGGNAPGKIYEMDIAGKEFIAQKDAFLCA
FT                   EKSVNWEIAFQKKLGSTFFGGEGLILEKISGSGMVFFHACGDLVEIDLKPGQTYKIATA
FT                   HVVGWESSVNYDIQAAGGIKTSMFGGEGFFLTTLTGPGKIVIQSMTLEQLAESLIPFLP
FT                   RPSSSGSD"
FT   gene            complement(67286..68107)
FT                   /locus_tag="Mpet_0059"
FT   CDS_pept        complement(67286..68107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0059"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789:IPR000014:IPR013767; KEGG: mbn:Mboo_1912
FT                   response regulator receiver protein; PFAM: response
FT                   regulator receiver; PAS fold domain protein; SMART:
FT                   response regulator receiver; SPTR: Response regulator
FT                   receiver protein; TIGRFAM: PAS sensor protein; PFAM:
FT                   Response regulator receiver domain; PAS fold; TIGRFAM: PAS
FT                   domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34840"
FT                   /db_xref="GOA:E1RDF6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDF6"
FT                   /protein_id="ADN34840.1"
FT                   /translation="MTEKKILIVEDNFEIAEIVSIILEREGHEITGIVESGENALLSAA
FT                   AITPDVVISDIGLAGEIDGIETATYISHLFRIPVIFMTGAVDQETIERANSAEPYGYLA
FT                   KPFNKSELLSTVSLAIRAFELNMKAKESGTRKIPSCVKQMCLYEEGIVITNTLGRILYI
FT                   NPYTENLTGLSNAEMLLKPLSEILHFSGNTGFDPGALSQAAYFGEDEETVFLKDRSGGN
FT                   IMVRVRIVPRRYRDEDTVGVIITIKEISEEKSAGVRDAGTLYRPDTGSAAA"
FT   gene            complement(68110..69138)
FT                   /locus_tag="Mpet_0060"
FT   CDS_pept        complement(68110..69138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0060"
FT                   /product="phosphate-binding protein"
FT                   /note="COGs: COG0226 ABC-type phosphate transport system
FT                   periplasmic component; KEGG: mac:MA2349 phosphate-binding
FT                   protein; SPTR: Phosphate-binding protein; PFAM: Bacterial
FT                   extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34841"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDF7"
FT                   /protein_id="ADN34841.1"
FT                   /translation="MLLSAPEKKSGFANIQKKNAISTFIIVIFFLAAASPGCLSDDAGI
FT                   AGAAGEGQKNLTISGSTTIQPVSEILAAAYMKENPGVDIVVNGGGSGMGIKEAGTGLTD
FT                   IGAASRDVEDSELLSYPDLEVYRIGASAIVIITSQMNGIDTITFEEASALYNGESEDIS
FT                   SMADIAGINSVIQRSEKSGTEETFANWLFPGKKNVDSSLEAEDYGINGKVKQLAAEGNS
FT                   EVLNLVKDNPFSIGFVDFGYAESDPGVKILKIVDKGSGEAVPSDITKIREAILLELRNE
FT                   EHSDGGGSFYISGLTRPLNYVTKSDASALAKDFIEFATSPSSDDYFNEVGYFSVAELNQ
FT                   EV"
FT   sig_peptide     complement(69019..69138)
FT                   /locus_tag="Mpet_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            69299..72445
FT                   /locus_tag="Mpet_0061"
FT   CDS_pept        69299..72445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0061"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR000014:IPR001610:IPR003661:IPR003594:IPR
FT                   001789:IPR004358:IPR005467:IPR000700:IPR003660:IPR007892:I
FT                   PR013767:IPR013656; KEGG: ppd:Ppro_3008 multi-sensor hybrid
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; CHASE4 domain protein; histidine kinase HAMP
FT                   region domain protein; PAS fold domain protein; PAS fold-4
FT                   domain protein; histidine kinase A domain protein; response
FT                   regulator receiver; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS domain
FT                   containing protein; PAC repeat-containing protein; response
FT                   regulator receiver; SPTR: Sensor protein; TIGRFAM: PAS
FT                   sensor protein; PFAM: HAMP domain; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; Response regulator
FT                   receiver domain; CHASE4 domain; His Kinase A
FT                   (phosphoacceptor) domain; PAS fold; TIGRFAM: PAS domain
FT                   S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34842"
FT                   /db_xref="GOA:E1RDF8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007892"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDF8"
FT                   /protein_id="ADN34842.1"
FT                   /translation="MALVEGDSGYELFSRITSPFGRKGRGKGEKRKSIRTTTAAIIAVT
FT                   LLGLIFLLYILSSVSLDSGFSSLEERLTGDNVMRAANAVNAEVDRLDSIANAWATSEEL
FT                   PEFIDSGDTSVARTIFTDGRLVDVGVNILLITDSEGNILWHKYMNLDYGHQMPTPKSLL
FT                   SQIAGHEDVLSNGTTKGTLMLNSGPMLIASRPITDPESGDPFGNLLVGRYLDRSEVSSL
FT                   SATTQLDISVIENKSGFEEYFEIFADKGAGNAANGSSIIISPVDDKYVAGFSEIYDIYG
FT                   EPVAVLQVTEPRDVTIYGKGVLSLLIMMLVLASVIFGAVILVLIQRSVVSRLENLNREI
FT                   KTVAMTESPEGRINIEGDDEISSVGSAINMMLESIEKGKEQYSRLFDNANDLIFTIDAD
FT                   GAFVSANGAMEKKTELEDGGLAGRKIEEFVRNGGMEKIRPLLAGNGMENSGKTEITLLS
FT                   ASGEEYLVEFSAQPLTGSDEMTGFFVIARDVTAKRKAEEELKNHRNRLRELVTERTAQL
FT                   EHANSELVKEVEERIRFEESLAEEKERLSVTLSSIAEGVIATDHLGYVTLINREASAKT
FT                   GISAGNSEGKRIDSIFMLEKAGRPEDIGSIVLDVISDRKVFEINTEVDLFDSEGNAYPV
FT                   VLSVSPLTDRSGTSIGAVIVFREISERLRWEEEVLRRQKLESLGVLAGGIAHDFNNILT
FT                   AISGNIGLARNMAEGDVDVSSRLEEAEKAISRAKDITRQLITFSKGGEPVRQVQDIKSM
FT                   IRESAEFVSHGSNVKLYFDIADDLSNVEVDKGQISQVIENLVINSIQAMADGGNIYVQA
FT                   RNAGVISGKDGLEDGKYIVISVRDDGSGIPEEYREKIFDPYFTTKKSGNGLGLASCMSI
FT                   IRKHGGAVKLISEVGVGTEFRIYLPATERSVEAEDGLSGGMLSGSSRVLVMDDDRSIYD
FT                   TIPQLLRGYGFDVEAALDGAEAIRIYQQSKILKKSIDVFVMDLTVPGGLGGVETIALLR
FT                   EFDPDILAIVSSGYSNDPVMADFREYGFDAVLPKPYNIEDLVRLINRLVSEKEKKDKTG
FT                   "
FT   gene            complement(72460..73218)
FT                   /locus_tag="Mpet_0062"
FT   CDS_pept        complement(72460..73218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0062"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="COGs: COG0675 Transposase and inactivated
FT                   derivatives; InterPro IPR010095; KEGG: tac:Ta0475
FT                   transposase related protein; PFAM: transposase IS605 OrfB;
FT                   SPTR: Transposase related protein; TIGRFAM: transposase,
FT                   IS605 OrfB family; PFAM: Putative transposase DNA-binding
FT                   domain; TIGRFAM: transposase, IS605 OrfB family, central
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34843"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDF9"
FT                   /protein_id="ADN34843.1"
FT                   /translation="MTQVQAELSDRWIGIDLNTTGYIAVVADPNTGFTAKLGREARLIH
FT                   DEFNRERKKLKNRKKTRNLKRLDKRETGQLRDLNKYLSREIVRIASDLDCGIKFERLSG
FT                   GRFRRKNRRGIITDFSINNWYFYHLCQMVENRAVRRGIPVLYVDPSFTSQICSRCGAHG
FT                   RRHRKVFQCPECGYICHADVNAAFNIARSPVNRWEDMEKIRLEAERAKIKREIRRINAV
FT                   SKSPACEIADWSSFPADSFSLLFSRQSCEI"
FT   gene            73467..74435
FT                   /locus_tag="Mpet_0063"
FT   CDS_pept        73467..74435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0063"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="COGs: COG3366 conserved hypothetical protein;
FT                   InterPro IPR011642; KEGG: mja:MJ0880 hypothetical protein;
FT                   PFAM: nucleoside recognition domain protein; SPTR:
FT                   Uncharacterized protein MJ0880"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34844"
FT                   /db_xref="GOA:E1RDG0"
FT                   /db_xref="InterPro:IPR038880"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDG0"
FT                   /protein_id="ADN34844.1"
FT                   /translation="MFSDIQFISFLNYTIRAVLLITAGIILVNLISETGVMSKFKIISV
FT                   PLCRISGLSEEAVLSILSMVINPTAGKSMLAEYHRAGKVGKEEIVPSLIIGTFPAVFGE
FT                   SIFRAQFPTAVVILGPVLGGIYTFFNLFSTFIQVIGALIYTNLVLRRKRSVPEKEYEKV
FT                   EAAEKLKRPDMKSLKKAVEKSKKPLKKIIPITIITMIVFWLLGVAGVLNWLSVIFDPIL
FT                   NLIGLPGEASAALLAQFMHFSAGYTVVGSMVDTGMLDFGQALVTLILGSMILITMIYLK
FT                   YSVPLYIGMFGKDGIRVAVIAYSASMAAKVICIAIVMAIFF"
FT   gene            complement(74458..74868)
FT                   /locus_tag="Mpet_0064"
FT   CDS_pept        complement(74458..74868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_1233 NlpA lipoprotein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34845"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDG1"
FT                   /protein_id="ADN34845.1"
FT                   /translation="MIFQDDIPSCLAKWGTCILLLTALLLVSGCTDEDQYTDNESVSVG
FT                   ELLANPEYDTPVYVNGVVSDLGILNCLCFHLTSGGEKIDVWYDMMVEDNKTSRPAVDVS
FT                   GLSNGEEVVLLGELKSEGEYRQKNAFWLIKVE"
FT   gene            complement(75012..75959)
FT                   /locus_tag="Mpet_0065"
FT   CDS_pept        complement(75012..75959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0065"
FT                   /product="methenyltetrahydromethanopterin cyclohydrolase"
FT                   /EC_number="3.5.4.27"
FT                   /note="COGs: COG3252 Methenyltetrahydromethanopterin
FT                   cyclohydrolase; InterPro IPR003209; KEGG: mpl:Mpal_2022
FT                   methenyltetrahydromethanopterin cyclohydrolase; PFAM:
FT                   Methenyltetrahydromethanopterin cyclohydrolase; PRIAM:
FT                   Methenyltetrahydromethanopterin cyclohydrolase; SPTR:
FT                   Methenyltetrahydromethanopterin cyclohydrolase; TIGRFAM:
FT                   methenyltetrahydromethanopterin cyclohydrolase; PFAM:
FT                   Cyclohydrolase (MCH); TIGRFAM:
FT                   methenyltetrahydromethanopterin cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34846"
FT                   /db_xref="GOA:E1RDG2"
FT                   /db_xref="InterPro:IPR003209"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDG2"
FT                   /protein_id="ADN34846.1"
FT                   /translation="MISVNEIALDLFEDLAEFPEDYNVEFHQLDNGARLVDCGVSAIGG
FT                   YQAGKRFTEICMGGLSEITFRNGKINEIPMPFIDVNTDFPAISCLGAQKAGWTVKVGNF
FT                   FAMGSGPARALSLMPKHTYEVIEYEDESDYAVICLESDKLPNGEVMENIAEKCGVDVAN
FT                   VCAVVAPTASIVGSIQVSGRCVETAIYKLNELGFDTKKVESAMGTAPIPPVKKDSTRAM
FT                   GCTNDATIYHGQIYLTMRAPEIKDYLDKIPSNKSSSYGEPFYDTFKKANFDFYQIDTNL
FT                   FSPAEVVINELSEGVVYRVGAINPEVTLKSFGLL"
FT   gene            complement(76031..77164)
FT                   /locus_tag="Mpet_0066"
FT   CDS_pept        complement(76031..77164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0066"
FT                   /product="orc1/cdc6 family replication initiation protein"
FT                   /note="COGs: COG1474 Cdc6-related protein AAA superfamily
FT                   ATPase; InterPro IPR014277; KEGG: mem:Memar_0669 cell
FT                   division control protein 6; SPTR: ORC complex protein
FT                   Cdc6/Orc1; TIGRFAM: orc1/cdc6 family replication initiation
FT                   protein; PFAM: CDC6, C terminal; TIGRFAM: orc1/cdc6 family
FT                   replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34847"
FT                   /db_xref="GOA:E1RDG3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDG3"
FT                   /protein_id="ADN34847.1"
FT                   /translation="MSNMKKNLLMWEETLFRDPEVFEIDFVPEQFNFRDTQMRELAFQV
FT                   RPGMKGARPLNTICRGPPGTGKTTSIKKLFLDIEEATHRIIPVHVNCQIENTKFAIFSR
FT                   IYRKLSGQQPPASGTSFKSLFDSVCKLILDKDAVLLVCLDDANYLLYENEINKVLYTLL
FT                   RAHESYEGVRIGVIAIISDMGVDLMREVDSRVSSVFRPTDIYFPPYGEDEIHEILNQRI
FT                   QQGLYPNVVNEAMLDLVVEQTANLGDLRVGIDLLKRATLYAENDARRSLEREDICRAYE
FT                   ISKYLHLSHTAKTLKDEERDVLKIIAENSMDKKELSAGAIFELIKESRKMGYTRYYEIV
FT                   KKLDAMRLLNLNYREGRGRTRLITLRYDPARVLEILD"
FT   gene            complement(77233..77703)
FT                   /locus_tag="Mpet_0067"
FT   CDS_pept        complement(77233..77703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_0670 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34848"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDG4"
FT                   /protein_id="ADN34848.1"
FT                   /translation="MSEKRKLSIGITVNLENYENLKVEVEGEAKDGCDADELIEYLDSV
FT                   LSRFGRNDPETKKRIDNYRRRVLENPGEPVITNIVEEETYPAPEILQTPAEPAIPVSEP
FT                   AQEKPLPEEKPVENTGFTCSSCGRPISKAEEQLSQIFMGRSLCKKCLEEMQK"
FT   gene            complement(77888..79063)
FT                   /locus_tag="Mpet_0068"
FT   CDS_pept        complement(77888..79063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0068"
FT                   /product="proposed homoserine kinase"
FT                   /note="COGs: COG3635 phosphoglycerate mutase AP
FT                   superfamily;
FT                   InterProIPR013371:IPR004456:IPR017871:IPR019304:IPR 006124;
FT                   KEGG: mem:Memar_0702 proposed homoserine kinase; PFAM:
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; metalloenzyme domain protein; PRIAM:
FT                   Phosphoglycerate mutase; SPTR: Phosphoglycerate mutase;
FT                   TIGRFAM: proposed homoserine kinase; phosphonopyruvate
FT                   decarboxylase-related protein; PFAM:
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; Metalloenzyme superfamily; TIGRFAM:
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase, archaeal form; proposed homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34849"
FT                   /db_xref="GOA:E1RDG5"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023665"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDG5"
FT                   /protein_id="ADN34849.1"
FT                   /translation="MKAIVILGDGMADEPLEELGGKTPIEYANTPYMDWAASNGACGML
FT                   KTVPDGMVPGSDVANLSVLGYDPRECYTGRGPLEAVSMGIDFGEDAIAYRCNLVTIEDG
FT                   VMADFSAGHITGDDGPRLIESLNKALPEGIRVYPGVSYRNLLILQGGKGSESAPPHDIV
FT                   GQEIDPHVPKGPDREILLEAMNIAAEVFKDHPVNRERIARGEKPATGIWPWSGGKKPSM
FT                   EPFKEKYGVSGGMISAVDLLNGIATLAGMEIITVPGATGFLDTDYMAKAKYALEGLKRL
FT                   DFIYMHVEAPDEAGHMGSIEEKVKAIERLDEAVGMILESTDAAIGILPDHPTPIRLKTH
FT                   TSNPVPFIIVGRGRDRTTCYSEKEAAENGGFGLIEGDMFMKLLLGQAEKKE"
FT   gene            complement(79060..80004)
FT                   /locus_tag="Mpet_0069"
FT   CDS_pept        complement(79060..80004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0069"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR001509; KEGG: mem:Memar_0703
FT                   NAD-dependent epimerase/dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase; SPTR: NAD-dependent
FT                   epimerase/dehydratase; PFAM: NAD dependent
FT                   epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34850"
FT                   /db_xref="GOA:E1RDG6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDG6"
FT                   /protein_id="ADN34850.1"
FT                   /translation="MFSVVTGGAGFIGSHIVDALVKKGDRVLVIDNLSAGATTNIMPLI
FT                   ESGKAEFLQADLLDDGWQERISGAGRVFHLAADPDVRASAISPARVFDNNVLATERVLD
FT                   AMRVHGAKEFVFTSTSTVYGEAGVIPTPENYSPMIPISIYGASKLACEAMIAGYAHTYG
FT                   MKSWVFRFANIIGERSGHGVIWDFVHKLIDNPEELEILGDGKQIKSYLSVGACIEAVLF
FT                   AIENSDEAFNFFNIGSEDWIDVTALAEIVVEEMDLSGVRFTYTGGDRGWVGDVPKMQLG
FT                   VDKLKTLGWKPETGSVESVRLAVKALLKEIKYI"
FT   gene            80185..81450
FT                   /locus_tag="Mpet_0070"
FT   CDS_pept        80185..81450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0070"
FT                   /product="uracil-xanthine permease"
FT                   /note="COGs: COG2233 Xanthine/uracil permease; InterPro
FT                   IPR006042:IPR006043; KEGG: dat:HRM2_05320 UraA; PFAM:
FT                   Xanthine/uracil/vitamin C permease; SPTR: UraA; TIGRFAM:
FT                   uracil-xanthine permease; PFAM: Permease family; TIGRFAM:
FT                   uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34851"
FT                   /db_xref="GOA:E1RDG7"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDG7"
FT                   /protein_id="ADN34851.1"
FT                   /translation="MDLTANKKETGKNVLMGLQMIFVAFGSLVLVPLLTGLDPSVALFT
FT                   AGVGTLIFQVVTKWKVPIFLASSFAFIPAITYGIAAWGLPSTLCGLAAAGLFYVVLSIA
FT                   IRYFGVGIIHRVFPPIVVGPVIAIIGLSLAPTAVSMALGQSGDVQVIPVETALIIAGIS
FT                   LAATLAVFLFAKGILKLIPVLVGIVVGYIVSLVLGVVDMSSFFESSIIAVPHFVLPEWN
FT                   LAAILFIVPVAIAPAIEHFGDILTIGSVTGKDYLADPGIHRTMLGDGIATFFASFVGGP
FT                   PNTTYSEVTGAVALTKAFNPVIMTFAAIFAIIFAFVGKIGGFLQTIPNPVMGGVMILLF
FT                   GLIASLGINQLILNKVNLSSAKNIVIVSLILVAGLGGLFIPIGDFQLAGIGLAAVIGVV
FT                   LNLIIPGEKEEEHVVGDKGVDF"
FT   gene            81452..82081
FT                   /locus_tag="Mpet_0071"
FT   CDS_pept        81452..82081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0071"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="COGs: COG0035 Uracil phosphoribosyltransferase;
FT                   InterPro IPR005765:IPR000836; KEGG: amc:MADE_02630 uracil
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase;
FT                   SPTR: Uracil phosphoribosyltransferase; TIGRFAM: uracil
FT                   phosphoribosyltransferase; PFAM: Phosphoribosyl transferase
FT                   domain; TIGRFAM: uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34852"
FT                   /db_xref="GOA:E1RDG8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDG8"
FT                   /protein_id="ADN34852.1"
FT                   /translation="MPSCTVNHPLVAHKLSLLRDISTNSKDFRDLIRELTMYLTYEATR
FT                   DWELEKTSVRTWEGRDVEAFRAKGIDPTIVPIFRAGIGMQEGFLQVIPTATISYIGFYR
FT                   DEETLLPQMYYAKLASRITERKVYILDPMLATGGTTSAVCSYLKKHGCTDIKVLCILAA
FT                   PEGLAKMDEDHPDVSILPAAIDSHLNEKGYIIPGLGDAGDRLFGTK"
FT   gene            82142..83032
FT                   /locus_tag="Mpet_0072"
FT   CDS_pept        82142..83032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0072"
FT                   /product="protein of unknown function DUF368"
FT                   /note="COGs: COG2035 membrane protein; InterPro IPR007163;
FT                   KEGG: mem:Memar_0704 hypothetical protein; PFAM: protein of
FT                   unknown function DUF368; SPTR: Putative uncharacterized
FT                   protein; manually curated; PFAM: Domain of unknown function
FT                   (DUF368)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34853"
FT                   /db_xref="GOA:E1RDG9"
FT                   /db_xref="InterPro:IPR007163"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDG9"
FT                   /protein_id="ADN34853.1"
FT                   /translation="MTRKETFFEYAIIYIKGLLMGICDIIPGVSGGTMALITGIYERLV
FT                   RAIGNIGPSPAKYLLKGDVKSAMEEFGKFDPIFLVVLVAGIGTSFLAMSNIILVLLNDY
FT                   AVQTFSFFFGLIVASAVVLFLIIEEDSRDKRAAAFLLIGAAAGFILAGLNPASLGHSLP
FT                   VLFLSGMAALCAMILPGISGSYIMLVLGQYEYMLSVIKSLSFVEIATYVAGGVIGLLLF
FT                   SRLLKYLLKTHHTAMIAFLTGLMLGSARLLFDKITAAGGTIGSAFLFVAAGAVVIIIME
FT                   LAKRFFSDREQKAEN"
FT   gene            83184..83654
FT                   /locus_tag="Mpet_0073"
FT   CDS_pept        83184..83654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbr:CBG18301 Hypothetical protein CBG18301;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34854"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDH0"
FT                   /protein_id="ADN34854.1"
FT                   /translation="MSLKPLIEKKYLINGPHSEAKMEIVDKNIQEIISGGTNKFTYDTV
FT                   VLKPYAKAYLGITLSPETRLSEDETTYEEEWRDIGQNSLKKLYPGEFLEKPDTIYLLYK
FT                   DESSEVVRSYEKIFLDEFSGFIDADEAEVDAEKKDMGMNSYYLYLFLQYYMK"
FT   gene            complement(83663..84844)
FT                   /locus_tag="Mpet_0074"
FT   CDS_pept        complement(83663..84844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0074"
FT                   /product="Abortive infection protein"
FT                   /note="InterPro IPR003675; KEGG: mem:Memar_0536 abortive
FT                   infection protein; PFAM: Abortive infection protein; SPTR:
FT                   Abortive infection protein; PFAM: CAAX amino terminal
FT                   protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34855"
FT                   /db_xref="GOA:E1RDH1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDH1"
FT                   /protein_id="ADN34855.1"
FT                   /translation="MNILSTPPESVRFTGILVLVLVFALAPVFGFFAGDGSPAGEFLGA
FT                   SATLAPFVILAIAAYLSMNKRMDMLKYPAYAILLGIILATAFISFFFGLISILPADIVF
FT                   SEEFDPGAFDAIADTGILGKIALLFLGCAGAAIFSLIPLLKTVRVKLASRLDFDPFCRV
FT                   HIIALVAIFAVTIIPLVPVSVAGVPPYLSPAFMEIIKNDAAFLEGTVAVDIYTLFWTIL
FT                   ASFAIVGLFTKRNFKEALQRLGLSEPGAKEVLIAIGAALSLIVVFYAVDAIIALIWNAA
FT                   GWPLTDSDAFEAFLVPYMTLPGIVIASVCAGFGEEISVRGVLQPRFGIILPAMLFASLH
FT                   AFQYNWDGIISVFIAGLIFGIIRQRYSTTVSAITHTTYDFVLFLGLLLGFNVI"
FT   gene            84987..85859
FT                   /locus_tag="Mpet_0075"
FT   CDS_pept        84987..85859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0075"
FT                   /product="methanogenesis marker protein 12"
FT                   /note="COGs: COG4020 conserved hypothetical protein;
FT                   InterPro IPR016735; KEGG: mem:Memar_0705 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   methanogenesis marker protein 12; TIGRFAM: putative
FT                   methanogenesis marker protein 12"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34856"
FT                   /db_xref="InterPro:IPR016735"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDH2"
FT                   /protein_id="ADN34856.1"
FT                   /translation="MYIGIDHGTTAIRFACETGHFKISREDAREFKFSDLERLCPVDEI
FT                   DGISVCYSMGDGISAITSIGKVENRGVVSREGAGEHIGGGTRVYDEVAGSGVPAVVIPG
FT                   IHRGSPTDPRFKAYSHQTSPEKIGIAYQVFLDHGGDFVVADVSSNTVTMLVSGGKIVGA
FT                   FDACIFSPGTKHGALDVDAIRKIDNGEWSANEAFLHAGVGESLPADVRKSALAMFTAME
FT                   CASMKLLNRDAKVALAGSMAPAIAAEVEALLQEKIFVYDEWCASIGLWKIAKEVFERKE
FT                   GVLGLELDL"
FT   gene            86009..87760
FT                   /locus_tag="Mpet_0076"
FT   CDS_pept        86009..87760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0076"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089:IPR004090:IPR000014; KEGG: mpl:Mpal_1769
FT                   methyl-accepting chemotaxis sensory transducer with PAS/Pac
FT                   sensor; PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; SPTR: Methyl-accepting
FT                   chemotaxis sensory transducer with Pas/Pac sensor; TIGRFAM:
FT                   PAS sensor protein; PFAM: Methyl-accepting chemotaxis
FT                   protein (MCP) signaling domain; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34857"
FT                   /db_xref="GOA:E1RDH3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDH3"
FT                   /protein_id="ADN34857.1"
FT                   /translation="MVRESFNNQEYTLQLLYENPLPMVIFDTGGRIVDFNRAFIDFSGY
FT                   GDDRLGGMHVSEFRTVNHGGEGFSACLEKRSGVRLFEDMELPSGLKYADVRFTPVKDGK
FT                   GDIEYIFGVYIDKSKIISRNKYMSKFISKTVSNLSLLAEGNTGFDLEVPPAGDQTEELR
FT                   ANFLKINDQLKLAKEAIDSMIDESARLSEAGINGNLSYRADASKFRGGFATVIGGFNET
FT                   LDAVVFPVRETVRIANAFAKKDFSRRFSEQIIVGGDFAGLKAALNGTGAEIGESLSEIR
FT                   ESVRVLEEYVRGTSENVNDVAGATEKVAIKNRESAENSEKQLEAVERVGREIEDLSASV
FT                   EEIASNAAEVRDVAQRVIATGDEAKNLGSEADARMNAVERLSQECVENIGRLNTRMLEI
FT                   NDIVKLISDISSQTNMLALNAAIEAARAGEHGRGFAVVAQEVKNLAGESKTAAARISGL
FT                   IDEIKSESDVTTRSMETSYNEISEAIASVEKTIESLNGIVNLANEASVGVIEIAKASEM
FT                   QSNATASVMGSMEQTTGMNRENMERIIQVASLSEDVSASIEEIGMGTAELSDMAKNLRN
FT                   ILEEYRF"
FT   gene            complement(87757..89493)
FT                   /locus_tag="Mpet_0077"
FT   CDS_pept        complement(87757..89493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0077"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterPro IPR003660:IPR003594:IPR005467:IPR011495; KEGG:
FT                   mem:Memar_2345 integral membrane sensor signal transduction
FT                   histidine kinase; PFAM: histidine kinase
FT                   dimerisation/phosphoacceptor; histidine kinase HAMP region
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase HAMP region domain protein; SPTR: Sensor protein;
FT                   PFAM: Histidine kinase; HAMP domain; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34858"
FT                   /db_xref="GOA:E1RDH4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDH4"
FT                   /protein_id="ADN34858.1"
FT                   /translation="MARRDFSFYYRLLTFIIILTVPLISGLFYLSVIDVSNDYKEKYAF
FT                   LQENTEENIINAVKTVDQGLAIYDMGLDEEMKRSFAIFLGAYNESGGSPGDMDLESLKE
FT                   ELGERYDLYIIDGKNVIAYTTNEIDLGLDFSNSGSFTEFLDQTRNGDSFVGDRISKGVR
FT                   DIENIRKYAYYPTPDHKYILELSYAIKKEDARFLLRYGNTVDQLRPLNPYLESIDLYEV
FT                   LGNLIGDSSETEPEMKALVKEEVIGKKSDYVIRDDEAGTATVIRYVDLSRPESGADMSL
FT                   AIAFIYDEKMLNDEINSVVLFQLGIYAIFVALFFTLLIVLTKTFTKPIRDIVEDVDAIA
FT                   GGDYDHEIRSSGVREFSQLEESISNMVEKIVGALDEKTVLLHELHHRVKNNLQIISGII
FT                   QLQSGSVGDTAAKEALLMCENRIRAIASVHESLYRADDISSVNSKEHFTSLAFNIIQSL
FT                   CDYEDCRVNLELDIENHRLPIDLVIPLSLVINEILSNSVKYAFAGRESGTIGIRFRLRD
FT                   GRILLDVWDDGIGLPEDYEKHRQGSLGLTIVKRLIRDQLKGTMTVNTERGTWYSFDIPG
FT                   DI"
FT   gene            complement(89566..91452)
FT                   /locus_tag="Mpet_0078"
FT   CDS_pept        complement(89566..91452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0078"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR003660:IPR003594:IPR004358:IPR005467:IPR 018170;
FT                   KEGG: mem:Memar_2343 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; SPTR: Sensor
FT                   protein; PFAM: HAMP domain; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34859"
FT                   /db_xref="GOA:E1RDH5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDH5"
FT                   /protein_id="ADN34859.1"
FT                   /translation="MSIKNKFSEKLSFLQLLLIICILIVIPISLGLAYDSYKSVSEEYN
FT                   SNFDLLKNNTEQSIIETLIVVDKGLTVYDEGLDDLMKKGFEPFLSAYDESEGDLSQVDL
FT                   EAIREGLGEDYNLYVIDETHTITYTTMATDLGLNFSYLEDFSGFLDNVREGYSYVGDRV
FT                   VKGIREEKTIRKYAYYPTPDHRYVLELSYDIDEDGPRKFLQYSRTIEELKGMNPYLTSV
FT                   KLYDIFGYTIGEPDEPDKELRKFIINNVIGEKKSVTLEDSAKGTFTDYRLVNLYEDGIG
FT                   SDTSLAIAFTYDENLLEDNIASAWYSDLLNIAGLSILLILILSIFCIAISRPLKYLVDD
FT                   VDKIASGDLDHQIRTGRGGKEFAHLEASISNMVERLKKTISKVRESEELIKRQNDELET
FT                   IVASRTKEALEKSNEANFYLDIITHDINNSNMAALGYAEIMLDLSKEEDRSIVKMLISA
FT                   IHQNTDIIRNISLMRAMKNGEKDASLSPVNLDNIIRHAISLFPLKVAYEGTGLKVMADK
FT                   LLEEVFTNILGNSIRHAGSDCEVRISVTESGDDVRICIADNGPGIPDDRKEECFNRYTK
FT                   NLSGRTANGNGVGLFIVKTLVTERYGGSVEALDTVEGHPEKGLMICVTLRKA"
FT   sig_peptide     complement(91354..91452)
FT                   /locus_tag="Mpet_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(91633..93288)
FT                   /locus_tag="Mpet_0079"
FT   CDS_pept        complement(91633..93288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0079"
FT                   /product="thermosome"
FT                   /note="COGs: COG0459 Chaperonin GroEL (HSP60 family);
FT                   InterPro IPR017998:IPR012714:IPR002194:IPR002423; KEGG:
FT                   mem:Memar_2346 thermosome; PFAM: chaperonin Cpn60/TCP-1;
FT                   SPTR: Thermosome; TIGRFAM: thermosome; PFAM: TCP-1/cpn60
FT                   chaperonin family; TIGRFAM: thermosome, various subunits,
FT                   archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34860"
FT                   /db_xref="GOA:E1RDH6"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDH6"
FT                   /protein_id="ADN34860.1"
FT                   /translation="MAANLGGQPIFILKEGSQRTRGRDAQSGNIAAAKAVASAVRTTLG
FT                   PKGMDKMLVDTIGDVVITNDGVTILKEMDIEHPAAKMMVEVAKTQDDEVGDGTTTAVVV
FT                   AGELLKRAEELLDQDVHPTVIAHGYRLAADKAQELIKELAIDVKPTDKKMLTKIADTAM
FT                   TGKGAEAAKDKLTELVVKAITMIADEDGTVDTDFVKVEKKVGGTIEDSEIIEGVVIDKE
FT                   RVHPGMPKKIENAKILLLNAPVEFKKTEVDAEISITSPDQLQMFLDEEEKMIKTIVEKI
FT                   VKSGANVLVCQKGIDDIAQHYLAKAGVLAVRRVKKSDLTKLSRATGATVISSIDAIDAA
FT                   ELGKAGLVEEKKVGGEEMIFVTECDNPKACTLIVRGGTEHVVDELDRALEDALRVVGVA
FT                   VEDKKFVAGGGSPEVELSLRLREFAASQEGRSQLAIEAFANALEIIPRTLAENAGLDPI
FT                   DMLVELRSEHENGKKTAGLNVFEAKAVDMLKAGVVEPMRVKTQAIASAAEAAVMILRID
FT                   DVIAASKMGGGAPGPEDMEGMGGMGGMGGMPPMM"
FT   gene            complement(93344..94264)
FT                   /locus_tag="Mpet_0080"
FT   CDS_pept        complement(93344..94264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0080"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="COGs: COG1395 transcriptional regulator protein;
FT                   InterPro IPR001387; KEGG: mpl:Mpal_0031 transcriptional
FT                   regulator, XRE family; PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein; SPTR:
FT                   Putative HTH-type transcriptional regulatory protein
FT                   Mpal_0031; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34861"
FT                   /db_xref="GOA:E1RDH7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR020886"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDH7"
FT                   /protein_id="ADN34861.1"
FT                   /translation="MSQERLVQTVISVLIMAGYNVSERCGIRPRSFDIIARKDAKLLVI
FT                   KVVPHIDSVGEESAHDLALIAHHLDATPIIVGERARDSELERGAVYIRHGIVATNSKTL
FT                   YDFLVDEVPPLVFAQPGGLYVNINGGKLRDLRESRNLSLGDLASSLGVSRRTISKYESG
FT                   MSTTLDIAIRLEELFDAAIVEAIDILKKSSDLAKKSEQKEHEDNFPPDFRRIGIETHTM
FT                   CRAPFDALAVYEKKTILTGYGTAQKTIRHAGLIGNISEITESRAVCVLTDYKKKKRIGK
FT                   TLIIGEDMLSDLTQGSEFIELIEDQ"
FT   gene            94389..95606
FT                   /locus_tag="Mpet_0081"
FT   CDS_pept        94389..95606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0081"
FT                   /product="domain of unknown function DUF1743"
FT                   /note="COGs: COG1571 DNA-binding protein containing a
FT                   Zn-ribbon domain; InterPro IPR013696:IPR004365; KEGG:
FT                   mbn:Mboo_0194 hypothetical protein; PFAM: domain of unknown
FT                   function DUF1743; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; SPTR: Putative uncharacterized protein;
FT                   PFAM: Domain of unknown function (DUF1743)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34862"
FT                   /db_xref="GOA:E1RDH8"
FT                   /db_xref="InterPro:IPR013696"
FT                   /db_xref="InterPro:IPR024913"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDH8"
FT                   /protein_id="ADN34862.1"
FT                   /translation="MLIGIDDTDSPAGMCTTYLGAVFAGKLREEGYSVDSMTLARLNPN
FT                   ARYKTRGNAAVCIETNAGEKGFDLACSLVDELADLSCERTNPGVAMAESPLPSWFYTKA
FT                   VTDFLTIEEAAEFLDENGAVYKGWKNGRGLIGAAAALSASFDDSTYELLAYRHHEEKGE
FT                   RIVDRGSIFLAEEKTYPHTWDSVDFGNNVVVCVPHTPDPVLYGIRGESPEWVKKAVSYI
FT                   KSEEPFITALYRTNQGTDAHLLDARIADIKEDRSYRIRGNVSSSPSTGEGGHVSFLLSD
FT                   EPGISVRCMAYEPTKEFRDVVRKLIPGDEVTVCGSFKGGSINLEKIEVISLAEKTFAKP
FT                   PVCSCGKRMTSAGTGKGYKCRRCGEKSGEAEIVHIERELPLGWYEVPPVARRHLSKPLV
FT                   RSRAKN"
FT   gene            95639..96757
FT                   /locus_tag="Mpet_0082"
FT   CDS_pept        95639..96757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0082"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; InterPro IPR001173; KEGG:
FT                   mla:Mlab_0663 hypothetical protein; PFAM: glycosyl
FT                   transferase family 2; SPTR: Glycosyl transferase, family 2;
FT                   PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34863"
FT                   /db_xref="GOA:E1RDH9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDH9"
FT                   /protein_id="ADN34863.1"
FT                   /translation="MFIFIISIVLLLISGFPYLYYLLGIKFGKKTLPVTVLNEDQYPPV
FT                   SVIISAYNEEKIIAERLENLIEGGYSLEKFELIFIDDNSSDNTKKLAESKLADLGVNYR
FT                   IFSNDSRKGTNRSYNFALGIAENNIVVTTDANKFFEKDALRVLISRLLSDDRIAAVCAE
FT                   TKPFAKSAKERTGGMESVYRGFYGRMCDWESANDSTYNFNGSLVAFKKDIIGSIKENKG
FT                   ADDANTAFEAIRKGYRAAYVMDAVIYEKIPPNIHKQYKQKVRRAKRLIEATLSNLDLLG
FT                   EKRIFSRRFYPVRIMMYVTSPFLFLLGTVLFFISLFIFNAIAATLLLVLLLLFVYAKKS
FT                   SFISSFIINQIYLLLGLLNIRKDMRTWESTSV"
FT   gene            complement(96766..98571)
FT                   /locus_tag="Mpet_0083"
FT   CDS_pept        complement(96766..98571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0083"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="COGs: COG0367 Asparagine synthase
FT                   (glutamine-hydrolyzing); InterPro
FT                   IPR006426:IPR017932:IPR000583:IPR001962; KEGG:
FT                   mem:Memar_2057 asparagine synthase (glutamine-hydrolyzing);
FT                   PFAM: asparagine synthase; glutamine amidotransferase
FT                   class-II; PRIAM: Asparagine synthase
FT                   (glutamine-hydrolyzing); SPTR: Asparagine synthase
FT                   (Glutamine-hydrolyzing); TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); PFAM: Asparagine synthase;
FT                   TIGRFAM: asparagine synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34864"
FT                   /db_xref="GOA:E1RDI0"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDI0"
FT                   /protein_id="ADN34864.1"
FT                   /translation="MCGIAGLFNISGKPADEKCLRSMSEVLTHRGPDDSGFFIEDEIGL
FT                   AHRRLSIIDLSKEGRQPMTNEDDSLWLIFNGEIYNYPDIKTELTSLGHIFKSETDSEVI
FT                   IHSYEEWGPDCLSKFNGMWAFAIWDGNKKELFCARDRLGIKPFYYAIKDDNFIFASEIK
FT                   ALRCYQGVGKEPNEKQLINFLKWGLSDHTNETMFDGIFQLPAGHYMQIRAGCQPEAFCY
FT                   WHTEKSNEIISDHKTDTEDSKQLLELLKDSVKIHLRSDVPTGTCLSGGLDSSTITALIN
FT                   RLLKENCPGAPKQKTFSAVFEEKKFDESEYVKIVTDFLKVDAYYTRPNPEDLWEDLGHL
FT                   IYSNDEPFMQLTLYSQYCVMRDLSKQVKVVLDGQGADEIFAGYLAYIYCHISSLLHGKH
FT                   FLTAASESLGVLRRHSGFLFYAVRQYFVRKQRRDLIKGFEEPLVRYQGNLNESLMTDLT
FT                   STNLPYLLHWEDRVSMAFSVEARVPFLDYRVVNFANSLPADKKIRKGVTKFIFRKSIKD
FT                   LVPESIRCRMDKKGFSTPEEVWMQGSLKDHILEVLGSESFSSRKYWDSKMVTADYNDFI
FT                   AGKKQYSSEIWRIVCTELWLRIFFP"
FT   gene            98710..101295
FT                   /locus_tag="Mpet_0084"
FT   CDS_pept        98710..101295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0084"
FT                   /product="Oligosaccharyl transferase STT3 subunit"
FT                   /note="COGs: COG1287 membrane protein required for N-linked
FT                   glycosylation; InterPro IPR003674; KEGG: mem:Memar_2235
FT                   oligosaccharyl transferase, STT3 subunit; PFAM:
FT                   Oligosaccharyl transferase STT3 subunit; SPTR:
FT                   Oligosaccharyl transferase, STT3 subunit; PFAM:
FT                   Oligosaccharyl transferase STT3 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34865"
FT                   /db_xref="GOA:E1RDI1"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="InterPro:IPR026410"
FT                   /db_xref="InterPro:IPR041154"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDI1"
FT                   /protein_id="ADN34865.1"
FT                   /translation="MDFQSSLNKRNLIVLILIIVFAYFAFWMRMIPAEGLVSSAGVDLL
FT                   GNDPWYNLREIEVMVSNSLQYPWFDPMTYYPYGTDNFWGPLFPMIASVMCILAGASTRP
FT                   EIMYVSSFLPPLMAAAMVPVTYFVAERVYNWKAGLAAAFIVSFVGGQYFYRSLFAFVDH
FT                   HIAEVFFSTLFCLAYIAYLVYVNKHPVDFRDKESLKIPALIAVGSGIAYTLGLYVMPTM
FT                   ALFALLVAIFTGLMFIINSYRNVSSEYLVLANTVTFLVAIAGLLVLGLHHSGTSMIRYS
FT                   MGHVYAYLALIVGTLVLYGLRRALNEKPWHYYLGSVIAFGVVAIAFMIVAMPDFYGTFL
FT                   SGLAGFFGYSAQLTTIEEAQNWSLDKAWSSFNVGIILMILGLFASVFLYLKEKKETFIF
FT                   ILVWSLLIIYSTTIQVRYEYYLGVNIAILTGILTACTLSYGWSEIEKILSGLKSEQQAP
FT                   PQEESKKKGKGKNQPKALPKKKPVNSGKIIPFAAVVVFIAAFAYVMVPVDINTSEVMKN
FT                   YGGMTYDWKEALEWFGENSPETGIDYYAIYDRADYTNPPESYGVMSWWDYGHWITFISE
FT                   RPPNANPFQEGVAGSNGAAAYFIQQSEEESNAILDNLNTRYVITDAEMDSGDGKFWAMS
FT                   TWYDPEVQSAPYLEHFLNINSDNSYSVVTFYTPEYYNTMISRLHNFDGSMVDPSQVVYI
FT                   EYVDGAAYGSPYPILSAATMLGFNEAEAKAEEFNAANAGTGKAAEILSWNVLVPDGKVP
FT                   ALQHYRLIHESPTNILEANNQDLKYVKVFEYVPGAVINGEGTIKIDLETGTGRQFSYMQ
FT                   ESVDGRFIVPYSTTGANGDVMPLGDYTIVETGETFSVSEDAVMNGLTIN"
FT   gene            complement(101550..102740)
FT                   /locus_tag="Mpet_0085"
FT   CDS_pept        complement(101550..102740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0085"
FT                   /product="methanogenesis marker protein 1"
FT                   /note="COGs: COG1944 conserved hypothetical protein;
FT                   InterPro IPR017667:IPR003776; KEGG: mem:Memar_2237
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF181; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   methanogenesis marker protein 1; PFAM: YcaO-like family;
FT                   TIGRFAM: uncharacterized domain; putative methanogenesis
FT                   marker protein 1; bacteriocin biosynthesis docking
FT                   scaffold, SagD family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34866"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR017667"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDI2"
FT                   /protein_id="ADN34866.1"
FT                   /translation="MFTHIDPIRINRIKKEYFDGTHRVTAPEKTLEKIKPLMPEIGVVE
FT                   VEDITGLDRLGIPVYSASRPGAKPGATRMHAGKGTRPVHAEVSAMMEAIERYSAEYRGE
FT                   SMIHESFDGMGPATAVDPADLILPRPLESGEKLHWTPSWDMMNEEEIYVPSNAVFHPYD
FT                   PVGMAQQLFRSDTNGLASGNVIEEAILHAIFEVIERDALSDAENARSMGKKIIVDKEGP
FT                   AKELLDIFEDNGVKIHLWLIDAKTGVPTVAAGGDDTLTKDPSLLVMGSGTHLNPEIAVL
FT                   RALTEVAQSRGSSLKGGREDPKRRMLIEKAGYERLKRINRMWFTDEAESIKLSEIPDKS
FT                   TEYIDEDLKVTLEELEGHAERVCVCDLSKTPVPVVRVVIPGLEVSYMDKTRVRRRH"
FT   gene            102799..103083
FT                   /locus_tag="Mpet_0086"
FT   CDS_pept        102799..103083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0086"
FT                   /product="Protein of unknown function DUF2098"
FT                   /note="InterPro IPR019209; KEGG: mem:Memar_2238
FT                   hypothetical protein; PFAM: Protein of unknown function
FT                   DUF2098; SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterized protein conserved in archaea (DUF2098)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34867"
FT                   /db_xref="InterPro:IPR019209"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDI3"
FT                   /protein_id="ADN34867.1"
FT                   /translation="MENATIAPGSLVRYPRTGTSGKATGSKIIDGREFVLIDSTGMYYR
FT                   ADQLIIVDSVTEKRERGEEKGIERFKAEKKLTNEDIRDAFDDVTGVGAG"
FT   gene            complement(103089..103517)
FT                   /locus_tag="Mpet_0087"
FT   CDS_pept        complement(103089..103517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0087"
FT                   /product="transcriptional regulator NikR, CopG family"
FT                   /note="COGs: COG0864 transcriptional regulator protein
FT                   containing the CopG/Arc/MetJ DNA-binding domain and a
FT                   metal-binding domain; InterPro IPR002145:IPR014864; KEGG:
FT                   mem:Memar_2239 CopG family transcriptional regulator; PFAM:
FT                   NikR nickel binding; CopG domain protein DNA-binding domain
FT                   protein; SPTR: Transcriptional regulator, CopG family;
FT                   PFAM: Ribbon-helix-helix protein, copG family; NikR C
FT                   terminal nickel binding domain; TIGRFAM: nickel-responsive
FT                   transcriptional regulator NikR"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34868"
FT                   /db_xref="GOA:E1RDI4"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDI4"
FT                   /protein_id="ADN34868.1"
FT                   /translation="MKMTHESDLSRIGISLPKNLLDKFDTILEYRGYSSRSEGIRDAIR
FT                   SYITYYQWMSDVEGERQGVITMVYDHEQRGLLQVLTEIQHEHLDIIQSSLHAHVTHDKC
FT                   LEIILVRGDAGKIKKIAESLMAQKGVDSVKLTTIPIEE"
FT   gene            complement(103625..104020)
FT                   /locus_tag="Mpet_0088"
FT   CDS_pept        complement(103625..104020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aag:AaeL_AAEL009943 sidestep protein; SPTR:
FT                   Putative GAG-POL-orf2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34869"
FT                   /db_xref="GOA:E1RDI5"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDI5"
FT                   /protein_id="ADN34869.1"
FT                   /translation="MYLLVTATIPAIPSMHAVWTSLSENEVPDGWLCMNIFPDSLKRSA
FT                   CQINILFLSPEVFLSIIFPEASKTTECSTGRHDIDLAVSRKSSLTPILSGILIFLISTL
FT                   PVVSLAPHIKIIFTYINFNLIIRIKKA"
FT   gene            104374..105609
FT                   /locus_tag="Mpet_0089"
FT   CDS_pept        104374..105609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0089"
FT                   /product="protein synthesis factor GTP-binding protein"
FT                   /note="COGs: COG5257 Translation initiation factor 2 gamma
FT                   subunit (eIF-2gamma; GTPase); InterPro
FT                   IPR000795:IPR004161:IPR015256; KEGG: mem:Memar_2240
FT                   translation initiation factor IF-2 subunit gamma; PFAM:
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; Initiation factor eIF2 gamma domain
FT                   protein; SPTR: Translation initiation factor 2 subunit
FT                   gamma (AeIF-2g); PFAM: Elongation factor Tu domain 2;
FT                   Elongation factor Tu GTP binding domain; Initiation factor
FT                   eIF2 gamma, C terminal; TIGRFAM: translation elongation
FT                   factor TU"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34870"
FT                   /db_xref="GOA:E1RDI6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR022424"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDI6"
FT                   /protein_id="ADN34870.1"
FT                   /translation="MSDPLIPGVNIGLVGHVDHGKTTLVSGLTGQWTDRHSEEIKRGIS
FT                   IRLGYADATFYRCPKCKGADAFTTESICPECGSECEPFRTVSFVDAPGHETLMATMLSG
FT                   SALMDGAMLVIAANEKCPQPQTKEHLMALELVGIENIVIVQNKIDVVSQEQALAHYKEI
FT                   KKFVKGTIAENAPVVPVSAQKGINIGALIQALDEYIPVPERDPDDDPIMLIARSFDINK
FT                   PGCSWRDVKGGVIGGSLTQGVLKEGDDIEIRPGMKVEAENQVRWDPIMTKVTSINAGKN
FT                   RVTEATPGGLLGVGTKLDPALTKSDALAGQVAGLVGKMPPVWSRMAFKVSLMERVVGSD
FT                   DEFTIEPLKHKEPLMLSVGTAVTVGVVVNVKKDIVDVVLKRPVCVAVGSRIAISRQVGG
FT                   RWRLIGMGTLVE"
FT   gene            105573..105986
FT                   /locus_tag="Mpet_0090"
FT   CDS_pept        105573..105986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0090"
FT                   /product="nucleotide binding protein, PINc"
FT                   /note="COGs: COG1412 Uncharacterized protein of PilT
FT                   N-term./Vapc superfamily; KEGG: mem:Memar_2241 nucleotide
FT                   binding protein, PINc; SPTR: Nucleotide binding protein,
FT                   PINc; PFAM: Fcf1"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34871"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDI7"
FT                   /protein_id="ADN34871.1"
FT                   /translation="MAPDRNGDSGRVRVLLDANGLMVPVQFSVDIFTAIGGLVGSFEPV
FT                   TLEGVVRELEGLSKGRGRDAAAAKVGLSLAKRCLVEKSPLSGVPVDDMIVDFADRTGCM
FT                   VMTNDRRLRERLLDKNIDVISLRNQKTLEIIRG"
FT   gene            106017..106586
FT                   /locus_tag="Mpet_0091"
FT   CDS_pept        106017..106586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0091"
FT                   /product="DNA-directed RNA polymerase"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG1095 DNA-directed RNA polymerase subunit
FT                   E'; InterPro IPR004519:IPR003029:IPR005576; KEGG:
FT                   mem:Memar_2242 DNA-directed RNA polymerase subunit E';
FT                   PFAM: RNA polymerase Rpb7 domain protein; RNA binding S1
FT                   domain protein; PRIAM: DNA-directed RNA polymerase; SPTR:
FT                   DNA-directed RNA polymerase, subunit E'; TIGRFAM:
FT                   DNA-directed RNA polymerase; PFAM: S1 RNA binding domain;
FT                   RNA polymerase Rpb7-like, N-terminal domain; TIGRFAM:
FT                   DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic
FT                   form"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34872"
FT                   /db_xref="GOA:E1RDI8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004519"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDI8"
FT                   /protein_id="ADN34872.1"
FT                   /translation="MYYKMKLIDKVRVPPNRLGEDLSSVVLDELQQQLEGSIDKDIGIF
FT                   IAVTEIHDIGEGDIIPGDGAVYYHVEFDAVVLRLAMQEVIEGEVVETTSFGAFVSLGPI
FT                   DAMLHVSQISDDFINYDEKNGRLVCQETRRQISVGDIVRGRVVSLSLSERDPRESKIGL
FT                   TMRQAGLGTGQWLTEEMEAEKADGSS"
FT   gene            106573..106776
FT                   /locus_tag="Mpet_0092"
FT   CDS_pept        106573..106776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0092"
FT                   /product="DNA-directed RNA polymerase subunit E, RpoE2"
FT                   /note="COGs: COG2093 DNA-directed RNA polymerase subunit
FT                   E''; InterPro IPR007178; KEGG: mbn:Mboo_0244 DNA-directed
FT                   RNA polymerase subunit E, RpoE2; PFAM: DNA-directed RNA
FT                   polymerase subunit E, RpoE2; SPTR: DNA-directed RNA
FT                   polymerase subunit E, RpoE2; PFAM: Spt4/RpoE2 zinc finger"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34873"
FT                   /db_xref="GOA:E1RDY2"
FT                   /db_xref="InterPro:IPR007178"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="InterPro:IPR038589"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDY2"
FT                   /protein_id="ADN34873.1"
FT                   /translation="MAPRNKKNLRVCRVCHHVVEGESCMTCGSTNLSEDWAGYLYIVDP
FT                   KNSEIAKKMNIDMPGRYALKVR"
FT   gene            106787..107287
FT                   /locus_tag="Mpet_0093"
FT   CDS_pept        106787..107287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0093"
FT                   /product="Protein of unknown function DUF359"
FT                   /note="COGs: COG1909 conserved hypothetical protein;
FT                   InterPro IPR007164; KEGG: mem:Memar_2244 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF359; SPTR:
FT                   UPF0218 protein Memar_2244; PFAM: Protein of unknown
FT                   function (DUF359)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34874"
FT                   /db_xref="InterPro:IPR007164"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDY3"
FT                   /protein_id="ADN34874.1"
FT                   /translation="MNWYLPERHRDRFKEPFGRLFPDIRAALEYSGGAPVFAVGDVVTY
FT                   NLVRNDVVPEIAVIDGITMREPCSRTPRLRSSRFEVENPPGMITGELIDTLLLALESRP
FT                   ALVHVNGEEDLAVIPLVKIVPDGSAVFYGQPGEGVVVKIVDEEARRLADELFSLFEADN
FT                   SCE"
FT   gene            complement(107595..107768)
FT                   /locus_tag="Mpet_0094"
FT   CDS_pept        complement(107595..107768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0027 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34875"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDY4"
FT                   /protein_id="ADN34875.1"
FT                   /translation="MYAKLNDEKIKKIKDLESDLGVYLLAEQRFKDLSAADLKTLQDME
FT                   KKMGAVLVAYEA"
FT   gene            107985..108302
FT                   /locus_tag="Mpet_0095"
FT   CDS_pept        107985..108302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0095"
FT                   /product="Ribosomal protein S24e"
FT                   /note="COGs: COG2004 Ribosomal protein S24E; InterPro
FT                   IPR001976; KEGG: mem:Memar_2245 ribosomal protein S24e;
FT                   PFAM: Ribosomal protein S24e; SPTR: SSU ribosomal protein
FT                   S24E; PFAM: Ribosomal protein S24e"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34876"
FT                   /db_xref="GOA:E1RDY5"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDY5"
FT                   /protein_id="ADN34876.1"
FT                   /translation="MDFEFIKEEENKLLNRTELDFVLTYDGATPSRKEILGKLCALRNV
FT                   SPELCVLGSMKTEFGKQEIAGQARVYQDAEVLKSTELNHVIENSTFTAEAAEAAEEGAE
FT                   E"
FT   gene            108321..108476
FT                   /locus_tag="Mpet_0096"
FT   CDS_pept        108321..108476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0096"
FT                   /product="Ribosomal protein S27a"
FT                   /note="COGs: COG1998 Ribosomal protein S27AE; InterPro
FT                   IPR002906; KEGG: mem:Memar_2246 ribosomal protein S27a;
FT                   PFAM: Ribosomal protein S27a; SPTR: SSU ribosomal protein
FT                   S27AE; PFAM: Ribosomal protein S27a"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34877"
FT                   /db_xref="GOA:E1RDY6"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR022845"
FT                   /db_xref="InterPro:IPR038582"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDY6"
FT                   /protein_id="ADN34877.1"
FT                   /translation="MGVKRYTYYKVEDDKAVTEKKHCPRCGPGVFMAEHKDRVSCGKCG
FT                   YTEFNK"
FT   gene            108486..110072
FT                   /locus_tag="Mpet_0097"
FT   CDS_pept        108486..110072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0097"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /note="COGs: COG0533 Metal-dependent protease with possible
FT                   chaperone activity;
FT                   InterProIPR009220:IPR017861:IPR000719:IPR008266:IPR
FT                   017860:IPR000905:IPR018934; KEGG: mem:Memar_2247
FT                   O-sialoglycoprotein endopeptidase/protein kinase; PFAM:
FT                   peptidase M22 glycoprotease; RIO-like kinase; SPTR:
FT                   Putative O-sialoglycoprotein endopeptidase; TIGRFAM:
FT                   metalloendopeptidase, glycoprotease family; PFAM: RIO1
FT                   family; Glycoprotease family; TIGRFAM:
FT                   metalloendopeptidase, putative, glycoprotease family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34878"
FT                   /db_xref="GOA:E1RDY7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR009220"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022449"
FT                   /db_xref="InterPro:IPR022495"
FT                   /db_xref="InterPro:IPR034680"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDY7"
FT                   /protein_id="ADN34878.1"
FT                   /translation="MPENGQILGIEGTAWNLSAAIFGDDLVSLFSKPYSPPHGGIHPRE
FT                   AAQHHASVMKEVISAAIEGQDLSKISGIAFSQGPGLGPCLRTVGTAARSLALALDVPLI
FT                   GVNHCVAHVEIGRWQCGCDDPIVLYASGANTQVLGFLKSRYRIFGETLDIGIGNAIDKF
FT                   ARSRDLPHPGGPLVEKLALEGEPVELPYTVKGMDLAFSGLMSAAKDCNAPLEDICAGFQ
FT                   ETAFAMCVEVTERALAHAGKDEVLLVGGVGANSRLQEMLRCMCEERGAEFFVPERKFIG
FT                   DNGAMIALTGKIMLEAGQTVTIPESAVNPGYRSDDVVVKWRKDTGDLPYAKANLLENGQ
FT                   ARGAEAVVTESGRDVIKRRLSKKYRNSSLDSRLIAERTRAEARLISQARRYGVPTPLIR
FT                   DVTADSIVMERIDGPMLKLDLTRDHVHDAGRIVGRLHTAGIIHGDLTTSNFIVRDGRCV
FT                   LIDFGLSYISSEIESRGVDLHVFFQTLESTAPDHADLRKAFCEGYAETFEESKDVFERV
FT                   EEIRLRGRYLH"
FT   gene            110482..111540
FT                   /locus_tag="Mpet_0098"
FT   CDS_pept        110482..111540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1157 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDY8"
FT                   /protein_id="ADN34879.1"
FT                   /translation="MTATLPKIYVFSSVPDQGKTKLVLELYNHFSSKGYRVACLQANKG
FT                   QKDFKVYIKKDIYHYSVPLEAAKSRAELEKWIPAGFDIYLMEVTLGNSPVDIAYISLFD
FT                   NINEVISSEYLDSWEDYVIKYFEDNWIHESSNGECKSSDFWDYIHDRNVQKVIIGTMGE
FT                   PICPFMDSGGYIHNVSSLVYDEIDPKYTFPVSNKRLITVGAFPGEYWDIYPHMRWYSSK
FT                   YAKFMERFRNESYDIAVIGDSAQEKLKFQSKPKNHLVICYQPGVYANIERKEPDMKVNT
FT                   DFKTFIKNLNNILQGNEISDEDNVLSRYNNSYRTFKPVPERESVWREGNIVFCNGWIHP
FT                   QYLISKGFLEVE"
FT   gene            111541..113160
FT                   /locus_tag="Mpet_0099"
FT   CDS_pept        111541..113160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0099"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1643 cell surface protein; SPTR: Cell
FT                   surface glycoprotein with copper-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34880"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDY9"
FT                   /protein_id="ADN34880.1"
FT                   /translation="MCGPIVYPPVITSIEPSQDCTIDTDESFFDRLFEFAVDAASTLTV
FT                   IVNDAIAFVIEKAATFFSWLFDAAKTTVVEGINTIRLVAENSAGSTEKIIHAVITNTPV
FT                   TSAPQITAKIPDQQAVSDVHGGSSVRTFGVTIDQPATITFSIDNQEKSKYYAVADATWE
FT                   CDFSAYSAGTYNVEVTAINSNGDDTFSWSWEIIEQPVITFITPSSGNVSNYNTNGKRLF
FT                   SAGVNIPSILELYFNDRLIEKTSSEITVISHEFDLVPLGSHDVKIIAKKDDVQVERSWS
FT                   WSVNEYSSSDVIYCESRHYSGLRLLHGDLADVERNLNFNSNMDLRCQKSQLPDGSWIYL
FT                   FTCSNIGLVVDDDLEFPPIVINPSNSGENVYLGGFNTIELSLAETYANENFVLFSSMDK
FT                   FCIGIYPLKWGNFENYYKMQGDLEFILGLAGLIPDIIETFHIGDIISGLLLLAPSDKSP
FT                   EFESINYSFPYEATMELDGVSPTGGRSPYVENQFRWIAWVQKESSVKFNFLMKLIETNA
FT                   EGEYFETNKEIQLTAGNDPVVL"
FT   gene            113400..114062
FT                   /locus_tag="Mpet_0100"
FT   CDS_pept        113400..114062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0100"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kcr:Kcr_0849 polysaccharide biosynthesis
FT                   protein; SPTR: DNA internalization-related competence
FT                   protein ComEC/Rec2"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34881"
FT                   /db_xref="GOA:E1RDZ0"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDZ0"
FT                   /protein_id="ADN34881.1"
FT                   /translation="MKEITVDKPLSSEESENEVSIDYLHLIYLLYRHPSQAFRIVNSEK
FT                   TVHGIVFFVVFVFILTFFYSLYIYYFSGIFYYDLSPISIITVIFDGIRNGLVIVIKYLL
FT                   LFGIGAVFLLFLLWIIQSKIPVIQSLSVIFYSCAIAYPFTLLRYFIYIPSEYSLLSYGL
FT                   FYLYLLPLAFLEYIGLKDLLKTKHHLILIGVLITIVIQYLIFEPVYLFISGILNVIF"
FT   gene            complement(114102..114929)
FT                   /locus_tag="Mpet_0101"
FT   CDS_pept        complement(114102..114929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0101"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG0535 Fe-S oxidoreductase; InterPro
FT                   IPR007197; KEGG: dae:Dtox_0480 radical SAM domain protein;
FT                   PFAM: Radical SAM domain protein; SPTR: Tungsten containing
FT                   aldehyde ferredoxin oxidoreductase cofactor modifying
FT                   protein; PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34882"
FT                   /db_xref="GOA:E1RDZ1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDZ1"
FT                   /protein_id="ADN34882.1"
FT                   /translation="MNTQNKYVPPILQVEPSTDCNLDCPFCFRKKYSQKGENINFEVFK
FT                   KAVDQQGFRYLSLHGWGEPLMNPYLVDMIKYGAEKGFSVNFTTNATLVGEKAEGLLSSG
FT                   VGIIAFSIPDLSLFSPDISGNIKYFHELKKQKGFTFPKTYINIAMMECNFDTVEETLSI
FT                   SNDLGVDAVNFERSYPWKPEYTKEEEKIFRKVNDFTEKTGLKITLPVPHTLPCRLFNTT
FT                   LFMRYNGDMTPCCYRPDIVFGNINSETFDEIMHKRNIFREEMAEDPICSVCGI"
FT   gene            115146..115550
FT                   /locus_tag="Mpet_0102"
FT   CDS_pept        115146..115550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbn:Mboo_2358 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34883"
FT                   /db_xref="GOA:E1RDZ2"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDZ2"
FT                   /protein_id="ADN34883.1"
FT                   /translation="MTDYFSNIELIIALNPPKNISIFPQNKTEMNVYCSILTILTAVFA
FT                   GLLVIDVFTTTLVLNMGGTELNPLMAGIASQPWLHLLIKTVFAVFIVLLACQAEHIKQH
FT                   SGAVILIAACSMFLVVAVHNIRVVLFTFLG"
FT   gene            115604..115942
FT                   /locus_tag="Mpet_0103"
FT   CDS_pept        115604..115942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbn:Mboo_2358 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34884"
FT                   /db_xref="GOA:E1RDZ3"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDZ3"
FT                   /protein_id="ADN34884.1"
FT                   /translation="MNFHGFTFLGFLSVILAGLFLADVVTTALILEMGGSELNPLMIDI
FT                   VSHPWLHSIVKFIAALFVIAVACYTERLKKNAGAAILVIACSIFLLVVAHNVCVLIGFS
FT                   PSGVFPGF"
FT   sig_peptide     115604..115675
FT                   /locus_tag="Mpet_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(115939..116721)
FT                   /locus_tag="Mpet_0104"
FT   CDS_pept        complement(115939..116721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0104"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="COGs: COG1719 hydrocarbon binding protein (contains
FT                   V4R domain); InterPro IPR001845:IPR004096; KEGG:
FT                   mpd:MCP_0329 putative transcriptional regulator; PFAM:
FT                   4-vinyl reductase 4VR; regulatory protein ArsR; SMART:
FT                   regulatory protein ArsR; SPTR: Putative transcriptional
FT                   regulator; PFAM: Bacterial regulatory protein, arsR family;
FT                   V4R domain; TIGRFAM: bacteriochlorophyll 4-vinyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34885"
FT                   /db_xref="GOA:E1RDZ4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDZ4"
FT                   /protein_id="ADN34885.1"
FT                   /translation="MKATEQTEEKADALIFLKNGRTIVVNSPVRIEILRMVMTGEQRFD
FT                   DIVRRIGRAKSTVSVHLRDMTDDGILAERTDENDARRKFLYLDARYLGTIAAPVCQMPA
FT                   GWEEQPVLGDSVRPASVFRLIFNTIRTSLLQSGVNIEPVLFSAGIRAGNEVAKIVSDNS
FT                   NEEFLKKLSDFFRSNELGKITIEEGDQLVITVTDCYECQDLPKIGRPACSFDCGLLTAV
FT                   FTRQTGDEVDVTETHCYAAGDPFCRFVITKKEEVPREN"
FT   gene            116814..118028
FT                   /locus_tag="Mpet_0105"
FT   CDS_pept        116814..118028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0105"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="COGs: COG0426 flavoprotein; InterPro
FT                   IPR008254:IPR016440:IPR001226; KEGG: mbn:Mboo_1153
FT                   beta-lactamase domain-containing protein; PFAM:
FT                   flavodoxin/nitric oxide synthase; SPTR: Beta-lactamase
FT                   domain protein; PFAM: Metallo-beta-lactamase superfamily;
FT                   Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34886"
FT                   /db_xref="GOA:E1RDZ5"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDZ5"
FT                   /protein_id="ADN34886.1"
FT                   /translation="MKVTELAKGVYWVGAIDWNLRDYHGYTLPGTTYNAYLVIGEKVAL
FT                   IDTTYPGFEGQMLDHVASIIDPMKIDYVIANHVEMDHSGGLPKIAKMLPGVPIYCTQAG
FT                   VEGFNRHYDTEGWNFHVIKNGETLDLGGKTLVFLEAPMLHWPDSMFTYLAEDEILFPND
FT                   AFGQHIASSERFDDELGTDEAMEHAQKFFANLIIPLAPKVLKKLGEVTDLKVGIRMVAP
FT                   SHGVIWRENAMGIITAYANWSNGVSKDKVTIVYDTMHGSTTRMATAIAEGVIEGGCEAK
FT                   VCMLKDGRYKGTHRSDVVKEILDSKAVIVGTPTLQDEPLPTVAGFMSYLRGLRPGRLTQ
FT                   KKKGFTFGSHGGSGGAVRIVEDDMKKAGIEIFREPIEVYYRPDKDEIELCRRAGKEIAE
FT                   AVRNS"
FT   gene            118204..118938
FT                   /locus_tag="Mpet_0106"
FT   CDS_pept        118204..118938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A2663 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34887"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDZ6"
FT                   /protein_id="ADN34887.1"
FT                   /translation="MKNQYFGDYRDMFKYDLIQEAMKKNKGFKRFSFIPMLTDFKECND
FT                   GNKRYYNSEKIEKRPGSGNTDLVGYLRDYNDKVRDRKNRDLRHIRDYFGAYINIEIFEP
FT                   DEPMQGKYFVNKNRSLYFQAIPDIYLESALVFVDPDNGIEVKNSSKKHILYQEIRSLYE
FT                   RMSDDSVLMIYQHFPRQKHEEYIDRRKEELGQRSGSKLKPLWISDNEIIFFFLSKGQEA
FT                   NNIISGVLSDYSGKYPEKCRNG"
FT   gene            119014..120300
FT                   /locus_tag="Mpet_0107"
FT   CDS_pept        119014..120300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0107"
FT                   /product="amino acid permease-associated region"
FT                   /note="COGs: COG1113 Gamma-aminobutyrate permease and
FT                   related permease; InterPro IPR002293:IPR004841; KEGG:
FT                   mem:Memar_1826 amino acid permease-associated region; PFAM:
FT                   amino acid permease-associated region; SPTR: Amino acid
FT                   permease-associated region; PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34888"
FT                   /db_xref="GOA:E1RDZ7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDZ7"
FT                   /protein_id="ADN34888.1"
FT                   /translation="MKDKGPALERTLSLPTVAISGIGIILGAGVYALIGEAASLAGNAL
FT                   WLSFLFSALIAAFTGLSYMELSSMFTEASAEYEYTRRSFGGTLAFIIGIMVILSGIVGA
FT                   ATVALGFAGYFSTFTGIPLLPVAFAVLVILSAVIFSGIKQSAAVAIVFTLIEAGGIVGM
FT                   IIIGLPYIGSVDYLAIPLGIAGVFQASALIFFAYQGFEEIVKLSEETVEPERTIPKGLM
FT                   IAVVVTVILYIAVSISIVSIGGYEAVAGSKNPFAMVAENTFSGGGTVFTIIALFATANT
FT                   ALLMMLASSRILYGMAKRKRMPGKFAWISPRTKTPVWSVAAVLLVSLVFLLPGEIRDVA
FT                   LIANFTLFFTFVVINAAVIALRFKMPEKSRPYRVPFTIGKVPVPAVLGIFTCLFFLSVM
FT                   DPVILGVGVVLTVVAAAGSYLFPEKKESV"
FT   gene            complement(120323..122023)
FT                   /locus_tag="Mpet_0108"
FT   CDS_pept        complement(120323..122023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0108"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="InterPro IPR000788:IPR013344:IPR013509; KEGG:
FT                   mla:Mlab_0204 hypothetical protein; PFAM: ribonucleotide
FT                   reductase large subunit; Ribonucleotide reductase large
FT                   subunit domain protein; SPTR: Ribonucleoside-diphosphate
FT                   reductase; TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: Ribonucleotide
FT                   reductase, all-alpha domain; Ribonucleotide reductase,
FT                   barrel domain; TIGRFAM: ribonucleoside-diphosphate
FT                   reductase, adenosylcobalamin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34889"
FT                   /db_xref="GOA:E1RDZ8"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDZ8"
FT                   /protein_id="ADN34889.1"
FT                   /translation="MTGEAAERILMLRYYRDDEKSFDELCRRVAGAIADSPEEEAEYFD
FT                   MMNTLRFLPNSPTLMNAGTDMNQLAACFTLYVGDSITEIFDAMKWGAMIHKSGGGTGYN
FT                   FSNIRPEGAFVESSEGVASGPVSFMKAFDAVTGVIRQGGRRRGANMGILNVDHPDILKF
FT                   INSKTREGDIANFNISVMVTDRFMGLVEAGRFDRVWITREETAEEITVGDIWNGITEGI
FT                   WRNGEPGLLFYDEINRKNMTPALGNINATNPCGEQPLLPFESCVLGSINLSKFIDEKGE
FT                   TDLASLEKTIRTAVKFLDRIIDKNRYPIPEIEEATKRTRKVGLGLMGVHDALIMRRIPY
FT                   DSPEGRKYCGSIMQFVAETAVSESGRLAEEKGPFPAWKGSVWEKNGKMVRNAALTTIAP
FT                   TGSISIIAECSSGIEPVFSYSYTRMNTAGESFRMVHPLFKKELETVAGKLFPNPEERER
FT                   RVGEVLSHVHETGTVQDIGWLPDSFTKIFTTALDIRWRDHILMQAAFQEHVHASISKTI
FT                   NMPGTSTKNEISEALLFAWRCRLKGITIYRTSSRKDAVLCLGKFGDGHC"
FT   gene            122079..122603
FT                   /pseudo
FT                   /locus_tag="Mpet_0109"
FT   gene            122654..123103
FT                   /locus_tag="Mpet_0110"
FT   CDS_pept        122654..123103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0110"
FT                   /product="Putative protein-S-isoprenylcysteine
FT                   methyltransferase"
FT                   /note="COGs: COG2020 Putative protein-S-isoprenylcysteine
FT                   methyltransferase; KEGG: hau:Haur_3074 isoprenylcysteine
FT                   carboxyl methyltransferase; SPTR: Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function (DUF1295)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34890"
FT                   /db_xref="GOA:E1RDZ9"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:E1RDZ9"
FT                   /protein_id="ADN34890.1"
FT                   /translation="MKKHYIPPNYFYLALILTALPGCLFPQFNIITYPFNLPGFIVVAI
FT                   GVLVTYVSWKVFIDHGTSESYRKDATCLVSDGLYAYSRNPMYIGMILIVLGLWICMMMN
FT                   LLALAGPVFLFLVLNFRFIPYEESVMSGQFGEEFTAYMKKVRRWL"
FT   gene            123182..123730
FT                   /locus_tag="Mpet_0111"
FT   CDS_pept        123182..123730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0111"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /EC_number="3.6.1.15"
FT                   /note="COGs: COG0127 Xanthosine triphosphate
FT                   pyrophosphatase; InterPro IPR002637; KEGG: mem:Memar_2248
FT                   RdgB/HAM1 family non-canonical purine NTP pyrophosphatase;
FT                   PFAM: Ham1 family protein; SPTR: Non-canonical purine NTP
FT                   pyrophosphatase, rdgB/HAM1 family; TIGRFAM: non-canonical
FT                   purine NTP pyrophosphatase, rdgB/HAM1 family; PFAM: Ham1
FT                   family; TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34891"
FT                   /db_xref="GOA:E1RE00"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE00"
FT                   /protein_id="ADN34891.1"
FT                   /translation="MNLKVVTGNPNKVKEVAAYFGEFVVVEHVKLDLPEYRGDDVGEIA
FT                   RGKAKVAYEAVGEPLIVDDTGFYIRALNGFPGAYAAFVLDTIGMEGVLKLMESKPERSA
FT                   YFETAIAYADEKGIFIFKGRVEGEIMTSPRGKEGFGYDPVFSVGGKTLAEIPLTEKSAI
FT                   SHRGRALEEFKKWFVENRL"
FT   gene            complement(123739..124620)
FT                   /locus_tag="Mpet_0112"
FT   CDS_pept        complement(123739..124620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0112"
FT                   /product="protein of unknown function DUF125 transmembrane"
FT                   /note="COGs: COG1814 Uncharacterized membrane protein;
FT                   InterPro IPR008217; KEGG: hor:Hore_01890 uncharacterized
FT                   membrane protein; PFAM: protein of unknown function DUF125
FT                   transmembrane; SPTR: Uncharacterized membrane protein;
FT                   PFAM: Rubrerythrin; VIT family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34892"
FT                   /db_xref="GOA:E1RE01"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039376"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE01"
FT                   /protein_id="ADN34892.1"
FT                   /translation="MESGFSKDISGILDHFQKNEITEHLIYEKLAEKEKDPHNKEVLGR
FT                   IAGDELKHYNIIKKITGKEFSPDKRRILWFTTMARVFGLTFTIKLMEKGENRAQSGYSE
FT                   IKEKFPEISRILADEERHELELADMINEEKLGYMGSVVLGLNDALVELTGALAGFSFAL
FT                   QNTALIGAIGLITGIAAALSMAASEYLSEKADGGGEKDPFRAASYTGAAYILTVFLLIL
FT                   PYFIFGNYAVALAVTIITGIIIIFVFNFYISVAKDLDFKRRFMEMAAISLGVAGLSFVL
FT                   GAVVKIVFGVDI"
FT   gene            124847..124993
FT                   /locus_tag="Mpet_0113"
FT   CDS_pept        124847..124993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0113"
FT                   /product="Ribosomal protein L40e"
FT                   /note="InterPro IPR001975; KEGG: apo:Arcpr_0963 ribosomal
FT                   protein L40e; PFAM: Ribosomal protein L40e; SPTR: Ribosomal
FT                   protein L40e; PFAM: Ribosomal L40e family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34893"
FT                   /db_xref="GOA:E1RE02"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR023657"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE02"
FT                   /protein_id="ADN34893.1"
FT                   /translation="MARFAEAEARLLNVKICMKCNARNPIRATKCRKCGGSELRPKSKE
FT                   RKG"
FT   gene            complement(125076..125729)
FT                   /locus_tag="Mpet_0114"
FT   CDS_pept        complement(125076..125729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0114"
FT                   /product="Domain of unknown function DUF1917"
FT                   /note="InterPro IPR015034; KEGG: mem:Memar_2250
FT                   hypothetical protein; PFAM: Domain of unknown function
FT                   DUF1917; SPTR: Putative uncharacterized protein; PFAM:
FT                   Domain of unknown function (DUF1917)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34894"
FT                   /db_xref="InterPro:IPR015034"
FT                   /db_xref="InterPro:IPR023398"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE03"
FT                   /protein_id="ADN34894.1"
FT                   /translation="MEVEGDENPLSGAAYGIFEIILNRELTKKGKYLFERVEAGEDFRD
FT                   EFDVIFSDFEDEYPQLSQALADEPGGKDRIYDMLLEGEGVIPSKTTRMYWIVQDYPDFS
FT                   PEDFDDEKGGKWLIFMEKADIDEIWRKIRDATAAGRLGISARVSTAKENPDSRDERAVV
FT                   YVNTADWEDEEDVMRIREVLRELGVEQRIGYKRNIETYHGEYSEGGKKVTYYSA"
FT   gene            125843..127570
FT                   /locus_tag="Mpet_0115"
FT   CDS_pept        125843..127570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0115"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="COGs: COG3290 Signal transduction histidine kinase
FT                   regulating citrate/malate metabolism;
FT                   InterProIPR003594:IPR004358:IPR000014:IPR005467:IPR
FT                   000700:IPR013655; KEGG: mhu:Mhun_1414 signal transduction
FT                   histidine kinase regulating citrate/malate metabolism;
FT                   PFAM: ATP-binding region ATPase domain protein; PAS fold-3
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; SPTR: Signal transduction histidine kinase
FT                   regulating citrate/malate metabolism; TIGRFAM: PAS sensor
FT                   protein; PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34895"
FT                   /db_xref="GOA:E1RE04"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE04"
FT                   /protein_id="ADN34895.1"
FT                   /translation="MDQKSTGIVVLIAISIFILLVVQAVGVLTLASHNENLVIERTWDE
FT                   LKDYAVIISTQIDGDVLENLKPGDESSLDFIEIRDRLWALQKDSASIRYVYVLRKTADG
FT                   EYLEFVVNSEYGRNDFTFPLIGHVYEEAPAEAFEGYTGPSVKKEFYSDQWGEYMSGYAP
FT                   IYDSDGKVVGVAGVDISKDVILGRLKDSETTIYYILIVTVIIGIFLLIFLLYMVSQFRR
FT                   YQLETEKSERRLNLAMEIAQEGLIDWNTRTDVAYISKGFWRIVGTGDEMPETHYKTSVV
FT                   LDYIHPDDRLKLVNYFRNVLENGFKKDIAVRINRVSGEGGWVRVKADVVGHEDEKPVRL
FT                   IATAIDITDEVEYLGALEIAREKLSTLSSITRHDVLNQVTVLNLNLDLLKMTNTDPEID
FT                   EIIEELDSASDKIRDLVEFTKYYPALGDSKPSWISVDEMVENVAPEGYYNELPVEVMCR
FT                   NLKIHADPLFEKVLYNLFDNSYRYGEKATRIVVDCMKSEGGMKLIIDDDGVGIPVDKKE
FT                   LIFEKNYGTNTGYGLFLVEKIIEMAGFAINETGTEGIGARFEIFIPDGKFSFGDETRD"
FT   sig_peptide     125843..125914
FT                   /locus_tag="Mpet_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(127599..128363)
FT                   /locus_tag="Mpet_0116"
FT   CDS_pept        complement(127599..128363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0116"
FT                   /product="thiazole biosynthesis enzyme"
FT                   /note="COGs: COG1635 Flavoprotein involved in thiazole
FT                   biosynthesis; InterPro IPR000759:IPR002922; KEGG:
FT                   mem:Memar_2251 ribulose-1,5-biphosphate synthetase; PFAM:
FT                   thiamine biosynthesis Thi4 protein; SPTR: Putative thiazole
FT                   biosynthetic enzyme; TIGRFAM: thiazole biosynthesis enzyme;
FT                   PFAM: Thi4 family; TIGRFAM: thiazole biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34896"
FT                   /db_xref="GOA:E1RE05"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="InterPro:IPR022828"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE05"
FT                   /protein_id="ADN34896.1"
FT                   /translation="MKLDEVTISRAILSEQHKIMTEYLDIDCAVVGGGPSGITCAAILA
FT                   QNGVKVALIEKKLSIGGGMWGGGMMFPRIVVQEEARRLLDHFGIKYTEYEKGYYVASSV
FT                   EAVSKSLAAACDAGAEVFNLTTVEDVVVKEDGGVSGLVINWTAVEMAGLHIDPLTMRTK
FT                   VTVDATGHDSMIAHMVRKKGGALEIKGEGFMWAERAETNILSHTKEVFPGLIVAGMAAN
FT                   AVGGETRMGPIFGGMLLSGEKAANMIIERLKK"
FT   gene            128575..129462
FT                   /locus_tag="Mpet_0117"
FT   CDS_pept        128575..129462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0117"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="COGs: COG0501 Zn-dependent protease with chaperone
FT                   function; InterPro IPR001915; KEGG: mhu:Mhun_1307 heat
FT                   shock protein HtpX; PFAM: peptidase M48 Ste24p; SPTR:
FT                   HtpX-2 peptidase. Metallo peptidase. MEROPS family M48B;
FT                   PFAM: Peptidase family M48"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34897"
FT                   /db_xref="GOA:E1RE06"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE06"
FT                   /protein_id="ADN34897.1"
FT                   /translation="MIGKWKRDWGLSGRVFMTWIFILALYVVFINILYFLFPGYLYMII
FT                   AFVFLMAFVQYFFSAKLVLMTTHARIVSEDEEPELHRMIEKLCQEADLPKPKIAVMPSP
FT                   VPNAFATGRNPKNAVVAVTDSIMRTLNREELEAVIAHELSHVKNRDILTMTVAGFLASL
FT                   ASIIMQNALIMNLFDGRNNNGAWIVIWIVSIIVWIVATLLMLLLSRYREFAADRGSAMI
FT                   TGNPAALRSALMKISGRMDAIPAKKKQEIEGSNAFFIIPAISGKSLTELLSTHPPLEKR
FT                   LAALEKIERELKGY"
FT   gene            129547..130140
FT                   /locus_tag="Mpet_0118"
FT   CDS_pept        129547..130140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0118"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="COGs: COG1853 Conserved protein/domain typically
FT                   associated with flavoprotein oxygenase DIM6/NTAB family;
FT                   InterPro IPR002563; KEGG: mac:MA3322 hypothetical protein;
FT                   PFAM: flavin reductase domain protein FMN-binding; SPTR:
FT                   Putative uncharacterized protein; PFAM: Flavin reductase
FT                   like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34898"
FT                   /db_xref="GOA:E1RE07"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE07"
FT                   /protein_id="ADN34898.1"
FT                   /translation="MMLKPFERENVLAMPVVLISTVSGSGVANVAPWGNVTPILRPLDE
FT                   IVIASALKRDTLDNIRETGEFVINVPPASMIDEVMICSRLYPPDVDEFAEAGLSKKTSS
FT                   TVSAPGIAGCVAWIECKLKEEIVRDKYSLVIGKVTGLELNEDFVTEDGDLDYENAEPLC
FT                   MLCGGSVIHYTKPVRAGRTAQYSEMFSWPGKKQD"
FT   sig_peptide     129547..129630
FT                   /locus_tag="Mpet_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            130233..130303
FT                   /locus_tag="Mpet_R0001"
FT   tRNA            130233..130303
FT                   /locus_tag="Mpet_R0001"
FT                   /product="tRNA-Gly"
FT   gene            130372..131580
FT                   /locus_tag="Mpet_0119"
FT   CDS_pept        130372..131580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0119"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="COGs: COG0475 Kef-type K+ transport systems membrane
FT                   components; InterPro IPR006153; KEGG: mhu:Mhun_0841
FT                   sodium/hydrogen exchanger; PFAM: sodium/hydrogen exchanger;
FT                   SPTR: Sodium/hydrogen exchanger; PFAM: Sodium/hydrogen
FT                   exchanger family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34899"
FT                   /db_xref="GOA:E1RE08"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE08"
FT                   /protein_id="ADN34899.1"
FT                   /translation="MSTGVVPGIELQMTLLLFFALAGYLLASKINQSAVVGEILLGLVV
FT                   GPSVLGLITYTEFVQAIAALGAVILMFVIGFEFKIEDLTNVKYGIIGLIGIIVPWIGGY
FT                   FVSLAFGFSPESALFIGTALTATSIAITANVLKEMCLLDAEFSKAIIGTAVIDDILSLL
FT                   ALSITADVASGTFSFGGLAFIIAKQIGFLVLIALIGVFFISKMIVRMDESPISKKYPEF
FT                   VFIFAVMIAFLFAALAEFIGISAIIGAFIAGVSFNGINLKHSHDISEGADYLYIIFASV
FT                   FFVSLGILVDLSALTGPVLIFIAVITVIAIISKVVGCGIPARLLGYSNRDSLAIGFGMS
FT                   PRGEVAMIVALMGLNLSLIGQDIYASIVVMSILTTVITPIAFRNWLFKKEVKACIAGEQ
FT                   GMQ"
FT   gene            131577..132530
FT                   /locus_tag="Mpet_0120"
FT   CDS_pept        131577..132530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0120"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="COGs: COG3173 aminoglycoside phosphotransferase;
FT                   InterPro IPR002575; KEGG: mhu:Mhun_1322 aminoglycoside
FT                   phosphotransferase; PFAM: aminoglycoside
FT                   phosphotransferase; SPTR: Aminoglycoside
FT                   phosphotransferase; PFAM: Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34900"
FT                   /db_xref="GOA:E1RE09"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE09"
FT                   /protein_id="ADN34900.1"
FT                   /translation="MKDLGMIEDEIRAAVDYSRAERIEKGFSFEKKYLLSGPGERSCIV
FT                   RICEVNSEEVLARKREEFDLIRRLHGYSSLVPEAYLFGVSGDGESCYMVLEYVQGSDLE
FT                   EAMPHFSGEEQYELGLQAGRELLNLHRLDAPLLPAEWHERYSRKYGRKWERFSESGIDA
FT                   GVIDIEQLSRFISENEQYMRCPRETFLHDDFHPANLITDGGNLAGIIDFNRYDWGDPVH
FT                   DFVKVAYFSSKISVPFSAGQIDGYNDGKIPDEFWKKYSLYAAMMMIQDMVWSHWYSEQT
FT                   GSSGEIERMQERTERVWSDHDCFRDEVPGWYRDFKE"
FT   gene            complement(132554..134290)
FT                   /locus_tag="Mpet_0121"
FT   CDS_pept        complement(132554..134290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0121"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG2205 Osmosensitive K+ channel histidine
FT                   kinase; InterProIPR003594:IPR000014:IPR005467:IPR000700:IPR
FT                   013656; KEGG: mba:Mbar_A1687 signal-transducing histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein; PAS
FT                   fold-4 domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; SPTR: Sensor protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34901"
FT                   /db_xref="GOA:E1RE10"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE10"
FT                   /protein_id="ADN34901.1"
FT                   /translation="MFQYHPYLIPVIFAAALSGFIALYSFRRRRMRGARAFSLLMLLVF
FT                   IWEFFYMFEMSSTNFESMKLFLRLQYFAIPFIPVVLLYFILEYGGYYRFLNFKYIGLLL
FT                   VVPLVSLILLLTDDFHHLFFNIEYMVAADYIIVRGFEAGPVYNLLWIYSGILFFLSAVI
FT                   SFHIHLSSQGIQRVQSGVLVGALSASLFVELLYQVGVSPYPYLDLTAIVFPISGLCIMI
FT                   GLFKYNFFDIVPLPKQTIFSSLSEGIIVLDSKKRIIDINSIAQDMLGGGVEVDGSLLFE
FT                   KDTFLNKYEDRMNSPACIAFLARVERDGGEKFYAVSVTPISLNDGDNVYRILVLRDITH
FT                   EKKYERELEKSRSSLKIANEKISLLNSVTRHDILNNITVLSAYADLIGDQIPEEGKSRD
FT                   YLDKMIKAIEQITQQIRFTADYQNMGVDDPIWQNMRRVVREAWESLGSVTSRIEFEVDL
FT                   PENLEIYADFLLSKVFYNLFENSIRHGERVTKISVSFDTKPDGSGVVIVEDNGVGIPED
FT                   TKPRIFSKGFGKNTGLGLFLASEILSITKIGIFETGTEGKGARFEMVVHPNGWRVKEKK
FT                   EG"
FT   gene            complement(134343..135776)
FT                   /locus_tag="Mpet_0122"
FT   CDS_pept        complement(134343..135776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0122"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR001411:IPR011701; KEGG: mba:Mbar_A3306 efflux PumP
FT                   antibiotic resistance protein; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Efflux PumP antibiotic resistance
FT                   protein; PFAM: Major Facilitator Superfamily; TIGRFAM: drug
FT                   resistance transporter, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34902"
FT                   /db_xref="GOA:E1RE11"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE11"
FT                   /protein_id="ADN34902.1"
FT                   /translation="MTFSDLIPAGVNNTVMEEMTDKRQLWIILFITSLGSFLTPFMGSS
FT                   INVAIPEIGMEFFSDAILLSWVAISYLLAASILIVPMGRLADMKGKTRIFLTGIAIYTA
FT                   GSLLSTMTSSIDMLILFRVIQGCGGAMIFGTSIAIISGTFPPAERGGALGINVAFTYTG
FT                   LSVGPVVGGALTEAFGWRSIFYLNAAVGILIIILGIKYLRIKETKDDQTAFDLPGSVLY
FT                   GAVILFVMLGFQELPDTTGYVLFALGTIFAAAFFFREKSTPHPVIRISLFTENRVFALA
FT                   NFAAFINYSSTFAISYLLSYYLQLIRGFGPEEAGLFLIAQPVMQAIFSPATGKLSDRIN
FT                   PSVLATGGMALITAGLMLFTVLSPETSITIIIVDLALLGFGYALFASPNTHAVMNSVPL
FT                   KLYGVASGVLGTTRMCGMMTSMGISMLAFSLTIGNTPISVVDTESLLLSINSAFTIFVI
FT                   LCAVGTFASYMVIRNKGKE"
FT   gene            135822..136859
FT                   /locus_tag="Mpet_0123"
FT   CDS_pept        135822..136859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0123"
FT                   /product="putative cache sensor protein"
FT                   /note="COGs: COG4564 Signal transduction histidine kinase;
FT                   InterPro IPR013163; KEGG: mem:Memar_2286 cache type 2
FT                   domain-containing protein; PFAM: Cache type 2 domain
FT                   protein; SPTR: Cache, type 2 domain protein; PFAM: Cache
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34903"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE12"
FT                   /protein_id="ADN34903.1"
FT                   /translation="MEKRAIFFGFLIVMLVAAFSAGCTSDGEANGTAHGNTAPPETTGD
FT                   KGVMPGEPAGLSGNITVGELMSFVSGAAGYAKSAGMVNALNEFGDPDGEFSSGDVYIYA
FT                   YGFNGTLLAHPYQPDLVGTDRSDWTDARGFPFYKASAYTAENGGGFVAYLYPKPDDGII
FT                   NESAKGDYAPKIGCVMPVDDEWWIGSGLYLSDPVDSDTGAAPAATAEMISLVESGVEYA
FT                   LENGNEAAFEAISDKKGLFVDESGHYLYAYDYNGTLLAHPYLTDKIGQDLIDHEGAFGE
FT                   KDIQMLVGAAQEGGGYVVFSWPNPDNGDKPEIKIGYVLPVDDEWWLGSGVYLSEITGDD
FT                   ESIPE"
FT   sig_peptide     135822..135896
FT                   /locus_tag="Mpet_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            136936..137009
FT                   /locus_tag="Mpet_R0002"
FT   tRNA            136936..137009
FT                   /locus_tag="Mpet_R0002"
FT                   /product="tRNA-Val"
FT   gene            complement(137032..137775)
FT                   /pseudo
FT                   /locus_tag="Mpet_0124"
FT   gene            138071..139480
FT                   /locus_tag="Mpet_0125"
FT   CDS_pept        138071..139480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0125"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR001411:IPR004638:IPR011701; KEGG: ele:Elen_2489 drug
FT                   resistance transporter, EmrB/QacA subfamily; PFAM: major
FT                   facilitator superfamily MFS_1; SPTR: Drug resistance
FT                   transporter, EmrB/QacA subfamily; TIGRFAM: drug resistance
FT                   transporter, EmrB/QacA subfamily; manually curated; PFAM:
FT                   Major Facilitator Superfamily; TIGRFAM: drug resistance
FT                   transporter, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34904"
FT                   /db_xref="GOA:E1RE13"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE13"
FT                   /protein_id="ADN34904.1"
FT                   /translation="MSLFNDAQLTNKQIVMTVVLVAGAFISVLNQTIVSPALPGIMSEL
FT                   GVDVSMAQWLITIFTLVMAIMIPVTAFLLDRFSLRSLFISAMALFAAGSLLLAWGPTFS
FT                   VLILGRVLQAISSGMLSPMIMSILMWIFPLGFRGRAMGLYSLVIAFAPAIGPTYSGVIV
FT                   DLFSWHFVFLSIAPLAVIAAFVAFFTIEDFVERRNVVLDKLSLILSTFGLISLLYGCSI
FT                   IGSAGGLSPESIATIAAGLLILTWFGIRQLNLKEPMLELRVLKNRNFLSAVFIIMLFQA
FT                   AILVLSVILPIYIQTIRGYSATITGLVFLPGAAFMAITSMFSGRLFDRHGPRRPVLLGA
FT                   TALMISFLGLVIIDTGSPIWLIFVIYIVLSTGIGLLNTPVSTWALNSLDDKEIHHGSAV
FT                   LNTLRQTAGAIGTAILVTVMSIEISAYPDPDSIAANMAGFNATSVCMAVLMIVVFVAAF
FT                   FLIRDKEKTGV"
FT   gene            complement(139634..140329)
FT                   /locus_tag="Mpet_0126"
FT   CDS_pept        complement(139634..140329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0126"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mru:mru_1363 hypothetical protein; SPTR:
FT                   Leucine-rich repeat, typical subtype"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34905"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE14"
FT                   /protein_id="ADN34905.1"
FT                   /translation="MKIFQTLKDIFAPKTEEKEKTSAAGETPGKAAEGARAEKLPAQEG
FT                   QKSAKAMNYAELINGLISNAGYRNYKPVGTEEAACPSCGKEIDSFPVRKMQCPSCGADI
FT                   FVRTRASDKRKVLLTGDQLEEFERQRTLDSGMYDTKMKNLAERMEKYSDHGGWVFLSVL
FT                   DEKDTPEYAEYHGMVIKSRSGEEKKALGLLIRPDSRARTKTWFNNPEQDTSPDEYEAQR
FT                   KEWFDSRKK"
FT   gene            140488..141957
FT                   /locus_tag="Mpet_0127"
FT   CDS_pept        140488..141957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0127"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="COGs: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain; InterPro
FT                   IPR001638; KEGG: pmy:Pmen_4251 amino acid ABC transporter
FT                   periplasmic protein; PFAM: extracellular solute-binding
FT                   protein family 3; SMART: extracellular solute-binding
FT                   protein family 3; SPTR: ABC-type amino acid
FT                   transport/signal transduction systems periplasmic
FT                   component/domain-like protein; PFAM: Bacterial
FT                   extracellular solute-binding proteins, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34906"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE15"
FT                   /protein_id="ADN34906.1"
FT                   /translation="MIEKLLYCAVFVLFMLSVAACGCLGESPPGAAAPAEDSGLRIITE
FT                   DFPPYNYINEDGNISGQSTDVVNGILERLNMKADIELMPWGDGYNIVLNEPGTALYSTG
FT                   RTTEREPLFKWVGPIASYETVLYAKADSGIEIDSLEAAKKAESIAVVRDDSRQQFLTEN
FT                   GFENLILCEDDTECIRKLMDGEAVLWFGSSANAEEIAFKAGYDPAALSAVYPVRTVGLY
FT                   IAFNPVVPDETVLKWQDALDSMKADGTYDTILAEYDLTEPGSAVEYGPETALFALMSYC
FT                   DGRIASVQRGLETAAVTFEAASGDWQEIKPVLTEIEDNEPDARMWYSYTNGTYYTVVDG
FT                   LASANLMNRSYFPLVLSGQESVGTVVVSYSTGKSTAIVAVPVKDGDDVTGVLGASVYLE
FT                   GITEALKDELPGTVFYAVDKEGKFALNSDTGLISQEVMVNDGNTSFGRAVEYMLFTGEG
FT                   SVEYESQGKNWNAEFRKSPLTGWIYAVAESA"
FT   sig_peptide     140488..140583
FT                   /locus_tag="Mpet_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(142012..142770)
FT                   /locus_tag="Mpet_0128"
FT   CDS_pept        complement(142012..142770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mem:Memar_0525 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34907"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE16"
FT                   /protein_id="ADN34907.1"
FT                   /translation="MKKVLVILLIIALLFAFPVSAAKNNDDTGSGGDTGVQASAAYNKT
FT                   TATWNGNSSGTTPSSGNQRGLATAQENMNQSAGQGTGISENLTTLRNQKEIKAQIRLIE
FT                   KESANFSGSETNNMLKNRNTVHAAVQALIAAGNLSGVTGEQISAIAQEFNNSLALQYSA
FT                   EERIQDRNAVSRFFFGGDSDAAGEIRDQIEANQERIENLNTLMNDCDCDDELRTMIQAQ
FT                   IQVLEEEQNRLQELSQAELDDKGLLGGLFG"
FT   sig_peptide     complement(142708..142770)
FT                   /locus_tag="Mpet_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(142848..143681)
FT                   /locus_tag="Mpet_0129"
FT   CDS_pept        complement(142848..143681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0129"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="InterPro IPR017896:IPR017900:IPR001450; KEGG:
FT                   mem:Memar_1074 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain-containing protein; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34908"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE17"
FT                   /protein_id="ADN34908.1"
FT                   /translation="MRTKIYYFTGTGNSLAVVRRIGESLGDCEFIPIASIKETEGNIEP
FT                   GVEHVGIVCPVYDMGVPLIVKEFAGRIDLNGAEYCFAVVTMGGMGASALHVLDKTLREN
FT                   CGKGLDSGFAIRMPANFPPLFKPPQGEKKDKILREADAKLDEIVGKIREGKREYPALTP
FT                   LSSLFKILTYGKFIKGVRSCDSEFFVKDNCISCHACSDVCPTGNIEFAGGWPKWSHNCE
FT                   MCFACLHFCPVEAIQWGKRTEGRGRYRHPDIRILDMKAQKGENGRLNNELIHDTK"
FT   gene            143774..144554
FT                   /pseudo
FT                   /locus_tag="Mpet_0130"
FT   gene            complement(144558..145532)
FT                   /locus_tag="Mpet_0131"
FT   CDS_pept        complement(144558..145532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A1447 hypothetical protein; SPTR:
FT                   Ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34909"
FT                   /db_xref="GOA:E1RE18"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE18"
FT                   /protein_id="ADN34909.1"
FT                   /translation="MNGGKMKTEEKILLGAAVVLFAFLILCPLTAVFIVFTATSSDSPE
FT                   EIHFSDIYGENNLQWPFWPLERNNFADLSEEQAEYVTDYMFENIRNTTGTAGRMNFGAC
FT                   KAFFLDCGDYVHEIVFYYENTTEYDLTPELMAENSTVLPGGGDLTAGYRMYRVYPEFPA
FT                   YRNAEIPYIDFTDAWTDSSVSCIAGEIASVRTEGRFYRNYDGKVAAVIDMTDIGKKSGW
FT                   VVSGKEMMESKQDSDYSGTVSFEGEYVIPSVPVMPVIYIDSHVTCGPYGEVGMFSFSNV
FT                   SLPFSFGIIGLLVYLLLLILSGGYVIKYLTGNKKKEDEEEGKS"
FT   sig_peptide     complement(145413..145532)
FT                   /locus_tag="Mpet_0131"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(145584..147116)
FT                   /locus_tag="Mpet_0132"
FT   CDS_pept        complement(145584..147116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0132"
FT                   /product="PEGA domain protein"
FT                   /note="InterPro IPR013229; KEGG: dth:DICTH_1706
FT                   hypothetical protein; PFAM: PEGA domain protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: PEGA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34910"
FT                   /db_xref="GOA:E1RE19"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE19"
FT                   /protein_id="ADN34910.1"
FT                   /translation="MFIFFAAIILAAVLMVSCVSAEDTTKGSLDVSSNPSGADVYLNDE
FT                   FIGNTPLTVNALYPGIYYVRLEMTGYESWEKIFDIKEGETTYISYNLDASVGEAYSINT
FT                   EPDGAEIYFDGEFKGYSDKVLNNLPTGQHEITLVLDGYQDYRRIVYIQEGMSQSLTHVF
FT                   EPMPTTGTVVVESVPSNADVYMNGEYMGRSMLTLEEVEPGTYNITVKKTGYEDWEGVVV
FT                   VEAGKISDVSAELTAAKAPVTINTVPEGASVLFDGEDLGTTPLEFQAEQGKHELVITKF
FT                   GYADLTTSINVSYEGDDYVFELVPMIAEAIAEAEAVIAENSEYGPDAAQAAIEKAKEAY
FT                   NDGDDEGALSWAQIAFRLAGDVDEDGIDNQNDMAPGVNNIIIYISPVFILIALIALIGY
FT                   DFRRHIINPVLEIEVPPSIDPDDEDTKAKISIDTGGPAKGHVCTIMIDGERVEYISETG
FT                   KFDISLAGRMPGLHKIEAKLEVARERYGTKVVTASKVFEVGSDIIIAEEMME"
FT   sig_peptide     complement(147054..147116)
FT                   /locus_tag="Mpet_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(147187..148686)
FT                   /locus_tag="Mpet_0133"
FT   CDS_pept        complement(147187..148686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0133"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA2713 hypothetical protein; SPTR:
FT                   Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34911"
FT                   /db_xref="GOA:E1RE20"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE20"
FT                   /protein_id="ADN34911.1"
FT                   /translation="MEENYGIFTTDGQRLAGNLQDESITGLAERLDESTASLFIKTSGT
FT                   FVWLGTAVNVQKKGRRPDTFIYIEKTSWYGSLPPRIDLSYIHEFFERVADRLSSIDYGI
FT                   RDLASDTAFIGERRGRFVSGLSGTGVVEYALGKTLLCKEVVCVSDDLSKSVDFVVATAE
FT                   KLSPFLYAGFTIVVSKRSFRGADILVTEKTAAKADIRLDTETIEDTKWTDIYRTAGVLP
FT                   QKPGMAHWAAERRSRRQIAERLLSDLKKNARAAGRSSYLESFIDSEEIEKFPCEKDGVT
FT                   GALSVQGEPSTGKRNGWTPSEDDYGKWEVSEYDRMKLMDDYEQLMETRRKKRIKIITAV
FT                   FVIFILAAAAVFVIVKPAGLTGFLPGFPVQTSPTSTSTPYITPSETIAQPEGNITIERL
FT                   IASPGNIPEGLMGVSGTYNITTDSPQTVLIELTGSYDPLLSYYLMEFNTSGYSWDYVTG
FT                   TSEYSEAGAMVVIHESGIYRIFTARTGPEENITDTNTTGGA"
FT   gene            complement(148711..150276)
FT                   /locus_tag="Mpet_0134"
FT   CDS_pept        complement(148711..150276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0134"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR018170; KEGG: mba:Mbar_A2476
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34912"
FT                   /db_xref="GOA:E1RE21"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE21"
FT                   /protein_id="ADN34912.1"
FT                   /translation="MIINNKRRKIYLLAGLPLAVIVAYIFVRIAPYFKNHPTPAGLTVF
FT                   MEFLCGLFFAIAIGMIFNEDSRINGIIYCGIFAAIPVFYVNVSPWANITLLLLAFGSGA
FT                   GVGAVAVIRSVLSNRYDSLAKIAKLLFTIFFAIIIGFLAYELYASSFSADASVSEDLIL
FT                   QNVFVFGTGIVISLVLYWLAIRITIGVRASEIFIFGPRSSGKTYFVLGLWGYISEHFEK
FT                   GHSNEGVVLTGDPNDDGEDLRISNLYANVLDGQILSRTYRYQMVMYQLTGKKFGIIPVK
FT                   WTVVDYAGEYYDELNEVNYTRAINQIAPALGMHPNDIRRRAGTIDFVKYIKLNFRDMLV
FT                   DPEFTKSVILITMYGNFLRAGKVIFLIDGEKITGSRKGQAQLAREFGGYMKTLIDLENR
FT                   QNMRFFNPNKKYALAVTKTDLLFWKNKEIRNQILSMGAEKLSGIDDHSRNASEIEKKIF
FT                   SILSANTVFRNLVNMMNDISMYFVAVSVDATAEPFPTEEGFEDEIAPKGLAPWRFTEII
FT                   KFGL"
FT   sig_peptide     complement(150196..150276)
FT                   /locus_tag="Mpet_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(150273..153536)
FT                   /locus_tag="Mpet_0135"
FT   CDS_pept        complement(150273..153536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR017975; KEGG: mba:Mbar_A2475
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: Tubulin/FtsZ family, GTPase domain; TIGRFAM:
FT                   glutamate--cysteine ligase/gamma-glutamylcysteine
FT                   synthetase, Streptococcus agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34913"
FT                   /db_xref="InterPro:IPR025904"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE22"
FT                   /protein_id="ADN34913.1"
FT                   /translation="MRVPNDGIIEGRPFQMPDELTVVAVGGCGKKLISQIYEHDWFLKH
FT                   YLSDAKRLTLYTFDTDTNQRKEDLRRVTGVEKKLSEIQKTENLTGGSVKAFHYHIPDLA
FT                   NVDRVSSLTSKDIIEQVKNRREPPLVDVWWMNDPDYGFDYQELKKVDPNIVDDFGGGVH
FT                   RRRAISKAVFYKAITQGGEQFPSFQGHGPVAIIVGLGGGTGSGMFIDLARYIKEKRGQE
FT                   AKIWLFCVLPAAGEGEKEQLNAAIALSEIEYLNMKDDKLFNYIVLSSLSPTGYVDGGDR
FT                   KREVVEFDSAFPYMFINAFYLPTADISAIVDAKRDYSGFIFADSHVIEYPVENLRTLKK
FT                   GFEDVIASYSEISNERTRLLKEISTFFATNENLYPAEFSKTDTEITHSDVTKFKKEIEK
FT                   IRNVWENEITSLLNFQTQNIIESAISNNMPVELKELDRINEFDKLAEYVTRLKKSLENE
FT                   SKPHENAKDQELYELVKKNLNLLGQMAELQNKALAVRDNSARLALANLIRGEENFGKIS
FT                   GDISSETGKLRADVSEADTKVSKKRAELDEIVKLRDRDVGLVKSEINALAKPVDDYIAL
FT                   GHGGDESGRSLEDLEREYIDKFAWLMSLLIERINETSGKKKLKPIRRDAWMGSLPLGEM
FT                   QTDIDRLEKITGTDLAYLNDLAESVSLYYFNDYMMRVAKKQGFGDSLLGKKLNFEMFRS
FT                   EKATKEERINKIARMHPGRIFIREPFEIYVQDRFITGEFDSKMVSLREAVIEPLVSQFN
FT                   LESEEKKALISSFSGGDSGRILSGLRERLTGIINSREGYESRIDSINGEIDGLIQSKKE
FT                   MQQEIEFFTRLDELISSSFEARKKLKAALDSYDSGLRDIEERRRGGSKTIEGMYRTWFG
FT                   EINPAILSLLNDDSDLSSLDYDNDGKKEIEKLYNIVRWKYKDLIDAHKLGVNNLSVGHG
FT                   PGGTERWSFEKSALVASSPSRWLSQMTDNNAGDFRRYLVKALDLKGVDSAKVNSHNYTK
FT                   PWEVSLTFFAAASFLDNISPLTTGGGYWEKYERSKNNILHHALYLQQGKYVTRKRTLLL
FT                   ADAAEIAGLEDGNKKSRDEAKERVLDLYEVKDIKEAAGE"
FT   gene            complement(153533..154324)
FT                   /locus_tag="Mpet_0136"
FT   CDS_pept        complement(153533..154324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A2474 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34914"
FT                   /db_xref="GOA:E1RE23"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE23"
FT                   /protein_id="ADN34914.1"
FT                   /translation="MLQRKSALLCMTLAALGLLFLAVCTPCAAMNIEVSDGTLPDSQDE
FT                   AATITYTIVITGLPKQAEYLEISTDLIPVSDSTLWTVPDTTYVEIEGGEDSLNDQKITL
FT                   KILEYPDQGITVTCSGRAPSLTSVETVDGVVITKRVEQSTGYIYYHVRALDENGDLLGT
FT                   AATETFSITIPGEDVFKERLNAVSDTDMRAIIDDLYSKGLTDEAGDLLDYWEAPKESTV
FT                   SLTMTAIVAIVLMIIGLVVGVIFGQVRARNMQDFEDDYRGR"
FT   sig_peptide     complement(154238..154324)
FT                   /locus_tag="Mpet_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(154380..155810)
FT                   /locus_tag="Mpet_0137"
FT   CDS_pept        complement(154380..155810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0137"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR001958:IPR011701; KEGG: mhu:Mhun_0464 major facilitator
FT                   transporter; PFAM: major facilitator superfamily MFS_1;
FT                   SPTR: Major facilitator superfamily MFS_1; PFAM: Major
FT                   Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34915"
FT                   /db_xref="GOA:E1RE24"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE24"
FT                   /protein_id="ADN34915.1"
FT                   /translation="MKHGIFHAERTSGPRDKFSHGTTIILLSACILLPMISESMLVAAL
FT                   PGIELEFSTQGIIGAWILPVVLLLGASLCPFLGTLGDNLGRKKVLSIGLAFYVAGVLLS
FT                   GFSWNIWSLLLFRAMQGIGIAASPIAFAIVSEHFPPERVSTGIGILAGCYGAGTLLGIF
FT                   FGSIVTGILGWRWTYYILIPVVILHLVLVNLKIPSSPGTPGRKSDWAGAFLLLAAIFFL
FT                   MTAVTLCYGGEFEPVPVAVSVALSVIAGVLFVYCEKKSAFPSIDLRMLKKRKVAIIAAM
FT                   ALLLNMTTFLYVQVFPFIIQSPAGLMLGELFVGCIMVPGSIADMIMSTSAGVWVRRKGH
FT                   KPVFYLGGILIIIAPLVYFLLPLSVITLAAVYTIFCAGMGMISTAYLILMIGTVPPDRT
FT                   AGATGLLNSYTNIGGMIGPIITGIFLATFSIKTVTNGVSWQTPTAEAFFYTFATGTAAA
FT                   LVIMMLIIAINNGRKVQL"
FT   gene            complement(155880..156272)
FT                   /locus_tag="Mpet_0138"
FT   CDS_pept        complement(155880..156272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0138"
FT                   /product="Proteinase inhibitor I42, chagasin"
FT                   /note="COGs: COG5513 secreted protein; InterPro IPR018990;
FT                   KEGG: mem:Memar_2202 secreted protein-like protein; PFAM:
FT                   Proteinase inhibitor I42, chagasin; SPTR: Secreted
FT                   protein-like protein; PFAM: Chagasin family peptidase
FT                   inhibitor I42"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34916"
FT                   /db_xref="InterPro:IPR018990"
FT                   /db_xref="InterPro:IPR036331"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE25"
FT                   /protein_id="ADN34916.1"
FT                   /translation="MKMAYSFAAVLLLAACLLFAGCTGTCTTMLYDDDNGKTVDVSKDC
FT                   EIMIELTENPTTGYTWELTAPGLTYVSDEYVPDANSEGLVGAGGVHVFIYKAENTGIFN
FT                   IEGIYKRSWEETSTDDTTWSATVVVK"
FT   sig_peptide     complement(156198..156272)
FT                   /locus_tag="Mpet_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(156375..157025)
FT                   /locus_tag="Mpet_0139"
FT   CDS_pept        complement(156375..157025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mem:Memar_2292 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34917"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE26"
FT                   /protein_id="ADN34917.1"
FT                   /translation="MTDKPLKAPDIAEMAGVSAGEMKRIAEEYKAVVPSRVFGRVKLYE
FT                   QKAAGIVEKISSMEAAGKTTADIIRELGGKVAAKSTKEKTGEKIRKKQSAPAGNNTPPG
FT                   KKPAPRPYRGREDETAFIELKLNRLTNRVEQLEKQLLAERAERNEERKEYLRIIAEITE
FT                   KVDTTGKWVDYFDKKIDDLSAGQDEFNKKTLEWIDYTEEEIDLLKKPFWKRRR"
FT   gene            157180..157638
FT                   /locus_tag="Mpet_0140"
FT   CDS_pept        157180..157638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0140"
FT                   /product="TrkA-C domain protein"
FT                   /note="COGs: COG0490 Putative regulatory ligand-binding
FT                   protein related to C-terminal domains of K+ channels;
FT                   InterPro IPR006037; KEGG: mbn:Mboo_0206 TrkA
FT                   domain-containing protein; PFAM: TrkA-C domain protein;
FT                   SPTR: TrkA-C domain protein; PFAM: TrkA-C domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34918"
FT                   /db_xref="GOA:E1RE27"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026278"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE27"
FT                   /protein_id="ADN34918.1"
FT                   /translation="MPGIGTKYELDTEKGDRVSIIYMEGEGVQLYVRSGSGDYCSADLT
FT                   PPEARRIGNVLTGAILETDEEEICMVFSSFADLKVKMHTFKLGDRTSGKTIGDLNIRSS
FT                   TGVTVVAVSRKGQSIFNPSPSFRFETNDSVLVIGNAEQMKRFEEEFVR"
FT   gene            157638..158762
FT                   /locus_tag="Mpet_0141"
FT   CDS_pept        157638..158762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0141"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="COGs: COG0475 Kef-type K+ transport systems membrane
FT                   components; InterPro IPR006153; KEGG: mbn:Mboo_0207
FT                   sodium/hydrogen exchanger; PFAM: sodium/hydrogen exchanger;
FT                   SPTR: Sodium/hydrogen exchanger; PFAM: Sodium/hydrogen
FT                   exchanger family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34919"
FT                   /db_xref="GOA:E1RE28"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE28"
FT                   /protein_id="ADN34919.1"
FT                   /translation="MFEGIALALLVCLILAWVSKKVRFPPIPAYMFAGLLLGAGGLGIV
FT                   GESDVSDFLAEAGLLFLLFTMGLELKPGEIYGQGRSFLVSGTVDLAINILTGYAVAVVV
FT                   GFDVMDAVVIACAFYISSSAMAVASLIENRKLAAPESETILWIMVFEDIMLLLIIVALS
FT                   SESKSPAAVIATATVLIAGFFALCYLFRKTVRGFLERYEDLGLLFTFSIVLAAGGVAIA
FT                   LDIPSTLVAIAIGSAMSVTKPEILEKHARPFRDIFLVIFFVFFGISVDLSSGFPVIPVI
FT                   LLSLAAVATKLISSLVIGKATHGNYISGIEIWSETTARGEFSLAIATYGSPLVLGTIAV
FT                   MVLITSTIGGLTGKYSDKIKRYVKKKSGKGRLPG"
FT   gene            complement(158751..159242)
FT                   /locus_tag="Mpet_0142"
FT   CDS_pept        complement(158751..159242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0142"
FT                   /product="CheW protein"
FT                   /note="COGs: COG0835 Chemotaxis signal transduction
FT                   protein; InterPro IPR002545; KEGG: mbn:Mboo_1579 putative
FT                   CheW protein; PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; SPTR: Putative CheW protein; PFAM: CheW-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34920"
FT                   /db_xref="GOA:E1RE29"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE29"
FT                   /protein_id="ADN34920.1"
FT                   /translation="MTVIDIVEFEINNERYALDIGLTREIVEMIPITPVPRAPPYIAGI
FT                   INLRGEITNIINLNNILGLPEKSAEDIEEHKIIVLVPEAAEGSIVGIIVDAVHSVLQIP
FT                   EKNIEKVSGGLSSEAYVKGIIKIEDKDTENLDTEKGRQKRLIIWLDISQLLQDLLASAR
FT                   "
FT   gene            complement(159267..161279)
FT                   /locus_tag="Mpet_0143"
FT   CDS_pept        complement(159267..161279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0143"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterProIPR000014:IPR004089:IPR004090:IPR000700:IPR
FT                   013767:IPR013656; KEGG: mbn:Mboo_1580 methyl-accepting
FT                   chemotaxis sensory transducer; PFAM: chemotaxis sensory
FT                   transducer; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: chemotaxis sensory transducer; PAS domain
FT                   containing protein; SPTR: Methyl-accepting chemotaxis
FT                   sensory transducer; TIGRFAM: PAS sensor protein; PFAM:
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain;
FT                   PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34921"
FT                   /db_xref="GOA:E1RE30"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE30"
FT                   /protein_id="ADN34921.1"
FT                   /translation="MELKDIIKVLKLAIEGDHSVRIDSDACKDPELKELSDTINTAIEF
FT                   LVDCKNTTDSVQMMIAQNPIPIVIVDSSFNIVDVNKSYADLLGVTLPEALSGDRSLYKA
FT                   KTLRGEGAGELFSMRKKTECELEMTLRSGTVKYVVQKGVPLVDENNNVNIGMFVFLDIT
FT                   KEREEEREIAKDLKKIEALQERSETIVQQNPMPIILCDKEMNIRVVNPAYSDLSGIPIN
FT                   RLTKMSLRDFKVLEQKGEGIKNVFETKRRCFGEVKVEFPTGVKTLEQYGIPIFNADGDI
FT                   ANLLIVYNDITAIREKEAEVLRLMEEQKEKAESLELSTNDIEKGLKAMSDGDFTVTVKH
FT                   RENDLLKQLKDNYNKAINESRTIFGDAIKAMIEVESYMSDANHSTGEVAKASEQVAING
FT                   QKAAELTRNLLRAMEEINKEISDMSASNEEIASTSQEVLDQSGRVSEMGREAEELGRNA
FT                   TSKMEVVMGITNKSVDEIEGLNNQLKEINNVVRLITEITNQINMLALNAAIEAARAGEH
FT                   GRGFAVVAGEVKNLATDAREATAQIDSVIEKIQKASLGTVESIKSANTEVTSGAESVNA
FT                   TIRALNNIVEGAERVTTDMGEIARAIEDQANIANKIVGQTDKSTVLAGDVQNEIDELAA
FT                   LSEETSASVQEIASAVDEVTGLAKQIKETISQLKV"
FT   gene            complement(161444..161893)
FT                   /locus_tag="Mpet_0144"
FT   CDS_pept        complement(161444..161893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbn:Mboo_0563 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34922"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE31"
FT                   /protein_id="ADN34922.1"
FT                   /translation="MASNREMEKKIGALADYLRVNPDKITPSKGTLYSFRAFYYGPNRA
FT                   YLVLTEIEANVAARRAIMNRLWVIALESVFNYFDIGCYPADALEKLSHDDIKKINAGLE
FT                   TLFEKTCGIEILAEKMLSLGNRANILADYDQKESTHGDYLIYRLF"
FT   gene            complement(162053..162637)
FT                   /locus_tag="Mpet_0145"
FT   CDS_pept        complement(162053..162637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0145"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /note="COGs: COG3390 conserved hypothetical protein;
FT                   InterPro IPR004365; KEGG: mem:Memar_2355 hypothetical
FT                   protein; PFAM: nucleic acid binding OB-fold
FT                   tRNA/helicase-type; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34923"
FT                   /db_xref="GOA:E1RE32"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE32"
FT                   /protein_id="ADN34923.1"
FT                   /translation="MSKGGFSRPAGSFVREPAIRVFSTELRESRLQFRDGEDEKSPSFI
FT                   LLPTGERCNRIFICGEVTQKEKRGDQNTFYTARLRDPAGLFFLNAGSYQQEAMQQMAKI
FT                   NQGDFAAVVGKPGIRETPDGSIFVTVRVETITRIDKDTYLTWIDDAAEQTLDRLEKFGS
FT                   TDDSMKASEFYNTSTEHYRRIVYESLVAADI"
FT   gene            complement(162637..163893)
FT                   /locus_tag="Mpet_0146"
FT   CDS_pept        complement(162637..163893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0146"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /note="COGs: COG1599 Single-stranded DNA-binding
FT                   replication protein A (RPA) large (70 kD) subunit and
FT                   related ssDNA-binding protein; InterPro IPR004365; KEGG:
FT                   mbn:Mboo_0179 nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; PFAM: nucleic acid binding OB-fold
FT                   tRNA/helicase-type; SPTR: Nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34924"
FT                   /db_xref="GOA:E1RE33"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE33"
FT                   /protein_id="ADN34924.1"
FT                   /translation="MDIDPQITERISLIFKEKGVLLENDKIESKLKLLTADFGIAPEEA
FT                   EKMVTSELLREYGLNGPSQQSPSAQQQAVPIAGVSPGDWVTVEGKIVSLSSPQSEVIAQ
FT                   SGILSDESGAIRFIVWAKSNAPLLEERKWYRFESATVDEYRGAPSMKIHSGTTITPIEM
FT                   EKTFMPSPVPISALKPGVSTIRAKVMQDWEPRHERMFQSGLLGDESGTVRFVTWKDDTN
FT                   VRLEAGKVYNIYYAGVDEFQGRLSMNLTGAMILEDEGADIEVASGDTKISGAFVHMGGG
FT                   TGLIKRCKVEGCNRALSRQNYCPVHEIQNDFRYDLRITGVVDNGQKATNVLVQRQEAEK
FT                   LTGISLEAAIETAENNPLGFDDVIMKMQEALLGRYVECKGSDIDGTLLVKSCSLVKYDS
FT                   TRHADLINRASVLPEGGEQ"
FT   gene            164033..164224
FT                   /locus_tag="Mpet_0147"
FT   CDS_pept        164033..164224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0147"
FT                   /product="Domain of unknown function DUF1858"
FT                   /note="InterPro IPR015077; KEGG: mem:Memar_2353
FT                   hypothetical protein; PFAM: Domain of unknown function
FT                   DUF1858; SPTR: Putative uncharacterized protein; PFAM:
FT                   Domain of unknown function (DUF1858)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34925"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR023883"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE34"
FT                   /protein_id="ADN34925.1"
FT                   /translation="MALTADSPLTELLQENPKAAEILMRFGMGCVGCALASGETIRQAA
FT                   EGHGIPLPELLEALGIEE"
FT   gene            complement(164270..165175)
FT                   /locus_tag="Mpet_0148"
FT   CDS_pept        complement(164270..165175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0148"
FT                   /product="protein of unknown function DUF105"
FT                   /note="COGs: COG1865 conserved hypothetical protein;
FT                   InterPro IPR002808:IPR007212; KEGG: mla:Mlab_0705
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF105; cysteine-rich small domain; SPTR: Putative
FT                   uncharacterized protein; PFAM: Cysteine-rich small domain;
FT                   Adenosylcobinamide amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34926"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="InterPro:IPR007212"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE35"
FT                   /protein_id="ADN34926.1"
FT                   /translation="MRFFYTKNTLFIRGNFRAASTGIAGGISDINTIINSSVPKDFECE
FT                   DPAGYIHDIITGKGYENDGFFGLLTAVNMKDLCIFSCGYITAFITAGVTNPNPQGPGTI
FT                   NIIIHSAKSMPDSAMLEMVKTVTEAKTAALFDMGYEFTGTTTDAVIVAYDRDAAESAGV
FT                   YCGTFTEPGMKAYECVRMGVKEAILRNESKVVRKRPSFFIHSTIGGAHWMEWSPDSCEY
FT                   YPCHFKGQACDFCYCPFYPCHDEQLGDWIDSASGKKVWACTRCLLLHHPKVAKYLKKNP
FT                   EAGLEDLKGTAKDYGLKIRE"
FT   sig_peptide     complement(165122..165175)
FT                   /locus_tag="Mpet_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(165172..165534)
FT                   /locus_tag="Mpet_0149"
FT   CDS_pept        complement(165172..165534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0149"
FT                   /product="oxygen-sensitive ribonucleoside-triphosphate
FT                   reductase-like protein"
FT                   /note="COGs: COG1328 Oxygen-sensitive
FT                   ribonucleoside-triphosphate reductase; KEGG: mem:Memar_2351
FT                   oxygen-sensitive ribonucleoside-triphosphate reductase-like
FT                   protein; SPTR: Oxygen-sensitive ribonucleoside-triphosphate
FT                   reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34927"
FT                   /db_xref="GOA:E1RE36"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE36"
FT                   /protein_id="ADN34927.1"
FT                   /translation="MIWTEEQLELAKKYKTLEDIPEEERRYKCHTCHMVVEESPCPNCG
FT                   ETHLEIMCPLDHCGCSHDIIEKIEYCPLCGQPICPECGSHDVSQVSRVTGYLADVAGWN
FT                   QGKQQELKDRSRYTVA"
FT   gene            165746..166009
FT                   /locus_tag="Mpet_0150"
FT   CDS_pept        165746..166009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dae:Dtox_3074 hypothetical protein; SPTR:
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34928"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE37"
FT                   /protein_id="ADN34928.1"
FT                   /translation="MEGDVFSGKNSVVLEIDGKKIAIEGLDSLFYSIYRGGVSSDELLL
FT                   ERVKEELEKTGSVPADLLDDAAARLITIYRENMERAGGINFG"
FT   gene            complement(166089..166724)
FT                   /locus_tag="Mpet_0151"
FT   CDS_pept        complement(166089..166724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0151"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /note="COGs: COG0284 Orotidine-5'-phosphate decarboxylase;
FT                   InterPro IPR014732:IPR018089:IPR001754; KEGG: mhu:Mhun_2545
FT                   orotidine 5'-phosphate decarboxylase; PFAM: Orotidine
FT                   5'-phosphate decarboxylase; SPTR: Orotidine-5'-phosphate
FT                   decarboxylase; TIGRFAM: orotidine 5'-phosphate
FT                   decarboxylase; PFAM: Orotidine 5'-phosphate decarboxylase /
FT                   HUMPS family; TIGRFAM: orotidine 5'-phosphate
FT                   decarboxylase, subfamily 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34929"
FT                   /db_xref="GOA:E1RE38"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE38"
FT                   /protein_id="ADN34929.1"
FT                   /translation="MTELILALDVLTREEAVYIADKTAPYLDAIKIGYPLVLGAGMKIV
FT                   HEIAGLGLPLIADFKVADIPNTNKLITEHAFQAGFSAIIAQGFTGSDSVEACVETAHDY
FT                   GGSCYVVSEMSHPGALEFLSGENAARIAKMAVECGADGIIAPATRPERVKALREIIGSK
FT                   KILSPGVGAQGGDAKEIAPLIDGMIVGRSIYNAEDPAKAAEEYSFIRR"
FT   gene            complement(166721..167668)
FT                   /locus_tag="Mpet_0152"
FT   CDS_pept        complement(166721..167668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0152"
FT                   /product="deoxyhypusine synthase"
FT                   /note="COGs: COG1899 Deoxyhypusine synthase; InterPro
FT                   IPR002773; KEGG: mem:Memar_2349 putative deoxyhypusine
FT                   synthase; PFAM: deoxyhypusine synthase; SPTR: Putative
FT                   deoxyhypusine synthase; TIGRFAM: deoxyhypusine synthase;
FT                   PFAM: Deoxyhypusine synthase; TIGRFAM: deoxyhypusine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34930"
FT                   /db_xref="GOA:E1RE39"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR036982"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE39"
FT                   /protein_id="ADN34930.1"
FT                   /translation="MKNNDLCKTPVIQARVKAGMTAGELVEQFGKSRAYNAGSLWHAVN
FT                   IYEKMLSDPEVVKFFGLAGAMVPGGMGGIVEDLILQGHIDVLVSTGANLTHDVIEAIGC
FT                   RHYHGTEICNDVELRDEEINRIYDIFLPNDAFIKFEEFLQGVFSGLETDKKYGIADLTR
FT                   TIGRNLDSGILAAAAKKEIPVYCPAIQDSMIGLQYWLFSQMNKVTIDAFADMPSLMDIC
FT                   FGAKKSGAMLVGGGVPKNYIFQSMLMTPNGFDYAVQLTGDRPDLGGLSGATLDEAKSWG
FT                   KLTGEATAQTVYGDATINLPLIVAATLERLEMRR"
FT   gene            167769..168650
FT                   /locus_tag="Mpet_0153"
FT   CDS_pept        167769..168650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sul:SYO3AOP1_0096 ribonuclease BN; SPTR:
FT                   Ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34931"
FT                   /db_xref="GOA:E1RE40"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE40"
FT                   /protein_id="ADN34931.1"
FT                   /translation="MNALYLFAAGGDRLPAAEGRYLMGLYDILRELRTFGLKKTLFLLL
FT                   LVLVPVALYLFQSEVFGGNFTADFILRNFVLQYSDPTVLSMFFANYTHNPTVPDHIFVN
FT                   IVSFLVFGFLVWFLYYHIIPVPESFLPENFLTINLALIFFVFPFAISGVAIFFYRLGSL
FT                   PAYVMFGVGFSGIVWAFTGLLLFLLFFILMIELFAANDLSGPGGLQELRMKIAVVLFSV
FT                   SVGVMSLFFLILADVGTESNPFAHFAGFALGFIIPGLVALFLDSEKLLQRTSYIIVISA
FT                   VLVLASVAWLFL"
FT   gene            168691..169239
FT                   /locus_tag="Mpet_0154"
FT   CDS_pept        168691..169239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0154"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="COGs: COG1413 FOG: HEAT repeat; InterPro IPR004155;
FT                   KEGG: mem:Memar_2192 heat repeat-containing PBS lyase;
FT                   PFAM: PBS lyase HEAT domain protein repeat-containing
FT                   protein; SMART: PBS lyase HEAT domain protein
FT                   repeat-containing protein; SPTR: PBS lyase HEAT domain
FT                   protein repeat-containing protein; PFAM: PBS lyase
FT                   HEAT-like repeat; HEAT repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34932"
FT                   /db_xref="GOA:E1RE41"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE41"
FT                   /protein_id="ADN34932.1"
FT                   /translation="MTMNSESRTPMERLEKERERRQKENFEILVAQLDHRHITYRVKAA
FT                   ESLGNTGDRRAVPHLIGSINPDGEPEYLYVAMLSLGKLGSAEAVPVLIPYLESDDKWVR
FT                   LGAVKALGMLRDDSATLPLLRLLNDKKWDVRASAAESFSLMGCTEAIEFIVPMLSDEDS
FT                   RVRESARKVLNVLERLEKV"
FT   gene            complement(169255..169839)
FT                   /locus_tag="Mpet_0155"
FT   CDS_pept        complement(169255..169839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0155"
FT                   /product="GPR1/FUN34/yaaH family protein"
FT                   /note="COGs: COG1584 membrane protein; InterPro IPR000791;
FT                   KEGG: mtp:Mthe_0263 GPR1/FUN34/YaaH family protein; PFAM:
FT                   GPR1/FUN34/yaaH family protein; SPTR: GPR1/FUN34/yaaH
FT                   family protein; PFAM: GPR1/FUN34/yaaH family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34933"
FT                   /db_xref="GOA:E1RE42"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE42"
FT                   /protein_id="ADN34933.1"
FT                   /translation="MIDEKDRNNIFIMDGTANPGPLGLLGFGMTTVLLNLHNAGYFALG
FT                   SMILAMGIFYGGLAQIIAGIMEWKKKNTFGTTAFTSYGLFWMSFAAMLIIPALDLASVP
FT                   EGAAMGWYLFMWGLFTAVMFIATLRINRTLQFVFGSLALLFFLLSAAEFTGSALIGTIA
FT                   GYEGIICGLSAVYGGLAQVINEVYGKAVCPL"
FT   gene            complement(170618..170689)
FT                   /locus_tag="Mpet_R0003"
FT   tRNA            complement(170618..170689)
FT                   /locus_tag="Mpet_R0003"
FT                   /product="tRNA-Met"
FT   gene            complement(170869..171543)
FT                   /locus_tag="Mpet_0156"
FT   CDS_pept        complement(170869..171543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_2438 hypothetical protein; SPTR:
FT                   Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34934"
FT                   /db_xref="GOA:E1RE43"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE43"
FT                   /protein_id="ADN34934.1"
FT                   /translation="MKIKPGKIITLILQVLIVLIIVASFYTGDYFFAIGGVFAFFLTIV
FT                   PYIVEKEFCLVIPWWLTFLIVLSLYIHLAGEYYSWYILFYPYYDKFAHTISGITVGLLG
FT                   FTAVLLIDRYTENNFNRPLIIFMIFMLTMAFGALWEIIEFTMDTFFLYGDPMQHGNTDT
FT                   MLDMIFVMFGAIIVAALGNFYLRKMSKLDLSQLLAGNPDLERYAHPAEEKAKNDAEEHR
FT                   DQ"
FT   gene            171671..172066
FT                   /locus_tag="Mpet_0157"
FT   CDS_pept        171671..172066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0157"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="COGs: COG1739 conserved hypothetical protein;
FT                   InterPro IPR001498; KEGG: mla:Mlab_0586 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0029; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterized
FT                   protein family UPF0029"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34935"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE44"
FT                   /protein_id="ADN34935.1"
FT                   /translation="MKELSAIKYEVRKSRFFAHLYLIESEDDVAAINGIQREMYKKAAH
FT                   HCYAARYPSGNSGSTAFGNDGEVGRPGRVLLDILIQKNLGSHCLAVSRVFGGIKLGPAG
FT                   VSRAFRDAGNAAVEHYLESGSVSGDSS"
FT   gene            complement(172047..172685)
FT                   /locus_tag="Mpet_0158"
FT   CDS_pept        complement(172047..172685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0158"
FT                   /product="Methyltransferase type 11"
FT                   /note="InterPro IPR013216; KEGG: mem:Memar_1026
FT                   methyltransferase type 11; PFAM: Methyltransferase type 11;
FT                   SPTR: Methyltransferase type 11; PFAM: Methyltransferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34936"
FT                   /db_xref="GOA:E1RE45"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026113"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE45"
FT                   /protein_id="ADN34936.1"
FT                   /translation="MTGSFSGWEKHYRKHRQPWAGTVPDRPVIPEGSVVLEAGCGNGKF
FT                   LKELLKDNIKICAFDFSEKAVDTCKNDISCFNTRAKADLLTADCIDLPFRDSAFDTAFY
FT                   RHITGHLDEAGRKKSAGECTRVLKEGGLLYFTGFSVEDMRAGNGIETEQNSFLRGNGIL
FT                   THYFTEEEVRRLFPGLDEISVKTIRWNMRVRGTDHTRAEINAVLRKSRR"
FT   gene            complement(172749..173165)
FT                   /locus_tag="Mpet_0159"
FT   CDS_pept        complement(172749..173165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_2484 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34937"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE46"
FT                   /protein_id="ADN34937.1"
FT                   /translation="MQKSGYMQVSNAPAYDPSGRKCRIIEISIDIGRYAVEAGELSKLL
FT                   LYGRRCQVRHISQHFGKHLGETAGVVSLSFSKKGLILEIFPGHRYMIAKGGVENMLEGY
FT                   IRYTKISAMHAPESEIHSCNSPTIQSTITPWVAV"
FT   gene            173347..173961
FT                   /locus_tag="Mpet_0160"
FT   CDS_pept        173347..173961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0160"
FT                   /product="6-phospho-3-hexuloisomerase"
FT                   /note="COGs: COG0794 sugar phosphate isomerase involved in
FT                   capsule formation; InterPro IPR001347; KEGG: mem:Memar_0706
FT                   sugar isomerase (SIS); PFAM: sugar isomerase (SIS); PRIAM:
FT                   6-phospho-3-hexuloisomerase; SPTR: Hexulose-6-phosphate
FT                   isomerase; PFAM: SIS domain; TIGRFAM: 6-phospho
FT                   3-hexuloisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34938"
FT                   /db_xref="GOA:E1RE47"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE47"
FT                   /protein_id="ADN34938.1"
FT                   /translation="MSGCGDVKMNMRTMTDEISRRIEEISDDEISSFTSSILTARRIYV
FT                   AGAGRSGLIARAFAMRLMHIGLESYVVGETVTPAMEPGDAVVVFSGTGETNSMVDIAES
FT                   TKALGGTLCLITSHRGSSIGKLADYIVEIPSEPPEDREWPNTFEVRQLTGGYKSLFQPL
FT                   AAIGTFFETAAMIFSDALIADLMDIRKCGIEEVMKRLSNIQ"
FT   gene            173964..175001
FT                   /locus_tag="Mpet_0161"
FT   CDS_pept        173964..175001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_2443 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34939"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE48"
FT                   /protein_id="ADN34939.1"
FT                   /translation="MSNISCPVCGGDCVKDAETLIREAEFLFLPCSDCIAIPLDKRLPP
FT                   PGLHPSEACLSCGKRFIDDVFSHCHAIMGEEGVIKADTPLGGIGTPLISPGIDLSSPPF
FT                   LPRRSLVLLTRHADKKTAERLVAEVPEIKGVIRDRGIVPGITGDDLSSSSENELLAGCD
FT                   VRADIFRSSGGAFAVYKQQSLLHIEFPRGTGLKIRTVEKMIDENFPEVFIDACCGAGTL
FT                   GIAALLAGVPSVVFNDAWYPAAFWSAVNIHVNRCLTGTGEIAFAGSCRPDDRRISTGTV
FT                   EIAGSQGGERRTVVLWGDYMDAGDFIPEGRRLAAIDVFGKDNRENTKWIVSRWKAAFGG
FT                   DAFIP"
FT   gene            175025..175314
FT                   /locus_tag="Mpet_R0004"
FT   ncRNA           175025..175314
FT                   /locus_tag="Mpet_R0004"
FT                   /product="SRP RNA"
FT                   /note="signal recognition particle RNA predicted by Rfam
FT                   (RF00017), score 73.50"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            175342..176298
FT                   /locus_tag="Mpet_0162"
FT   CDS_pept        175342..176298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0162"
FT                   /product="Lactate/malate dehydrogenase"
FT                   /note="COGs: COG0039 Malate/lactate dehydrogenase; InterPro
FT                   IPR001557:IPR018177:IPR001236; KEGG: mhu:Mhun_2343 malate
FT                   dehydrogenase; PFAM: Lactate/malate dehydrogenase; SPTR:
FT                   Malate dehydrogenase (NAD) / malate dehydrogenase (NADP);
FT                   manually curated; PFAM: lactate/malate dehydrogenase,
FT                   alpha/beta C-terminal domain; lactate/malate dehydrogenase,
FT                   NAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34940"
FT                   /db_xref="GOA:E1RE49"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE49"
FT                   /protein_id="ADN34940.1"
FT                   /translation="MLKVTVIGASGKVGQSAAYAISRIPSITEIVLFGREGNEESLDGL
FT                   KWDFTDAFAAVGRRIKVVSGADPSLIRDSDMVIITSGAPRHTGQDRIDLAKGNAKIIAN
FT                   YAKMVAENAPDTILFVVTNPVDIMTAVALKYSGFPPSRVFGLGTHLDSMRLKSFIAQHF
FT                   KVHVSEVHTRIIGEHGDTMVPLWSATTIGGIQLKNLPEFKTFTGEEMIDWVKAAGHYII
FT                   ERSGATIYGPGEAIATLARTVLGNENRILSVTAYIRCEVHDIGDVCIGVPAMLNRKGVF
FT                   PIPIRISPEEVEDFQASVEKIRRVTDEVFDYLENEGF"
FT   gene            complement(176334..177569)
FT                   /locus_tag="Mpet_0163"
FT   CDS_pept        complement(176334..177569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0163"
FT                   /product="protein of unknown function DUF111"
FT                   /note="COGs: COG1641 conserved hypothetical protein;
FT                   InterPro IPR002822; KEGG: mvn:Mevan_1281 hypothetical
FT                   protein; PFAM: protein of unknown function DUF111; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF111; TIGRFAM: conserved hypothetical protein
FT                   TIGR00299"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34941"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE50"
FT                   /protein_id="ADN34941.1"
FT                   /translation="MKCLVIDSRLAGIAGDMLISALVDLKGDEEPLRRTAEAISGLESC
FT                   RSFTFSVEESDDSFFPAKKLSIEIEEGGVDGKDGLLEAASLVMDAIGISPAARKKAEAA
FT                   FDDLLYAEKRLHRSGFNRHEIASADTLFDVIGSIALLDSAGFFDGIIHAITPVVGAGSI
FT                   SVRGEQVPGPAPAVLEIFARKKIPFSGRDVDMEFTTPTGAAILANIATTVSPIYPPMTP
FT                   EATGYGTGTRRNNGNPSNVLRVVAGETSAASNDSIVMLETNVDDIPGEIIGYTIERLFA
FT                   EGAADVFVTGAIGKKNRPVNIISVITNRQNHLRLTETLMKETGTLGVRIYEVPRLVADR
FT                   TRESINVGVGNKQYQVSLKRSTVGERLVSLKPEYDDLKKIALDAGLSLREIMDIAGKEI
FT                   SDYESRSETEKN"
FT   gene            complement(177584..179425)
FT                   /locus_tag="Mpet_0164"
FT   CDS_pept        complement(177584..179425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR002198; KEGG: afu:AF1856 hypothetical
FT                   protein; SPTR: Uncharacterized protein AF_1856"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34942"
FT                   /db_xref="UniProtKB/TrEMBL:E1REJ5"
FT                   /protein_id="ADN34942.1"
FT                   /translation="MTDLERERVLNSVSQAVSFKPAYMTNDKLEAAVKGHGSLVISAYA
FT                   ISNSIAEDIFCPYGAPDMELLNRMTLVDASVATLPLDMVMEKAINSAKLAGATPENAAL
FT                   LAAAFAYFTGSCARSGVPLGNRKLGAIARIHAGVPRTSAISLITGKFTHKIPAFPAYMA
FT                   IYEELVDKKLTRVDGSVLPPFVSGGAMYGHSALGEDYNFPELAYNAAKVGTEAMIKSMH
FT                   GAGIYAYPLWPAFIGSAITLEMIHSDAALGEEYGTFTGTDSAYMAGKGAMDAAGIPAKI
FT                   HVRGTNEEYDTARVIGDFGLILKDIGGPSVVGSMALDEVFAGFQEAATMGAGFSGGPVN
FT                   APLGHVLGDCMPAIRMLIKYNGDVYRTADDIRDYKMNSFIDPEYALCSLNTIARKAEDV
FT                   TRGSVSTACLLASEDVKQRAVYRRAVKSYEMLKAGKTVEEVARQLDDERKAYVEERGSQ
FT                   VLSGFTGKDIKVRFTSITPQGRRTDNFTKKFWAFDANICFEATVNGKDYKIDNFAAKVI
FT                   PEYVVDGKGRDDPDMGTVIFAGSVLSQELQYVGHTILNITIPAATGALLGGDPKTVAKD
FT                   SQKGAYLTSAIPGGKEKAMEVVAVAKQIYDRINEPFP"
FT   gene            complement(179608..179868)
FT                   /locus_tag="Mpet_0165"
FT   CDS_pept        complement(179608..179868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0165"
FT                   /product="translation elongation factor aEF-1 beta"
FT                   /note="COGs: COG2092 Translation elongation factor
FT                   EF-1beta; InterPro IPR004542:IPR014038; KEGG:
FT                   mem:Memar_2445 translation elongation factor aEF-1 beta;
FT                   PFAM: Translation elongation factor EF1B, beta and delta
FT                   chains, guanine nucleotide exchange; SPTR: Elongation
FT                   factor 1-beta; TIGRFAM: translation elongation factor aEF-1
FT                   beta; PFAM: EF-1 guanine nucleotide exchange domain;
FT                   TIGRFAM: translation elongation factor aEF-1 beta"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34943"
FT                   /db_xref="GOA:E1REJ6"
FT                   /db_xref="InterPro:IPR004542"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR036219"
FT                   /db_xref="UniProtKB/TrEMBL:E1REJ6"
FT                   /protein_id="ADN34943.1"
FT                   /translation="MGDVAVILKVMPESPDVDLEGLKKAIKEKYPGTQDIVEDPIGFGL
FT                   VAIKVAIVIPDGTAGAADEAEAALASIEGVQSAEIVSLTLN"
FT   gene            complement(179872..180030)
FT                   /locus_tag="Mpet_0166"
FT   CDS_pept        complement(179872..180030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mla:Mlab_0627 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34944"
FT                   /db_xref="InterPro:IPR011668"
FT                   /db_xref="UniProtKB/TrEMBL:E1REJ7"
FT                   /protein_id="ADN34944.1"
FT                   /translation="MPTEKCTSCKAPLSEPGWTKFECPKCREVIYRCHKCRHQSVPYEC
FT                   KCGFQGP"
FT   gene            complement(180076..180708)
FT                   /locus_tag="Mpet_0167"
FT   CDS_pept        complement(180076..180708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0167"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /note="COGs: COG2054 Uncharacterized kinase related to
FT                   aspartokinase uridylate kinase; KEGG: mpl:Mpal_2593
FT                   aspartate/glutamate/uridylate kinase; SPTR:
FT                   Aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34945"
FT                   /db_xref="GOA:E1REJ8"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:E1REJ8"
FT                   /protein_id="ADN34945.1"
FT                   /translation="MQHNETFIRMVRIPDSDHFVVKLGGSLMEHAPRLIDILVRSGRNI
FT                   TIVPGGGCFADSVREMELDDDSSHWMAILAMEQYGCYLHSLGLAVQDELVRGTGVCVLL
FT                   PYSCLREDDPLPHSWDVTSDTIAAWAAGRMGSPLILLKSTEGLSAGGRTLDIVSSPGSY
FT                   PECDPCLVPYVLENGIHTTVINANDGITAERFFRGEEVAGTVIIRSV"
FT   gene            180782..182494
FT                   /locus_tag="Mpet_0168"
FT   CDS_pept        180782..182494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0168"
FT                   /product="phospholipase D/transphosphatidylase"
FT                   /note="COGs: COG1502
FT                   Phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthase; InterPro IPR001736; KEGG:
FT                   mem:Memar_2448 phospholipase D/transphosphatidylase; SPTR:
FT                   Phospholipase D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34946"
FT                   /db_xref="GOA:E1REJ9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:E1REJ9"
FT                   /protein_id="ADN34946.1"
FT                   /translation="MGIRGAVFAIILFVFFCITSVSAEFVISEFCPDTWLSGEGDEYFV
FT                   IGGSGDLTGYYVTDNEGSARFPDNTVAGGSVVVAQKSTDYEAVHGEKPDFEIYNSDPQV
FT                   PDMVRTGTLKMANSGDELILKRGFAVIQEVRWPGDVVSGEGRVHVYSDGVWDERPYYIG
FT                   QSLFEPETFYDVSVTVFAAPDCSYAKLKDFIENSKSSLDINVYEFTGTSIAGLLAEASG
FT                   RGVDVDVLVEGSPVGGVSDEEKNVCSILGSVRIPVLSMATENGVFHAPYRYDHAKYVIS
FT                   DDSLVLVASENFGETGYPSSGMGGNRGWGAIAESPALASYFEDIFDYDTSGGWITEMTG
FT                   TNGVGSYSVAEAKTGNFLPESFEGASVTPVISPDTSYLVGDLISSAKESVCIEQAYIKN
FT                   WSSGENPWLEDAIDAARRGANVRIILDSYYYNIEGDDDNDEMAQYINAVASSGSLPLEA
FT                   RLISLESGYLDKVHNKGVIVDGRQVLVSSINWNENSPSYNREAGLIIDHAGAAGYFTEV
FT                   FDSDWDSSAPVDPSTGHIGDVSGSSQTDELRNYIAAGVIFLFAALYVVKKKRF"
FT   sig_peptide     180782..180850
FT                   /locus_tag="Mpet_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(182788..183282)
FT                   /locus_tag="Mpet_0169"
FT   CDS_pept        complement(182788..183282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0169"
FT                   /product="Protein of unknown function DUF367"
FT                   /note="COGs: COG2042 conserved hypothetical protein;
FT                   InterPro IPR007177; KEGG: mem:Memar_2471 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF367; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DUF367)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34947"
FT                   /db_xref="GOA:E1REK0"
FT                   /db_xref="InterPro:IPR007177"
FT                   /db_xref="InterPro:IPR022968"
FT                   /db_xref="UniProtKB/TrEMBL:E1REK0"
FT                   /protein_id="ADN34947.1"
FT                   /translation="MMMPLFAWRDNSCDPRICSVKKLERAGMIRVAAKIDKIPKSTLLL
FT                   DPRSPQALSPADRIAPSLTVLDCTWETLEKVDVGEITRKRALPFLVAANPGHFGRPFML
FT                   NSVEALAAALYIMGEKQQAHDILAKFGWGIRFLEVNAEPLEDYSRAANSAEIVEIQSHY
FT                   Y"
FT   gene            183301..184137
FT                   /locus_tag="Mpet_0170"
FT   CDS_pept        183301..184137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0170"
FT                   /product="nucleoside 2-deoxyribosyltransferase"
FT                   /note="COGs: COG3613 Nucleoside 2-deoxyribosyltransferase;
FT                   InterPro IPR019274:IPR007710; KEGG: mem:Memar_2470
FT                   nucleoside 2-deoxyribosyltransferase; PFAM: nucleoside
FT                   2-deoxyribosyltransferase; Protein of unknown function
FT                   DUF2297; SPTR: Nucleoside 2-deoxyribosyltransferase; PFAM:
FT                   Protein of unknown function (DUF523); Nucleoside
FT                   2-deoxyribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34948"
FT                   /db_xref="GOA:E1REK1"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:E1REK1"
FT                   /protein_id="ADN34948.1"
FT                   /translation="MLSMYVLMCPCITDPALRAKGITRDDDIFCFNRCIERCERFGIEI
FT                   VRMPCPETIFLGKDREPTNFAESLANDEFSKLLDELEADARKVIEEKGEPLCIIGVDSS
FT                   PSCGVNMTYATEEKTPGRGAFLSRFPDIKAVDVTDFCRYKIYLAGPLFTEAETDFNLKL
FT                   HDFLEEHLLDVYLPQEVGDTSVTRHKEEHARIFGMHLAALEDCDYIVSVVDGADADSGT
FT                   SWEMGYGYAKGKTVISLRTDFRCVGCHELVNLMLEESSFVVRKKEDILRELGPQIL"
FT   gene            184196..185542
FT                   /locus_tag="Mpet_0171"
FT   CDS_pept        184196..185542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0171"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterProIPR000014:IPR003594:IPR005467:IPR000700:IPR
FT                   013767:IPR011495; KEGG: mth:MTH468 sensory transduction
FT                   histidine kinase; PFAM: histidine kinase
FT                   dimerisation/phosphoacceptor; PAS fold domain protein;
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; PAS domain
FT                   containing protein; SPTR: Sensory transduction histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: Histidine
FT                   kinase; Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34949"
FT                   /db_xref="GOA:E1REK2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1REK2"
FT                   /protein_id="ADN34949.1"
FT                   /translation="MVKDVGSEDYLQYSHWIAIVALFTVLAAGVNLFTLTFDPPYPALS
FT                   LFMIPVVIATFFFRRQGLLASLLILALFSVVIWLYSPDKFAELRVLENVTVVFGVALIV
FT                   TLLSTALHRSENSYRLLFETSPAPIIVLKPDGSIVDVNSRFFSVFGYGSIFVEGKKIQQ
FT                   LPIIAEESLIEIGERLMNPEPDGDNQEPFIIKVMDASGDMHICNVFSSFLYDETGIPES
FT                   CMMVLVDITENVKAEEEIKRSLEEKETLLKEIHHRVKNNLQEVVSILKLQRNRTTDEDV
FT                   QWSLKECQNRVYTMAMVHENIYRADSLSSIGIKAYLEKLARDLLIEYMSPGQNISFEIE
FT                   CSDDIEFDIDGIIPVALITNELISNSMKYAFPGGRKGMIRIAVEKTPDNSYRYTYSDDG
FT                   VGFPPGLRIDKTKTLGLRIVRAFVRQLDGSIEFVPGTGTKIIITFPIKE"
FT   gene            185599..187056
FT                   /locus_tag="Mpet_0172"
FT   CDS_pept        185599..187056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0172"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="COGs: COG0784 FOG: CheY-like receiver; InterPro
FT                   IPR001789:IPR000014:IPR013767:IPR013656; KEGG:
FT                   mhu:Mhun_2637 putative PAS/PAC sensor protein; PFAM:
FT                   response regulator receiver; PAS fold domain protein; PAS
FT                   fold-4 domain protein; SMART: response regulator receiver;
FT                   PAS domain containing protein; SPTR: Putative PAS/PAC
FT                   sensor protein; TIGRFAM: PAS sensor protein; PFAM: Response
FT                   regulator receiver domain; PAS fold; TIGRFAM: PAS domain
FT                   S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34950"
FT                   /db_xref="GOA:E1REK3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1REK3"
FT                   /protein_id="ADN34950.1"
FT                   /translation="MKKILIVEDSALVALEISETLKNLGYNVVGEAASGLEAIEMVRDL
FT                   RPDLVLMDIILKGDMDGIEAADRIYSNYDIPVIYLTAHSDEATLERALKTNAFGYLIKP
FT                   FNDRELYSNIEITLHKHRIMKKVDLGPREAVDSTLNVLADPVVAVDESGIITRINPAAE
FT                   NFTGQTKWEAVGSDFFRIFSLDREKVQPAMDSLKNDVFEKRTLLSWVDGLSLVTKKGET
FT                   KQVSMNIGYVRAGRQNNAEYFFVLIPDEGTATKTADDTANHYRIILDAVENPIFMVDGD
FT                   IRIVLFNRAFQETCGKAGISLNGVGDEPAYAVLPHSVFGDEYDFMDAFEAGTGYVRERL
FT                   WKTDGEVRTYRIETIPIFENDRPIYAAIIMSDISEVVEFEERNGKLSVSLRAYTRNVED
FT                   IGDLCAGLKEPLNNIRKHAAKVSPPFESMQIGAALAELSELIYSIDMKWLEYEKVKKMV
FT                   ESAGGFDLVPAVKSIAEEGEGGGEGAH"
FT   gene            187443..187625
FT                   /locus_tag="Mpet_0173"
FT   CDS_pept        187443..187625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xtr:549053 caspase 7, apoptosis-related
FT                   cysteine peptidase; SPTR: Caspase 7, apoptosis-related
FT                   cysteine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34951"
FT                   /db_xref="UniProtKB/TrEMBL:E1REK4"
FT                   /protein_id="ADN34951.1"
FT                   /translation="MFHLGFNEISGYLKPMNYSDLYEHDECWDGSGYSTSSLNYRSCIR
FT                   SGDMITLVSERDEAD"
FT   gene            complement(187745..188587)
FT                   /locus_tag="Mpet_0174"
FT   CDS_pept        complement(187745..188587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR000182; KEGG: mhu:Mhun_1230 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34952"
FT                   /db_xref="GOA:E1REK5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR041496"
FT                   /db_xref="UniProtKB/TrEMBL:E1REK5"
FT                   /protein_id="ADN34952.1"
FT                   /translation="MEEILIRKALPKEIPLFIEWAGKEGWNPGIHDSECHYAVDPDGWF
FT                   VAVSEDAIIGTIALTNYDDYFSFGGFFIIKEEFRHIGAGWELWSTASSHVGDRNLGIDG
FT                   VYEMQDNYSRHSGFRFAYRNIRWEGTACGSPQDDLIDINNIPFKETADYDSLHFPARRE
FT                   SFLKKWLNMPESTALAYTGPDGGIAGYGVVRKCLEGHKIGPLFADSPEIADRILEGLTF
FT                   SVRGETFYFDTPEINQEAVKIAKQRDMSEVFGTARMYTGDIPELPVERIFGVTTFELG"
FT   gene            complement(188625..189197)
FT                   /locus_tag="Mpet_0175"
FT   CDS_pept        complement(188625..189197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0175"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="COGs: COG0655 Multimeric flavodoxin WrbA; InterPro
FT                   IPR005025; KEGG: msi:Msm_0664 NADPH-dependent FMN reductase
FT                   family multimeric flavodoxin; PFAM: NADPH-dependent FMN
FT                   reductase; SPTR: Multimeric flavodoxin, NADPH-dependent FMN
FT                   reductase family; PFAM: NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34953"
FT                   /db_xref="GOA:E1REK6"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1REK6"
FT                   /protein_id="ADN34953.1"
FT                   /translation="MKKVIILNASPRANGNTDILCRTCAEAIEKNGCEAEIISFRGKSF
FT                   KSCIACNTCKEKKGECAIKDDGLNEIIDKIKDAKGLIVASPVYFGTARGDMMSAIQRIS
FT                   MVSYGGDRFLSGMVGGPIAVARRGGHTATIQELLMFYFINDMIVAGSDYWNMAFGKAPG
FT                   EVEEDSEGLAVISKFGANVANIINKMN"
FT   sig_peptide     complement(189153..189197)
FT                   /locus_tag="Mpet_0175"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(189282..190121)
FT                   /locus_tag="Mpet_0176"
FT   CDS_pept        complement(189282..190121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0176"
FT                   /product="ABC-2 type transporter"
FT                   /note="InterPro IPR013526:IPR000412:IPR013525; KEGG:
FT                   mpl:Mpal_0427 ABC-2 type transporter; PFAM: ABC-2 type
FT                   transporter; SPTR: ABC-2 type transporter; PFAM: ABC-2 type
FT                   transporter; TIGRFAM: daunorubicin resistance ABC
FT                   transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34954"
FT                   /db_xref="GOA:E1REK7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E1REK7"
FT                   /protein_id="ADN34954.1"
FT                   /translation="MKFGFLNIYKRDMTRFFRFKHQLFSSLLQPALWLGFFGMAMAGNF
FT                   DRILGGTGEAVSGTMSVDYLTFMCAGVIAATILFTNIFGGFILLFDKNWGIFREILASP
FT                   MSRKDIIIGIAMSGITKSWIQAIIVIVFGLILGVAFFTGKGPFGIIFSLAGILLFIALF
FT                   SIAFISLSAIIALKMDSPEGFQGISTLLTMPLFFVSNALYPATGLPVVLQQIAEVNPLT
FT                   HLTAGIRYFAIGGDFTAIGMHFVYTTTDMLVSLGYLALFAGVIFAIAWRVVDKVVIT"
FT   sig_peptide     complement(189996..190121)
FT                   /locus_tag="Mpet_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(190132..191073)
FT                   /locus_tag="Mpet_0177"
FT   CDS_pept        complement(190132..191073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0177"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro
FT                   IPR003593:IPR005894:IPR003439:IPR017871; KEGG:
FT                   mpl:Mpal_0428 daunorubicin resistance ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: Daunorubicin resistance ABC transporter
FT                   ATPase subunit; TIGRFAM: daunorubicin resistance ABC
FT                   transporter ATPase subunit; PFAM: ABC transporter; TIGRFAM:
FT                   daunorubicin resistance ABC transporter ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34955"
FT                   /db_xref="GOA:E1REK8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1REK8"
FT                   /protein_id="ADN34955.1"
FT                   /translation="MEGSVIIDVEGLSHSYGDLRAVDNISFSVKSGEIFSFLGPNGAGK
FT                   STAINVLITLLPLQKGKVAIAGHDLGSEPKAVRNSIGIVFQEITLDRDMTVNETLEFHG
FT                   NLYSMEKKEIDSRIEELLTLVELHDKKDVLTKNLSGGMKRRLEIARGLMTRPAVLFLDE
FT                   PTIGLDPQTRRKTWEYLRAVNEEGTTIFLTTHYMDEADLLSDRISIIDHGRIIASGTPE
FT                   ELKNSLGEDIICLETPERKRAEEAIRVNGDIKSISENEDGLVIMTEKDGAHILPELIAG
FT                   LNTDGIKITAVNLKKPSMDDVFMHYTGSALRE"
FT   gene            complement(191188..191376)
FT                   /locus_tag="Mpet_0178"
FT   CDS_pept        complement(191188..191376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mem:Memar_1432 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34956"
FT                   /db_xref="UniProtKB/TrEMBL:E1REK9"
FT                   /protein_id="ADN34956.1"
FT                   /translation="MWVLVRKPDGTEKELDLPEDSYIEIGDILEDGSVVLEIRYTDEDD
FT                   DLTEMGYFSDERDEDFL"
FT   gene            191589..192035
FT                   /locus_tag="Mpet_0179"
FT   CDS_pept        191589..192035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0179"
FT                   /product="UspA domain protein"
FT                   /note="COGs: COG0589 Universal stress protein UspA and
FT                   related nucleotide-binding protein; InterPro
FT                   IPR006015:IPR006016; KEGG: mhu:Mhun_0542 hypothetical
FT                   protein; PFAM: UspA domain protein; SPTR: UspA; PFAM:
FT                   Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34957"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E1REL0"
FT                   /protein_id="ADN34957.1"
FT                   /translation="MLRKILVACDGSLQSEKALIAAIEDCMAEDSELHIVHIMNIKKFS
FT                   AIDSESSYDGVESPHDISRKFLEKNRDETVNMIDRVCRGRDMIYTLHVKGGDPRHEIID
FT                   LAAETSADLIVMGSTGKGLGSRILLGSVSAYVSVHSPVSALIVK"
FT   gene            192144..195248
FT                   /locus_tag="Mpet_0180"
FT   CDS_pept        192144..195248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0180"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterProIPR001789:IPR000014:IPR003594:IPR005467:IPR
FT                   000700:IPR013656:IPR013767:IPR011495; KEGG: mma:MM_0168
FT                   sensory transduction histidine kinase; PFAM: response
FT                   regulator receiver; PAS fold-4 domain protein; PAS fold
FT                   domain protein; histidine kinase
FT                   dimerisation/phosphoacceptor; ATP-binding region ATPase
FT                   domain protein; SMART: response regulator receiver; PAS
FT                   domain containing protein; ATP-binding region ATPase domain
FT                   protein; SPTR: Hypothetical sensory transduction histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: Histidine
FT                   kinase; Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; Response regulator receiver domain; PAS fold;
FT                   TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34958"
FT                   /db_xref="GOA:E1REL1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1REL1"
FT                   /protein_id="ADN34958.1"
FT                   /translation="MTIRVLVVDDEEGMLRSYRRILKTLNYEICGTARNNEEAVKAACE
FT                   TVPDVIIMDVSLGGSKSDGIDAAREINSFLEVPVIFVSAFGNTADTERIVEPWSYGFIK
FT                   KPFDLIEIQSSIELAVNKYRTFKYERELLKKDSILKAVNSAATLFLSKEPFEESLRKTI
FT                   ELIGRAVESRYICLYQNLGNADEVKGATCNYKWFAGSRSEPENSPCSDIVYDESYSGFK
FT                   ESLFRGDIIMYPGCDEGPEEVIFPFNVPVPVINIPIFCGTFWWGFLSIGMGDSEGSGMD
FT                   VEMEALVTAASILGSALNQKRMNDALMKREEEYRSLYKMMRLVCDNVPDAIWVKGKDRR
FT                   YTFVNRTFAEDFIKTEDTDEPLGKGIEYFAERERALHSGDECWLNIDEGAFEADSKVLE
FT                   SGISLNTESRYYIYGEQKHLDVYRAPFYDDEGNLVGVVGCARDETKRKNIEDNLRELNE
FT                   RFETFMNALPGHAFIKSPCGVITYVNSNNSLGDGLYAEDWIGKNEKDILYNLDPSDIIE
FT                   SDRKALESGFHNRVERIALDGGEERIYNILKFPIESENEGKQVGGIVFDITDRILAEES
FT                   LLRSEELSSILVSQMPVIVWTTDSDLKISYAVGNSLKNIGFTPESIRGFSFAEILREVA
FT                   DNLNAPVDETVDSYSAALHGESFVLESSFRGRELYIYVQPFRDKNGRITGTAGLAYDIT
FT                   DNKIAEKALLESEERYRRLVESIKVKIVIAQDERIVYANRCFFDFLGITPEHLDKTSFG
FT                   DLVCPEDLERVKNYHKGRISGEKDLPSNYRISCYSRDGELRLHDLTVSLITWNGKPATL
FT                   NILIDIEDENRTKEELEKSLHEKILLLEEVHHRVKNNLALINSLLMMQIRNIDHARVRE
FT                   GLLMARTRIFSIAAVHEGLYRSDSISSIPAKEHFKKIGEEILENYDPGHRLALEIDGDD
FT                   VELSLALATPISLVINELLINAIKYAYPGGEEGIISISLVNRGDSIELRLKDEGVGIPG
FT                   DFVLEDAKSLGLSLVRNIITSQLEGSISLDPGKGTEWIIEVPFES"
FT   gene            195417..199385
FT                   /locus_tag="Mpet_0181"
FT   CDS_pept        195417..199385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0181"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterProIPR001610:IPR000014:IPR003594:IPR005467:IPR
FT                   000700:IPR013767:IPR013655:IPR011495; KEGG: syn:slr1212
FT                   ethylene response sensor protein; PFAM: histidine kinase
FT                   dimerisation/phosphoacceptor; PAS fold-3 domain protein;
FT                   PAS fold domain protein; ATP-binding region ATPase domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   PAS domain containing protein; PAC repeat-containing
FT                   protein; SPTR: PAS fold family; TIGRFAM: PAS sensor
FT                   protein; PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; PAS fold; TIGRFAM: PAS
FT                   domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34959"
FT                   /db_xref="GOA:E1REL2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1REL2"
FT                   /protein_id="ADN34959.1"
FT                   /translation="MDFAILLRQKQLFWLSIIALISFFMSEVVIFMLSGESFIVISQVI
FT                   FFLIVLISLLVPEKSLIINVFIGFIYLIFSALSAGPDFYELVPSMVQFYVFISMSIIIS
FT                   RIILEVRYNEKKYYGLLENTTRGICIYDSEERSLVEKNHAFVYDPSIFFERARSVNPDF
FT                   FGARIENAGKSSTFEIEYESADGEKLELLVFAERLFERYILFIVTDITESKRNVENSQI
FT                   VSSLSNALLRGSNIGASSSFTSYAARNISDTCWVGIYLLNDEKNAYRLVSSHNLPEPFE
FT                   KSFSTIDLGDRIGELIAGGDTVEIDSAALGIVPAEEEPHLQRSVLIVPVYMTNKPIGCI
FT                   FAVTDKGKKFSESSKNSLNSIAHIFGSALKRINAEKEIIIAKSNLESLFESLDDFIFIY
FT                   DNEGGIIHTNSTVSGKLGYTTRQLEEMNVAAIHSSPSFEVFDREIRSRISDKSITMPFN
FT                   LVKSNGEKIPVEMKAVVGKWGDSEVFFVIDRDVTLRKKHEDEIRSRDAILDAVSIIAEN
FT                   FLRADAGADNISESLERLGKAADVASVCLFEVKWTLKDSYSPENVYKWVNDDNAFVPNV
FT                   ESLIRLSVFQEWRGMTTCPPEMDKVVYLDIESVSGEDRKIFETLNIKTLIAVILTVDGS
FT                   FRGVMCLVESVKRIWSDIETEAIMIAGDIISSAIGRAETDEIFRIPIERSLVGVYHIQN
FT                   FTFKYVNPKLAEIFGYTREEMLGDLNLVELVHPDYRQLLIDTVQSFKSSAIDGNGGTGG
FT                   NIPDFHIDARGIKKDGTLNDVEIYGSMMLHSGKFSFIGMVMDITQRKEAERKLYESSEM
FT                   LDLALKSTKLGIYDWNLRDDKLFYSDALFTMLGYSPEDYEEGRMSFDAIIHPDDKDEKK
FT                   RKLRAHLEGKTPYYETEYRLRTKDGEWRWIAARGEVFERDSSGKAVRITGTHLDITERK
FT                   NAEEKISHLNRVLKAVRNVNELIVRETDINNLINGASKLLVETRGYLDAWVILTDRYGS
FT                   YLDSAGSGDREDVAEIIRKTKSGNPPKILVETLRTTEIVSLSRLMYPEGDPADEGELLC
FT                   RRLDYGENVFGVVFGVIIISIPSGLSEDQEELGLFNELASDISFAIHDILLQNERKSYE
FT                   EQILSSLEEKTVLLQEVHHRVKNNLQIISGLIKMQSRNVEDPSARDSLLRCENRIMAIA
FT                   MVHEALYRSESLSDIHAREHFINLAQSLIDSLSFTEYKDIKLKTDIEIISLPINIAIPC
FT                   SLIINEIISNAIKYAFTGRDSGEISLVFRSEDENYYLEVSDNGVGVPDDFDLDRSKSLG
FT                   MRLVRRLAVEQLRGTAEIITGEGTRFIFIFPKHPEQGK"
FT   gene            199382..199783
FT                   /locus_tag="Mpet_0182"
FT   CDS_pept        199382..199783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0182"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789; KEGG: mhu:Mhun_1724 response regulator
FT                   receiver domain-containing protein; PFAM: response
FT                   regulator receiver; SMART: response regulator receiver;
FT                   SPTR: Response regulator receiver domain protein
FT                   (CheY-like); PFAM: Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34960"
FT                   /db_xref="GOA:E1REL3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1REL3"
FT                   /protein_id="ADN34960.1"
FT                   /translation="MILLAEDKKRILVVEDEGIVAMTLEDSLFNLGYEVAGTADDSRSA
FT                   IELAEKEKPDLILMDIRLRGDIDGIETVERINEKMDVPVIFLTAHSDEETLSRMLKTRP
FT                   YGFLVKPFREKELYANIEAAIARHRLSKK"
FT   gene            199945..201012
FT                   /locus_tag="Mpet_0183"
FT   CDS_pept        199945..201012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0183"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789; KEGG: mhu:Mhun_1724 response regulator
FT                   receiver domain-containing protein; PFAM: response
FT                   regulator receiver; SMART: response regulator receiver;
FT                   SPTR: Response regulator receiver domain protein
FT                   (CheY-like); PFAM: Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34961"
FT                   /db_xref="GOA:E1REL4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1REL4"
FT                   /protein_id="ADN34961.1"
FT                   /translation="MSGKRILVVEDEVMVAMTLEDTLEALGYEVAGTVDNGRDAIRLAA
FT                   EKKPDLILMDIRIRGDIDGIETADRISGSMDIPVVFLTAHSDEQTLMRALKTQPYGFLI
FT                   KPFRERELYSNIEMAIHKHRVLKTRNRDGGTEKESPSPYGTAVEAGPAISRLHEKETVE
FT                   VGTDTERLKNHVFESIQNPLFVLNGNMKIVLYNRKFAELCVFFNISESTFRASAEKAGI
FT                   FPLFGSTNDFMTTFTEGRENFSTLEVMTGEIGHTLKITKIPVKEGHMVAYVMAVIEDIT
FT                   YEKMLEDSGELYHKTAEGIINLSHELKGILKGHEDPRLNEIADTSDDLVLEFARTDEEW
FT                   LKIKEMRDLKKIWDL"
FT   gene            complement(201018..202271)
FT                   /locus_tag="Mpet_0184"
FT   CDS_pept        complement(201018..202271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0184"
FT                   /product="Arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="COGs: COG2235 Arginine deiminase; InterPro
FT                   IPR003876:IPR003198; KEGG: sro:Sros_5730 arginine
FT                   deiminase; PFAM: amidinotransferase; PRIAM: Arginine
FT                   deiminase; SPTR: Arginine deiminase; PFAM:
FT                   Amidinotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34962"
FT                   /db_xref="GOA:E1REL5"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:E1REL5"
FT                   /protein_id="ADN34962.1"
FT                   /translation="MKPGVYSEVGRLRTVIVHRPDMALRRLTPSNHDEYLFDELLWVDR
FT                   GIEEHDAFTKILEENGVEVLRLDRLLEETLRSGDAREYILGGVFPGDAPGVSIAGRLKD
FT                   ALMEEEPEILAGYLTGGLAVDEMEIPGMSGIKSRSLVAAAAGPDSYILPPLPNTLFSRD
FT                   PSSWIFGGVTINPMYWHVRRREALNVSAIYRYHPEFSKSSFECWHPKGDLAGVPPPGYG
FT                   RNTLEGGDIMPLKKGCVLAGISERTGSGMIENLASTLFAGDEAERIVACDIGRDRSHMH
FT                   LDTVFTMINEDTATAYPGVLEKSRTWSLFPGDVEGTFRIREEAGLVPAIEDALGIDALN
FT                   IIPTGGDRYEAEREQWDDGNNVLAVRPGVVVAYRRNARTNKSMEKEGIDVIEIEGCELS
FT                   RGRGGTHCMTCPVTRDGI"
FT   gene            complement(202268..203203)
FT                   /locus_tag="Mpet_0185"
FT   CDS_pept        complement(202268..203203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0185"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="COGs: COG0549 Carbamate kinase; InterPro
FT                   IPR003964:IPR001048; KEGG: smd:Smed_5204 carbamate kinase;
FT                   PFAM: aspartate/glutamate/uridylate kinase; PRIAM:
FT                   Carbamate kinase; SPTR: Carbamate kinase; TIGRFAM:
FT                   carbamate kinase; PFAM: Amino acid kinase family; TIGRFAM:
FT                   carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34963"
FT                   /db_xref="GOA:E1REL6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:E1REL6"
FT                   /protein_id="ADN34963.1"
FT                   /translation="MKERTVLVALGGNALLKRGESPDPAVQRENVRRAAEALAPLAKEY
FT                   KLVLTHGNGPQVGLLALQAAAYTKSKPYPLDILGAETEGMIGYLIEQELRNILPPDVPV
FT                   ATMLTMTAVDPSDTAFENPEKFVGPVYTKEQAGEVGNATGWTFRQDGFDWRRVVPSPEP
FT                   VKILEMKPIRWLIEKGAIVICTGGGGIPVVPSPGGGYSGIEAVIDKDLASAILAEELRA
FT                   DLFIMATDVEGVYLNWKEEDRELIGETTPRFLGENRHHFPPGSMGPKVDAACRFVEATG
FT                   NPAAIGSLEEIAEIAAGSAGTIVRRESETR"
FT   gene            complement(203205..204233)
FT                   /locus_tag="Mpet_0186"
FT   CDS_pept        complement(203205..204233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0186"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="COGs: COG0078 Ornithine carbamoyltransferase;
FT                   InterPro IPR002292:IPR006130:IPR006132:IPR006131; KEGG:
FT                   aha:AHA_4091 ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region; SPTR: Ornithine
FT                   carbamoyltransferase; TIGRFAM: ornithine
FT                   carbamoyltransferase; PFAM: Aspartate/ornithine
FT                   carbamoyltransferase, carbamoyl-P binding domain;
FT                   Aspartate/ornithine carbamoyltransferase, Asp/Orn binding
FT                   domain; TIGRFAM: ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34964"
FT                   /db_xref="GOA:E1REL7"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E1REL7"
FT                   /protein_id="ADN34964.1"
FT                   /translation="MTEKNMTKEIVRHKSFTKLLDFSGEEIINLVELAKQLKSARADGR
FT                   ETKHLSGKQIALIFEKASTRTRCSFEVAAREQGADVTYLGPEGSMIGYKESMKDTARVL
FT                   GRLYDAIEYRGFSQESVEILAEYSGVPVYNGLTDEFHPTQFLADIMTMVEHSGKDPKEI
FT                   SFCFTGDCRNNVAHSLMTGGAKLGMDVRICGPMSLMPDPDLTETCRRISEETGARLMLT
FT                   SDRREAVRGVDFIYTDVWVSMGEPFGKWQERIDLLLPYRVDMELIEATGNPKVRFMHCL
FT                   PSFHNRETELGEKIYEKYGLESLEVTDEVFESEYSVVFDQAENRMHTIKAIMVATLSGP
FT                   EK"
FT   gene            204377..204712
FT                   /locus_tag="Mpet_0187"
FT   CDS_pept        204377..204712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0187"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="COGs: COG1917 conserved hypothetical protein
FT                   contains double-stranded beta-helix domain; InterPro
FT                   IPR013096; KEGG: mhu:Mhun_0538 cupin 2, barrel; PFAM: Cupin
FT                   2 conserved barrel domain protein; SPTR: Cupin 2, conserved
FT                   barrel; PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34965"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E1REL8"
FT                   /protein_id="ADN34965.1"
FT                   /translation="MTDKNRNELKGKVMTIGDLVEYQPGTVSSRMVINNSAGSVTVFSF
FT                   DDGEEISEHTAPFDAMVTILEGECSVRLSGEFFLMKAGETIIFPANEPHAVSAVTKFKM
FT                   MLVMIKG"
FT   gene            204755..205036
FT                   /locus_tag="Mpet_0188"
FT   CDS_pept        204755..205036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0188"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="COGs: COG0760 Parvulin-like peptidyl-prolyl
FT                   isomerase; InterPro IPR000297; KEGG: mpl:Mpal_2106
FT                   PpiC-type peptidyl-prolyl cis-trans isomerase; PFAM:
FT                   PpiC-type peptidyl-prolyl cis-trans isomerase; SPTR:
FT                   PpiC-type peptidyl-prolyl cis-trans isomerase; PFAM:
FT                   PPIC-type PPIASE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34966"
FT                   /db_xref="GOA:E1REL9"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="UniProtKB/TrEMBL:E1REL9"
FT                   /protein_id="ADN34966.1"
FT                   /translation="MAKKVRASHILVNSEKEAKDILAKLNSGENFEELAKKYSTCPSGR
FT                   KGGDLGWFGKGMMVKEFEDASFSAKDGDVTGPVKTQFGYHIIKITGNK"
FT   gene            205143..206057
FT                   /locus_tag="Mpet_0189"
FT   CDS_pept        205143..206057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0189"
FT                   /product="DNA adenine methylase"
FT                   /note="COGs: COG0338 Site-specific DNA methylase; InterPro
FT                   IPR002294:IPR012326:IPR002052:IPR012327; KEGG:
FT                   mem:Memar_0517 DNA adenine methylase; PFAM: D12 class N6
FT                   adenine-specific DNA methyltransferase; SPTR: DNA adenine
FT                   methylase; TIGRFAM: DNA adenine methylase; PFAM: D12 class
FT                   N6 adenine-specific DNA methyltransferase; TIGRFAM: DNA
FT                   adenine methylase (dam)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34967"
FT                   /db_xref="GOA:E1REM0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1REM0"
FT                   /protein_id="ADN34967.1"
FT                   /translation="MADTVAKPFLKWAGGKTQLLDEFLKRIPPELKNGGITSFIEPFIG
FT                   GGAVFFNLNSIFSFEECHIFDSNEELVLAYNVVRKDAEDLIGCLEGMSREYLKLDSPGR
FT                   SEYFYSVRERFNKERSGINFKRYGKKWVPRAAQIIFLNRTCYNGLFRVNSKGSFNVPFG
FT                   RYKNPKIVNPDLLRADSEVLSNTKIHCGDFADSLKCIRDDSFVYFDPPYRPLSPTASFT
FT                   TYSRNGFDDCEQRRLASFFKKCDGKGARLILSNSDPKNIDPADDFFDALYSGFRIERVP
FT                   AKRMINSDGDKRGEISEILVMNY"
FT   gene            complement(206167..207543)
FT                   /locus_tag="Mpet_0190"
FT   CDS_pept        complement(206167..207543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0190"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR010916; KEGG: mac:MA0783 hypothetical
FT                   protein; SPTR: Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34968"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR027618"
FT                   /db_xref="UniProtKB/TrEMBL:E1REM1"
FT                   /protein_id="ADN34968.1"
FT                   /translation="MVCAICLVILIVAAYPCAAIKTPEPVVIAKSDSAKFNSIAFDNDT
FT                   VAWIEYGPNADNTTGSSLHKFDISTGRQETVIVDPSGKFSLDLSGSRYVWSDQRAIFLY
FT                   DEDEHVLKFLYSNNKQDNPVIDGDRVVWEEKTADQSFLRMYDISTGDYGDAVKGVGKDT
FT                   DCLLPAISGDRLVYISMEQGSSAIYLMLYNMTTGEKTNVARLPSTYQPPAIDGNLIVWA
FT                   ESYDEYYSVYMYDIEKQMTSVISPMTGYQMYPDISGDCVVWVYYGQKGEDLENGGSIYL
FT                   YDSKAGNASVISQEGERLDFPRVSGDYVVWTDRGENSNDIYLFGIPEEGQAISGGTQNS
FT                   SFLSNPTPFPTPDTKIRFYSSIKEGEVQWYSLTPSENESQISFELRWNDPDDELSLSVA
FT                   GPDGSIWCFSDEDDHNDDSCVRMTISGLSTAYSIKKKWTIAVSGESVSEDKAYYDVCWY
FT                   "
FT   sig_peptide     complement(207490..207543)
FT                   /locus_tag="Mpet_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(207565..209001)
FT                   /locus_tag="Mpet_0191"
FT   CDS_pept        complement(207565..209001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0191"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mem:Memar_2457 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34969"
FT                   /db_xref="GOA:E1REM2"
FT                   /db_xref="UniProtKB/TrEMBL:E1REM2"
FT                   /protein_id="ADN34969.1"
FT                   /translation="MGSEYHKKITGITIISLFILCCLALPAAAGDNFTIDPIPDQIIWD
FT                   DLLEITGTTSPGEEAIIGHYILEGYCADVKDVQGDPDPNQQTRGMSYSSFQGDKPTWGY
FT                   STTVSWRAPGDYTLVVWKRGDDQNKIAKNLRISYSTGNVKMVEVYEPGAKGPDLEQSEM
FT                   KENSFYYQTTYTTPNSGMNLVFRPDLVQTDGKLAKGESLSIEGNGVAGKNIMVWINRKS
FT                   SSSSANIYEKVKMLRTDERGKISSNNQLLSANETMELLSGKYNIYAVTGTEDELSEIEE
FT                   KISYFGEGYLKISEGNNPYQQFMLILEEPWINISGVADGYLPDAVSGSTVNFTGTTNLN
FT                   PGSQLALTIEPSSVPDSGEFATQITGIEVNEGDPNNWNAEYNTSSSGTGEFVATISNPG
FT                   GLAEATTVINIYDKTYSAGEVDKDSLLVESFTIDPETKDITTESPPSNNAGTVPTAVIM
FT                   FEAGLIFVIAVCAVVIYKKR"
FT   sig_peptide     complement(208915..209001)
FT                   /locus_tag="Mpet_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            209198..209989
FT                   /locus_tag="Mpet_0192"
FT   CDS_pept        209198..209989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0192"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COGs: COG3398 conserved hypothetical protein;
FT                   InterPro IPR001845:IPR000835; KEGG: mpl:Mpal_0760
FT                   transcriptional regulator, ArsR family; PFAM: regulatory
FT                   protein MarR; SMART: regulatory protein ArsR; SPTR:
FT                   Transcriptional regulator, ArsR family; PFAM: Bacterial
FT                   regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34970"
FT                   /db_xref="GOA:E1REM3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1REM3"
FT                   /protein_id="ADN34970.1"
FT                   /translation="MVRAMRVKKQNRISGVIYAAALLILVSSLISSAGATSMQYSVQNW
FT                   DEAPPVNEESKAPVPLDLWQVSPLVLAAVTLAMISPVMVLPAEIILGGIGLVALNFRRV
FT                   EVKTVLDHELRNGIYRHVLDNPGVCFTDIEKGLDVNRGTLDYHLKVLRREHRIAVLTKN
FT                   GRSFYFENSGRYTREEMEMLAILRNDTEFTICEYLLDSPGASRNEIVSLIKTTCSTVSW
FT                   HMKRLTDSGLVCSTKDGRIVSYHLSGPAKRIVEDISGSRCV"
FT   sig_peptide     209198..209296
FT                   /locus_tag="Mpet_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            210137..210565
FT                   /locus_tag="Mpet_0193"
FT   CDS_pept        210137..210565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cgt:cgR_0497 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34971"
FT                   /db_xref="GOA:E1REM4"
FT                   /db_xref="UniProtKB/TrEMBL:E1REM4"
FT                   /protein_id="ADN34971.1"
FT                   /translation="MKIESGTKFVIVVIVAVIIVVAAITALLSCMNMLPATGVKNPQDN
FT                   PSLDELNKALSDPEVVELLGNRNFTSIVFSKFENSPMEEDYTQIVFHPEDPDPEDRFFP
FT                   SMIVVKINESGQVFSAYETYPAYRQLVVGELFLIPEYQ"
FT   sig_peptide     210137..210250
FT                   /locus_tag="Mpet_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(210559..211446)
FT                   /locus_tag="Mpet_0194"
FT   CDS_pept        complement(210559..211446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_3623 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34972"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:E1REM5"
FT                   /protein_id="ADN34972.1"
FT                   /translation="MFSQAIQKAMKFTWPVVCSFSTIGGKTESPIGACVLLNDEGWIIT
FT                   VAHLFIPRFKFQQDQKNVEACNLEVDKINSDSKLNENQKRKKISKINKDGKWVTNFSDV
FT                   AFIDKNQYTVERVISNTQLDIAIAKLKDFKPQESVEYPVFKQPTEITPGRSVCKLGFPF
FT                   NSINSELVKTDGREFFRFLNNPFPMALFPIDGIATRTLKGEKTKDGFDNLFIETSSPGL
FT                   RGQSGGPIFDTNGVIWGIQSHTAHLPLGFSPKINRNGKEVEENQFINLGVGVHPVTISQ
FT                   FLERNGIKYQTADY"
FT   gene            complement(211570..211653)
FT                   /locus_tag="Mpet_R0005"
FT   tRNA            complement(211570..211653)
FT                   /locus_tag="Mpet_R0005"
FT                   /product="tRNA-Ser"
FT   gene            211864..212067
FT                   /locus_tag="Mpet_0195"
FT   CDS_pept        211864..212067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0195"
FT                   /product="thiamineS protein"
FT                   /note="KEGG: apo:Arcpr_0028 thiamineS protein; SPTR:
FT                   ThiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34973"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:E1REM6"
FT                   /protein_id="ADN34973.1"
FT                   /translation="MKCRVHFKRESKDIEYEFYEGEKLSEMLLSFGLIPDTVIILVDGR
FT                   PVPEDEYIAETGYVIMETASRG"
FT   gene            complement(212103..213017)
FT                   /locus_tag="Mpet_0196"
FT   CDS_pept        complement(212103..213017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0196"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="COGs: COG2113 ABC-type proline/glycine betaine
FT                   transport systems periplasmic components; InterPro
FT                   IPR007210; KEGG: mem:Memar_0992 substrate-binding region of
FT                   ABC-type glycine betaine transport system; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system; SPTR: Substrate-binding region of
FT                   ABC-type glycine betaine transport system; PFAM: Substrate
FT                   binding domain of ABC-type glycine betaine transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34974"
FT                   /db_xref="GOA:E1REM7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:E1REM7"
FT                   /protein_id="ADN34974.1"
FT                   /translation="MTGKFKAIGLIILVLFAFTLFAGCTGSDTGQTGEQTTTATATPTT
FT                   GTESKDEVSIGYVLWDSEIASTNVLKQAFEKAGYDVELYAVDAGPLYQALADGDVDCSV
FT                   SAWLPSTQANYWDTYGDDIDLVGRNMEGTKIGLVVPTYVTIDSIDEMNGVADKFDSTIT
FT                   GIEPGAGIMQNTEEAIDEYGLDYTLLSSSSAGMTAELAKAYKDEDWIVVTGWTPHWMFS
FT                   RYDLKYLEDPKGVYGGDEYIATLARQGLKEDKPGVYTILQNFNWTADDMSAVMLDIEGG
FT                   ASEDEAAAAWIEANEETVNGWIS"
FT   sig_peptide     complement(212952..213017)
FT                   /locus_tag="Mpet_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(213159..214013)
FT                   /locus_tag="Mpet_0197"
FT   CDS_pept        complement(213159..214013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0197"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG4176 ABC-type proline/glycine betaine
FT                   transport system permease component; InterPro IPR000515;
FT                   KEGG: mla:Mlab_1061 hypothetical protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34975"
FT                   /db_xref="GOA:E1REM8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1REM8"
FT                   /protein_id="ADN34975.1"
FT                   /translation="MAGDSYAIFPKIPLGEAVEYIVDWIDTYFGWLLDTIRFVLDVFIS
FT                   AIKDLLLFIPSFIIILILAAAGWYVSNKDWKMPVFIAAGLLLIQNLRLWPESMETLALV
FT                   ITSTFIALLIAIPTGITASRNDIFDRVLRPFLDFMQTMPSFVYLIPAVIFFALGDVPGV
FT                   IATVIFAMPPAIRLTNLGIRQIPKELNEVADSFGATPNQKLIKVQLPVAMPTIMAGVNQ
FT                   CIMLSLSMTVIASMIGAGGLGYNVLVGIQRVDIGMGFEAGLAIVIIAIILDRLSQNLIK
FT                   TTA"
FT   gene            complement(214016..215236)
FT                   /locus_tag="Mpet_0198"
FT   CDS_pept        complement(214016..215236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0198"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /EC_number="3.6.3.32"
FT                   /note="COGs: COG4175 ABC-type proline/glycine betaine
FT                   transport system ATPase component;
FT                   InterProIPR003593:IPR005892:IPR003439:IPR000644:IPR
FT                   018247:IPR017871; KEGG: mba:Mbar_A2376 glycine
FT                   betaine/L-proline ABC transporter, ATP-binding protein;
FT                   PFAM: ABC transporter related; CBS domain containing
FT                   protein; SMART: AAA ATPase; SPTR: Glycine betaine/L-proline
FT                   ABC transporter, ATP-binding protein; TIGRFAM: glycine
FT                   betaine/L-proline ABC transporter, ATPase subunit; PFAM:
FT                   ABC transporter; CBS domain; TIGRFAM: glycine
FT                   betaine/L-proline transport ATP binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34976"
FT                   /db_xref="GOA:E1REM9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1REM9"
FT                   /protein_id="ADN34976.1"
FT                   /translation="MDIPEEDNIGDNKKVKVEARSLVKIFGPRPEAALEMLERGRSKKE
FT                   IMEATQQNVALNNVSFEVYEGEIFVLMGLSGCGKSTLLRCLNRLVEPTSGEILVDGENI
FT                   REMNEEELREFRRNKIGMIFQGFALLPHRTVLDNVAFPLEIQGITVEERHRKAEKAISL
FT                   VGLEGYENSMPSELSGGMQQRVGLARALAGDCDILLMDEAFSALDPMIRREMQDELLDL
FT                   QDRVNKTIIFVSHDLDEALKLGDRIALMKDGGTVQVGTAEDILTNPETKYVEKFVEDVD
FT                   MTKVLSAKDVMKRPEPLVSVSSGPNNALHLMEEYGISSVFAVSKHRKYEGLVLVDDATE
FT                   AKKNGLGLEGIIKRDIPSVSPDTPVTEIIPLVAESGIPIPVLDDEQKIKGIIIKGSVLA
FT                   ALSRMEV"
FT   gene            complement(215573..216082)
FT                   /locus_tag="Mpet_0199"
FT   CDS_pept        complement(215573..216082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0199"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="COGs: COG0225 Peptide methionine sulfoxide
FT                   reductase; InterPro IPR002569; KEGG: mth:MTH535 methionine
FT                   sulfoxide reductase A; PFAM: Methionine sulfoxide reductase
FT                   A; PRIAM: Peptide-methionine (S)-S-oxide reductase; SPTR:
FT                   Peptide methionine sulfoxide reductase msrA; TIGRFAM:
FT                   peptide methionine sulfoxide reductase; PFAM: Peptide
FT                   methionine sulfoxide reductase; TIGRFAM:
FT                   methionine-S-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34977"
FT                   /db_xref="GOA:E1REN0"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:E1REN0"
FT                   /protein_id="ADN34977.1"
FT                   /translation="MSEETVVFAGGCFWHVEEAFGKVRGVIRTRVGYTGGKLDNPCYED
FT                   VCTGNTGHAEAVEVTFAPEAVSYRDLLKEFFNMHDPTTLNKQGPDVGTQYRSAIFCRDE
FT                   LQKNEAENFVRELEDESRFGGKEIVTEVVPLGKFWEAEEYHQKYLFKIRNQGVNPECRV
FT                   DLGKRE"
FT   gene            complement(216185..217498)
FT                   /locus_tag="Mpet_0200"
FT   CDS_pept        complement(216185..217498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1734 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34978"
FT                   /db_xref="GOA:E1REN1"
FT                   /db_xref="UniProtKB/TrEMBL:E1REN1"
FT                   /protein_id="ADN34978.1"
FT                   /translation="MHRNEFRTDVEEETGLGQDDNGGNNIEMKKEFFGDLSFEVVILFI
FT                   FGIFMLIFGTLLFRIHTGELPYTPDSTYGLFLVIVSLQIIALGRTPFGDIRRSWIVIII
FT                   GVCTTAAGMIACFIPGYLSDFVRILAGLMLFFGGISLLLQLFLADGKAKRWLAVPGVLR
FT                   HLTLACALVYIISAILGIITLLPGIAEDTLTAAILLVYGVCIFYLSFCLHRTNTIYPQE
FT                   EEKILSESAEKRTLLFSVAAIPLQVAIIIPVGFLLVLLGFLLVPVNLGMIPFSPDGQLG
FT                   LLMVVMAIQMMALGETPAGECRRSWLLMVIGVVFAGAGIFSCVVPGITTGILTELIGFL
FT                   NIAGGVILLLKRFGPVLLNRGKQGAENDPIPPVLKNLLIIQTILNFVSISFGASMFLPG
FT                   IIPGMAIAGILVLNGILIFALASAVLKIDRMQSAEITG"
FT   gene            217679..218473
FT                   /locus_tag="Mpet_0201"
FT   CDS_pept        217679..218473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0201"
FT                   /product="Acetoacetate decarboxylase"
FT                   /note="InterPro IPR010451; KEGG: mem:Memar_1128
FT                   hypothetical protein; PFAM: Acetoacetate decarboxylase;
FT                   SPTR: Putative uncharacterized protein; PFAM: Acetoacetate
FT                   decarboxylase (ADC)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34979"
FT                   /db_xref="GOA:E1REN2"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:E1REN2"
FT                   /protein_id="ADN34979.1"
FT                   /translation="MFRLQDDFTYLMPVHFGGGRFTPDRVVRQRTTTLAMTYETDRGLL
FT                   EQYIPEGFELISPEVQVIFSKFTEIDWMQGGQYNLVNVASPVRFSGQKDDLEGSYTLVV
FT                   WENRTAPILGGREQTGIPKIYADIEDLHILRPHYMTNASYEGSTFLNLEFEAEEEITGV
FT                   EMDAMRSGFSSVNAIGWRYIPKVGAPGAELSQFVLYPQGMKVEHAVAGKGSLKWTTLTP
FT                   MQNPAQYYIVNSLAALPVEKIKQSVLFEGETFLHAMGARVIE"
FT   gene            218506..219342
FT                   /locus_tag="Mpet_0202"
FT   CDS_pept        218506..219342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0202"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG4221 Short-chain alcohol dehydrogenase of
FT                   unknown specificity; InterPro IPR002347:IPR002198; KEGG:
FT                   mem:Memar_1129 short-chain dehydrogenase/reductase SDR;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   Short-chain dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34980"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1REN3"
FT                   /protein_id="ADN34980.1"
FT                   /translation="MVDSDHYRNRICIVTGANSGIGYAISAELLKRGAVVYMTGRSPDK
FT                   ISKAAEDFSSYGGNVRKLVMDVTKQEDVRKGIAHVAAEAGRIDLLFNNAGVGGTIPFEK
FT                   ATIEDWKKIIDTNIWSVIYGVSAAVPIMLKQGEGHIVNTSSIAGIVPPPFQALYSLTKY
FT                   GVTGMTECLKYEYAEKGLRFSTICPANIATPIFNKSIDGTAHGELRIPDDAYPADEAAS
FT                   LILDRVSENKGIIVVPEEPYTDMWKGYVLGESVVEDELYKMARQRREAFEKGGSYF"
FT   gene            219448..222048
FT                   /locus_tag="Mpet_0203"
FT   CDS_pept        219448..222048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0203"
FT                   /product="polymorphic outer membrane protein"
FT                   /note="InterPro IPR006626:IPR003368; KEGG: mbn:Mboo_0401
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein; TIGRFAM: polymorphic outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34981"
FT                   /db_xref="GOA:E1REN4"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR026453"
FT                   /db_xref="UniProtKB/TrEMBL:E1REN4"
FT                   /protein_id="ADN34981.1"
FT                   /translation="MGNELSEDTLAVSADCRLPGFNGRSGLYRFILTLILFLGLLVIAA
FT                   PVSAEVWTLNTTDSIEANISLASPGDTLILNPGTYQQYNITVSKNVTIMSNISAGGSAG
FT                   NTIIDAMNSGRIFYDNSTAGYTLTIEGLTLTNGSLSDEEGGAICTTNGSVEISSSVITD
FT                   CSALTLGNGGAIYSSSGNVIATSCTFNDCFSNTGGAICAAVVNTTSCSFTRCGSSVCLG
FT                   GAISSDDVTAISCSFTGCFAWSGGGIFSDAVTVRSCNFTDCAAYTSTGIGGGISSDDVV
FT                   AESCSFINCSSKGDGGGIYSNTTSVVFCDFTDCKAVYDGGGISSLDATVTSCSFTSCYG
FT                   TGGYSYGGGICSNYDAGGTFLISSSSFTGCRASAGGGLYSELSTVTVISCTFINCRGID
FT                   SGGAILSMDNNYLTISSCTFTGCSALNYAGAILSDTDYTTYATITSSDFTNCSAENMYG
FT                   GVIYANYSISAIHYCRIYDCNGGTAVVMEDGTMDAENNWWGTNSDPSGYTKALSGGPVD
FT                   VSPWLVLGTAPSPSSITAGDSSIVSADLTRNSADEDTSPGGYVPDGIPVTFTLAGGPGS
FT                   LSSLSGATVSGVSATTYSSSSPGTATIAATVDNQIANCTVQVNSGGGSSSGGSGGSNTD
FT                   TGIGFAEDLKAGENVSLEMNKGAVYRVDLTAKTDIEKLMITVRKDSSVPSSVGEPDWDV
FT                   YEYEEVTLYYADESDLSDLMFYFKVKKSWPASNGYGYGDVLMLRFNEETDEWEELTTTF
FT                   TGEDGTYYYYSAETPSFSWFAIAVSEDATIIPEGTETEVATQAATSVNTPSSSVATAVS
FT                   TTSPGNSSIAEGEKSLTSLAIPALAVILVIIAVIGLVSRKKKDEYPDWWDHGRR"
FT   gene            complement(222104..223693)
FT                   /locus_tag="Mpet_0204"
FT   CDS_pept        complement(222104..223693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0204"
FT                   /product="chaperonin Cpn60/TCP-1"
FT                   /note="COGs: COG0459 Chaperonin GroEL (HSP60 family);
FT                   InterPro IPR017998:IPR002194:IPR002423; KEGG:
FT                   mem:Memar_0271 chaperonin Cpn60/TCP-1; PFAM: chaperonin
FT                   Cpn60/TCP-1; SPTR: Chaperonin Cpn60/TCP-1; PFAM:
FT                   TCP-1/cpn60 chaperonin family; TIGRFAM: thermosome, various
FT                   subunits, archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34982"
FT                   /db_xref="GOA:E1REN5"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:E1REN5"
FT                   /protein_id="ADN34982.1"
FT                   /translation="MLAGQPIIILRDNVDVTSGREAQHSNIMACKAIASAVRTTLGPRG
FT                   MDKMLVSPSGDVVITNDGATILHEISVEHPAAKMMISVAEAQDDEVGDGTTTSCILIGE
FT                   LMEEAERLFAKKIHPTVIANGYTLAMEKALEILNENAIESKGEDRELLVKVANTAVTGK
FT                   SIEMMKDKISSIVVDAVLAVAEKDENGKYAIDEDDVKIKTVVGDSLEEAELLSGFMIDK
FT                   TRCDEGMPKKVTNAKVALLAQPLEIKKTETKSKIKITTSEQMEAFSDSEKAKLKEYADL
FT                   IVASGANVVLCQKGIADAVQYHLSHAGILAIQDVPEKDMKSFSRALHGTIVNSVKDLDE
FT                   SVFGNAESVEEMKDIKATKFTGCKNGKIVTILLKGSNQIFVDELERAAYDAARVVMDAL
FT                   EDGKYVVGAGAIDAELCLGLRSYAATVGGRTQLAIDAFANIFEAIPNTLAENSGLDPID
FT                   ILVDLKSAHANGEKYAGINVFTGKIVNMYDDGVIEPMRVKRQAIQSAAETAALLIRVDD
FT                   MMVSKSAAQMNR"
FT   gene            complement(223841..224311)
FT                   /locus_tag="Mpet_0205"
FT   CDS_pept        complement(223841..224311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0205"
FT                   /product="CheW protein"
FT                   /note="COGs: COG0835 Chemotaxis signal transduction
FT                   protein; InterPro IPR002545; KEGG: mbn:Mboo_1579 putative
FT                   CheW protein; PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; SPTR: Putative CheW protein; PFAM: CheW-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34983"
FT                   /db_xref="GOA:E1REN6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:E1REN6"
FT                   /protein_id="ADN34983.1"
FT                   /translation="MALIDVVVFEIGGTLYALDIHLAREIVEMMPITPVPRAPPHIAGI
FT                   INLRGEITNILNLNRILNLPEHENEETQKIIVLMPDASGGSNVGIIVDNVRSVIQVEEE
FT                   NIDSMDNSFSKEAFVKGIIKEKTEESGAAGKTDLIIWLDMNLILAGLNIENL"
FT   gene            complement(224328..224951)
FT                   /locus_tag="Mpet_0206"
FT   CDS_pept        complement(224328..224951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0206"
FT                   /product="phosphoribosyltransferase"
FT                   /note="COGs: COG0856 Orotate phosphoribosyltransferase
FT                   homologs; InterPro IPR000836; KEGG: mbn:Mboo_2394 orotate
FT                   phosphoribosyltransferase-like protein; PFAM:
FT                   phosphoribosyltransferase; SPTR: PyrE-like protein; PFAM:
FT                   Phosphoribosyl transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34984"
FT                   /db_xref="GOA:E1REN7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR022854"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E1REN7"
FT                   /protein_id="ADN34984.1"
FT                   /translation="MSSLDELISKARLLHSEGRSTSQISDELSLSAETVTWLLTREKSG
FT                   GDVPRDVLIDWSSISCDSNNLCLAASMMAQRFYFAREQAGLSEEEGSGFPDVVIGIAHS
FT                   GIPLATLIAGNEGAMFAMYHPKKHAQGDSPSGSLNSSFAGVSNRSCLIVDDVVTTGNTI
FT                   TEAIEYIRKHGGEPVGILVLFDKRGLKEIGGVPLYSLVKVERID"
FT   gene            complement(224973..225434)
FT                   /locus_tag="Mpet_0207"
FT   CDS_pept        complement(224973..225434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0207"
FT                   /product="Nucleotide binding protein PINc"
FT                   /note="COGs: COG1439 nucleic acid-binding protein consists
FT                   of a PIN domain and a Zn-ribbon module; InterPro IPR006596;
FT                   KEGG: mhu:Mhun_0974 nucleic acid binding protein; SMART:
FT                   Nucleotide binding protein PINc; SPTR: Nucleic acid-binding
FT                   protein, containing PIN domain and zinc-ribbon module;
FT                   PFAM: UPF0278 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34985"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:E1REN8"
FT                   /protein_id="ADN34985.1"
FT                   /translation="MKRKIVTDSTFFFTDLPLDGDLIVPSAVFEELKDLNSKMRFEKYR
FT                   ESGLIVTGPDRKSVEEVKKAATKSGDISVLSATDIDVAALAYETGAAVATDDFALSNTA
FT                   QHMGIEVIPLQQRAAKKKKWRYRCTGCGRYYSEPGICEVCGLEIKRKVK"
FT   gene            complement(225431..226282)
FT                   /locus_tag="Mpet_0208"
FT   CDS_pept        complement(225431..226282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0208"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="COGs: COG0462 Phosphoribosylpyrophosphate
FT                   synthetase; InterPro IPR005946:IPR000836; KEGG:
FT                   mem:Memar_0275 ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase; PRIAM: Ribose-phosphate
FT                   diphosphokinase; SPTR: Ribose-phosphate pyrophosphokinase;
FT                   TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   Phosphoribosyl transferase domain; TIGRFAM:
FT                   ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34986"
FT                   /db_xref="GOA:E1REN9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037514"
FT                   /db_xref="UniProtKB/TrEMBL:E1REN9"
FT                   /protein_id="ADN34986.1"
FT                   /translation="MKIIGAEHSQVLAAKTAHILGAELLSAEFRSFPDGELYVRADAPA
FT                   EDLVIIGSITNSDSLIQLLLLIDACEEADSLSLVIPYMGYARQDKKFRPGEPISARAVA
FT                   LALSQGIDRVYTINIHENTVLDHFEVPAENISIAERISDYIRSMKPGNPLILAPDEGAA
FT                   DFASDVASFGGFEHDHLQKIRLSGTEVNIAPKNMDANGRTVFIVDDIISTGGTLATAAG
FT                   MLKEQGAAEVHAACVHGVFTNGGYARLAAAGIKSVAASDTIESGASSFSAAESISAALR
FT                   GR"
FT   gene            226365..228446
FT                   /locus_tag="Mpet_0209"
FT   CDS_pept        226365..228446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0209"
FT                   /product="peptidase S16, Lon-like protease"
FT                   /note="COGs: COG1067 ATP-dependent protease;
FT                   InterProIPR003593:IPR001984:IPR004663:IPR000523:IPR 008269;
FT                   KEGG: mbn:Mboo_2391 ATP-dependent protease Lon; PFAM:
FT                   peptidase S16 lon domain protein; magnesium chelatase ChlI
FT                   subunit; SMART: AAA ATPase; SPTR: Peptidase S16, Lon-like
FT                   protease; TIGRFAM: peptidase S16, Lon-like protease; PFAM:
FT                   Magnesium chelatase, subunit ChlI; Sigma-54 interaction
FT                   domain; Lon protease (S16) C-terminal proteolytic domain;
FT                   TIGRFAM: lon-related putative ATP-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34987"
FT                   /db_xref="GOA:E1REP0"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004663"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041699"
FT                   /db_xref="UniProtKB/TrEMBL:E1REP0"
FT                   /protein_id="ADN34987.1"
FT                   /translation="MNNEDTINENIDKPEDIVESPVNETPSAPEDAGFTADPGKPGEGP
FT                   KLIAADTGDHSTEDAGQPGIKTEEIDLDTLNSSSEIEVPKRLIDQVIGQDHAVEVIKKA
FT                   AIQRRHVMMIGTPGTGKSMLAKAMAELLPKEDLQDILVYPNSDDSNTPIVRTVKAGRGK
FT                   EIVNAHKAEAKKRAQTRNTMIMLLVFGIMGYAIITGQLLMGIIGAAFIFMALQYTRPKE
FT                   EAMVPKLLVSSQKEGNAPYVDGTGAHAGALLGDVRHDPFQSGGLETPAHDRVEAGAIHK
FT                   ANKGVLFIDEINTLTPHSQQNLLTALQEGEFPITGQSERSSGAMVKTEPVPCRFVMIAA
FT                   GNVDAIEGMHPALRSRIRGYGYELFMQDSMPDTEENQKKFIRFIAQEVKNDGKIPPFDK
FT                   GAIEEIMREARRRSNRKGHITLKLRDMGGLIRVAGDMARQDDSEITTAEHVLKAKEIAR
FT                   SVEDQISGEITQRSREYELTVVSGSEIGRVNGLAVVGHDSGQVLPIMAEATPTQSKVGG
FT                   EVIATGLLKEIAQESIKNISAIIKKLTQKDIKDMDIHIQFIGTYNGVEGDSASVSVATA
FT                   VISAIEGIPVRQDVAMTGSLSVRGNVLPIGGVTYKIEAAAKAGITTIIIPESNLADVLI
FT                   EDRYKEMVTIIPVKKFEDVLDIALVPEKKKDFMERVKELAKITPSEINIKAPPKPLHG"
FT   gene            228509..229837
FT                   /locus_tag="Mpet_0210"
FT   CDS_pept        228509..229837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0210"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="COGs: COG0312 Zn-dependent protease and their
FT                   inactivated homologs; InterPro IPR002510; KEGG:
FT                   mpl:Mpal_2693 peptidase U62 modulator of DNA gyrase; PFAM:
FT                   peptidase U62 modulator of DNA gyrase; SPTR: Peptidase U62
FT                   modulator of DNA gyrase; PFAM: Putative modulator of DNA
FT                   gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34988"
FT                   /db_xref="GOA:E1REP1"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:E1REP1"
FT                   /protein_id="ADN34988.1"
FT                   /translation="MEEPRYYDIRHVSGVSTHIDIENGRIDSAGSSFYDVALLRVLGKK
FT                   GWGLVSIENFSGKTKKDIEGFIREAMRYASVTEEEVILGDAPSGLLDVPKIENNPADVS
FT                   LEEKCDLLRAIESSARIDGIVSTRAGYVEGSSTVYFTDSCGNEYSYPVCRSGYGINAIA
FT                   GRNGNMQAARESERTIAGLNMYHKEHKGMEAAERALKLLEAAPAKGGIMNAVLDQELAG
FT                   VFAHEAVGHASEGDLVKEGVSVLKGRIGEKIGDSALSVTDDPTLHEFGFMPLDAEGVRP
FT                   KKTAIIKKGVLNSYIHNRQTLALIGDGDAGHARAEGGAVPQVRMSNTFIENGDSTYDEI
FT                   VAECRNGVLLKGSRGGQVDPGRGVFQFNAEYGYVIENGELAGMIRDVSLSGDILKTMHN
FT                   IVLCGNDLRLNQGYCGKGGQSVPVTDGSPHVLLKDAVVGGQGV"
FT   gene            229830..231125
FT                   /locus_tag="Mpet_0211"
FT   CDS_pept        229830..231125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0211"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="COGs: COG0312 Zn-dependent protease and their
FT                   inactivated homologs; InterPro IPR002510; KEGG:
FT                   mem:Memar_0278 peptidase U62, modulator of DNA gyrase;
FT                   PFAM: peptidase U62 modulator of DNA gyrase; SPTR:
FT                   Peptidase U62, modulator of DNA gyrase; PFAM: Putative
FT                   modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34989"
FT                   /db_xref="GOA:E1REP2"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:E1REP2"
FT                   /protein_id="ADN34989.1"
FT                   /translation="MSEFDSDSIIDDIIRKGQKIADEVEVAYESGKSIHATLKGREIGE
FT                   AGVSDSWVFCIRIIDGGKIGCSTTNDPARWEKCLEAAKAGSKFAAGQDWEGLPGPSATN
FT                   GTPESVFDEKLALDSSLISGYIEDLLNGASEYSVDVAGGGASASASSYKLANSAGLVYE
FT                   GARTRIGVSLETISGTSTGYESDIVCFADRINPYDVGKQAAYLAAHSVGAGEIDTGTYD
FT                   VVLSPIAASQLIGGIVVPALSGKNVKAGRSYFADKLGEQCLDESFTLRDDPFHGQGSWV
FT                   RDAEGVPTRVLDLIKDGVVNEFSYDLKTAYRYGEKSTGSAVRSGDSPSIGFHNLYFEGE
FT                   RQDIFDEKVLYVHDVIGAHTANGITGDFSVETSNSTWREGGEDTDAVRAAMLSGNVFEM
FT                   LKSIAGVSKEPRELGNVIMPSVRFNNLRVVGK"
FT   gene            231128..231382
FT                   /locus_tag="Mpet_0212"
FT   CDS_pept        231128..231382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0820 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34990"
FT                   /db_xref="GOA:E1REP3"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:E1REP3"
FT                   /protein_id="ADN34990.1"
FT                   /translation="MIDTLITVLIAAGIVIVLWYFLKNVTTLIVNSIVGIVTIVIISQL
FT                   NILGMESFKLTWGAVLVCALGGLPGAILLIVLNFAGISI"
FT   gene            231532..232200
FT                   /locus_tag="Mpet_0213"
FT   CDS_pept        231532..232200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hla:Hlac_0527 chromosome segregation protein
FT                   SMC; SPTR: Chromosome segregation protein SMC"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34991"
FT                   /db_xref="UniProtKB/TrEMBL:E1REP4"
FT                   /protein_id="ADN34991.1"
FT                   /translation="MPFNEKKKNSVNNQGLVVVLILLVIVISVSSGCLDSISKRAEITR
FT                   QLEQAEPLMENVESEIADMNVYLSDPGNSDPVEVQSRLAVLKSDMNEINTIMAGIDRSA
FT                   LTESEREDLDAGLFAMEYMSDFIDSVSVRLPEMLRIANNMEDAAEAHNVQRARSAMHDM
FT                   HDLIESFLSDLDVLEEKLVEKQANSDSEKMNEFCSQNLAQIRDWKSQFKTLQKEIDEVL
FT                   "
FT   sig_peptide     231532..231627
FT                   /locus_tag="Mpet_0213"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(232234..232566)
FT                   /locus_tag="Mpet_0214"
FT   CDS_pept        complement(232234..232566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0214"
FT                   /product="protein of unknown function DUF86"
FT                   /note="COGs: COG2361 conserved hypothetical protein;
FT                   InterPro IPR008201; KEGG: lch:Lcho_0358 hypothetical
FT                   protein; PFAM: protein of unknown function DUF86; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34992"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:E1REP5"
FT                   /protein_id="ADN34992.1"
FT                   /translation="MERNDRIYVLHAVDAAEKALEISGRIQRKDLDSDEIYGLALIRLL
FT                   EIIGEAANLVSADFQEKYPAIPWKHMISMRNRLIHGYFDINYDIVWDTVKNDLPPLIKS
FT                   LKQALK"
FT   gene            complement(232556..232861)
FT                   /locus_tag="Mpet_0215"
FT   CDS_pept        complement(232556..232861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0215"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="COGs: COG1669 nucleotidyltransferase; InterPro
FT                   IPR002934; KEGG: chl:Chy400_2264 DNA polymerase beta domain
FT                   protein region; PFAM: DNA polymerase beta domain protein
FT                   region; SPTR: Putative uncharacterized protein; PFAM:
FT                   Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34993"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:E1REP6"
FT                   /protein_id="ADN34993.1"
FT                   /translation="MNESNLKVPKKKIAEFCKRNHIRRFALFGSVLRDDFGPDSDVDIL
FT                   VEFEDNHTPGLFKIFDLEEELSVIFGNRKIDLRTPGDLSRYFRAEVISNSEVCYGT"
FT   gene            complement(232988..233869)
FT                   /locus_tag="Mpet_0216"
FT   CDS_pept        complement(232988..233869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpl:Mpal_0166 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34994"
FT                   /db_xref="GOA:E1REP7"
FT                   /db_xref="UniProtKB/TrEMBL:E1REP7"
FT                   /protein_id="ADN34994.1"
FT                   /translation="MTGRISRGWRLFKATFAILKAEKSLALFPVISAILSLLVLVVFIF
FT                   PALMIFSSTGADTESWGATQYAMWIVFLFAFYFVIYLITIFFKGAVISNATEVMKGNNP
FT                   TMGQGIGASASHIGKLAVWALIQATIGLILSMIRNRDNIVATIISSLIAAAWELVTFFV
FT                   IPILIFEEQGIPGSIKESWNLFKKTWGETVVSGFSFVLIYIPAFILFFLAIGSIALGIQ
FT                   TVTIAAFGLFLIVLLSTAVLASTLHGILVALLYNFAKTGEIPDMIDRDLIENAFVESKK
FT                   KKTPAYSGGGNI"
FT   sig_peptide     complement(233705..233869)
FT                   /locus_tag="Mpet_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(234327..235025)
FT                   /locus_tag="Mpet_0217"
FT   CDS_pept        complement(234327..235025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0217"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /note="COGs: COG0467 RecA-superfamily ATPase implicated in
FT                   signal transduction;
FT                   InterProIPR003593:IPR004504:IPR010624:IPR014774:IPR 015140;
FT                   KEGG: mpl:Mpal_2689 putative circadian clock protein, KaiC;
FT                   PFAM: Circadian clock protein KaiC central region; KaiA
FT                   binding; SMART: AAA ATPase; SPTR: Putative circadian clock
FT                   protein, KaiC; PFAM: KaiC"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34995"
FT                   /db_xref="GOA:E1REP8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR022420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1REP8"
FT                   /protein_id="ADN34995.1"
FT                   /translation="MKKNRVRMGIDGLDEMMDGGLIEGSICSIIGTYGTGKTTFALQFA
FT                   YDGLKNNETVVYISLEEKKESIYEKIEDRGFELEKYRDLTLFVIKLDPTDFNLSINSIR
FT                   NELPELIYEIGAKRVIVDPISLFEGLFDDESQRRLEMFRLVEILRDLKCTVLMTSEHNR
FT                   NDAYASRYGLIEYLADTVVVLKYIRPDDLAEVHTAVEVVKMRSSNHSREIKPYEIEEDE
FT                   INVYSEASVF"
FT   gene            complement(235022..235852)
FT                   /locus_tag="Mpet_0218"
FT   CDS_pept        complement(235022..235852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0218"
FT                   /product="HTR-like protein"
FT                   /note="COGs: COG0467 RecA-superfamily ATPase implicated in
FT                   signal transduction; KEGG: mpl:Mpal_2688 HTR-like protein;
FT                   SPTR: HTR-like protein; PFAM: KaiC"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34996"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1REP9"
FT                   /protein_id="ADN34996.1"
FT                   /translation="MNDNLNERMPTGISSLDPVLDGGVPPGSVVLLIGEQGAGNREFVQ
FT                   SSMIYLSKMKAAGQNGDNRILPEQMVYVSFTRLTSSIIDEIKISYKKDLVAGIEENISF
FT                   IDLSNFYFEKSVVPRGWYSHTSLLTEKEKGKVSDSLVAELTNSLRKIKNKSLIIIDSLT
FT                   DLNTTINNPDEWNQLIEFLRGLQRVAKTWRTTIYILVSEGIFERSKLMEVADCCDAIVD
FT                   FRWEETTGRKRQRIMYFVKFDGAMPHLEENDLVKFASKITTEAGFEVSNIRVVI"
FT   gene            236047..238308
FT                   /locus_tag="Mpet_0219"
FT   CDS_pept        236047..238308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0219"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG0630 Type IV secretory pathway VirB11
FT                   protein involved in flagella biosynthesis; InterPro
FT                   IPR001482; KEGG: mpl:Mpal_2687 type II secretion system
FT                   protein E; PFAM: type II secretion system protein E; SPTR:
FT                   Type II secretion system protein E; PFAM: Type II/IV
FT                   secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34997"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1REQ0"
FT                   /protein_id="ADN34997.1"
FT                   /translation="MPFPGFHKKKKTDPSVGKEPEEPKLEDILKKINGVNDAGKEENKE
FT                   PADLPDKPNIEDIIKNIKRADDAGKEEGSEPAGTPEPDSLSSSIAEEAPVPASEEPRES
FT                   VEVTAHEEPEERVISAEDSVEPVGSVEGTAPEIPGVSVVLIEDSTDPELIQEHPEEPEK
FT                   DEITEKEEIGNIEEPSDQPVREPVKEREEEWPESVEKAETTGKDEGGGEDLSYIKKKKK
FT                   TTKARIQDEKKGLLLKKKIEKIRLYDFGTDGPLVDPILPEGYVLRDEYWIHEGRSKVLI
FT                   AKSPENHLEEYLLYEPKLSSFERELAERLYEDMRDVLILTDEEILEDRESVLMDKMNYL
FT                   LHEYKVKIEDDALFKLQYYLLRNFLGWSKLDSLMFDPNIEDISCDGSDIPLFLYHRKFR
FT                   NIKTNISFDEDTLYSLAILLAQRSGKHISVSQPMLDATLPDGSRLQLTLGKVVTSRGTS
FT                   FTIRKFREEPFTPIELIDYGTFNVDQLVYFWLAIENNKSLLFVGGTASGKTTSLNAVSL
FT                   FIPPLSKVVSIEDTREITLFHDNWLATVTREAVVETSGAKVDMFDLLKAAMRQRPEYIL
FT                   VGEVRGVEAQTLFQAMNTGHTTFSTLHANSVDAAIHRLENPPLNVPRNMVQALDIVSIQ
FT                   ALVYRGQDRVRRAMEIVEIAGIDPGTGNLRVNTVFEYDPVKDIHTYSGRSQVYSKILEM
FT                   RGWSREEMNEEIEKRRRIIQAMHDQGIIDYINVTKIFQAYFINSSNVLENIGDLKKAFL
FT                   "
FT   gene            238305..240245
FT                   /locus_tag="Mpet_0220"
FT   CDS_pept        238305..240245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0220"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="COGs: COG1955 flagella assembly protein J; InterPro
FT                   IPR018076; KEGG: mbn:Mboo_2354 type II secretion system
FT                   protein; PFAM: Type II secretion system F domain; SPTR:
FT                   Type II secretion system protein; PFAM: Bacterial type II
FT                   secretion system protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34998"
FT                   /db_xref="GOA:E1REQ1"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E1REQ1"
FT                   /protein_id="ADN34998.1"
FT                   /translation="MIVDRYVSWKLKRNPDAFMQLHADLISARMGITLNRFLQICLISA
FT                   LLAGFSAGIAAALFASLIYIPRVSIQIYNVFNLQLPSYYIPQLNQTNFAILAFFVIFIL
FT                   LSFISYHVMIRYPSIKKASRTTKINLSLHNAVSYMFAMRRGGAEMLDIFRSMSENAVVY
FT                   GEVAIEFRQVLRDAEYFGHDLISALENLSMTTPSEKLKDFLEDLVSVTGSGGNISEYLE
FT                   GRVRMYQEEARFEQLQFLSTLQIVAEAYVTVFVAGPLFLVIIMVVMGMVGSSAVLEFAL
FT                   VTYVLLPIGAVIFILFIDMMSLSDEVAERYTRITEMKQFIDVPIEDKEDDVRNYKALDW
FT                   YDRLKAIRGFLTSPFDWFIVNANRTLYFTVPLALIYIIAVYLVTPQYSDTELYIAVVDD
FT                   HVIIAMLIVILPYAVFFEFWRRKLKSIESSIPDFLERLSGINRVGLTIAGAINVLVKAN
FT                   LGLISYEIRRIKRDLEWGASVNDALIRFEERVNTAAIARTVTLITKASEMTGDIGEVLG
FT                   IASADARMSETLKKERQGEMFIYTVIIYLAFFVFIFVVAVLNTNFLEILEQLSNMTTSS
FT                   GSSIAGASEFSMAANMDVDVFRRLLYHTCLIQAIFSGIIAGQMGEGMVKSGIKHAGIML
FT                   IIALVIFNLFI"
FT   gene            240456..241043
FT                   /locus_tag="Mpet_0221"
FT   CDS_pept        240456..241043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0221"
FT                   /product="flagellin"
FT                   /note="COGs: COG1681 flagellin; InterPro
FT                   IPR013373:IPR002774; KEGG: mpl:Mpal_2391 flagellin; PFAM:
FT                   flagellin; SPTR: Flagellin; PFAM: Archaebacterial
FT                   flagellin; TIGRFAM: archaeal flagellin N-terminal-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADN34999"
FT                   /db_xref="GOA:E1REQ2"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:E1REQ2"
FT                   /protein_id="ADN34999.1"
FT                   /translation="MLRLQERCEGFTGLEAAIVLIAFIVVASVFAFSVIGAGYFATQQT
FT                   QSTAYTALQQTGSTLEILGYVHGIKRADDEIGAIQFNVGLAPGGKYIDFSKMVLTWTTR
FT                   DEIRTYDANEPLYNTTIDEGKWGIMGIKPTDATGDTVLEPGETYTIYVNLTSGEELGPG
FT                   DEFSLELTSTSAMSLIISRSAPWQIDNINTLY"
FT   gene            241067..241966
FT                   /locus_tag="Mpet_0222"
FT   CDS_pept        241067..241966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0222"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="COGs: COG0053 Co/Zn/Cd cation transporter; InterPro
FT                   IPR002524; KEGG: mem:Memar_0526 cation diffusion
FT                   facilitator family transporter; PFAM: cation efflux
FT                   protein; SPTR: Cation diffusion facilitator family
FT                   transporter; TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: Cation efflux family; TIGRFAM: cation
FT                   diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35000"
FT                   /db_xref="GOA:E1REQ3"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:E1REQ3"
FT                   /protein_id="ADN35000.1"
FT                   /translation="MRDFEAENLKKKRVARLSILSNTFLVFMKLGAGLAVGSISIISEA
FT                   VHSAVDLIASAIAYISVKKSAVPPDMCHEYGHGKFEDMSGIIEALLIVVASLIILYEAV
FT                   MNLVSGHDIASEQLLSVGIAVMLISTIMNLYVSTKLFSVAKDTGSIALESDAWHLRTDV
FT                   FTSAGVMVGLILIRITGFVQFDAIIAIGISFVILHAAHDLIKRSFAHLTDRSLPDDEME
FT                   EIREVLMRFCGNNVSFHAIRSRRAGPDRFVEFHLTVPGDSSVNDSHELTDRIEAALKSK
FT                   LGRIFVTIHVEPAKNKKD"
FT   sig_peptide     241067..241210
FT                   /locus_tag="Mpet_0222"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            242004..242156
FT                   /locus_tag="Mpet_0223"
FT   CDS_pept        242004..242156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mla:Mlab_0285 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35001"
FT                   /db_xref="UniProtKB/TrEMBL:E1REQ4"
FT                   /protein_id="ADN35001.1"
FT                   /translation="MCSGAGGFDVELTQRLKPKKYKCRSCGATFESVSKHPVCPTCQSE
FT                   SVDEV"
FT   gene            242146..242625
FT                   /locus_tag="Mpet_0224"
FT   CDS_pept        242146..242625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_0280 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35002"
FT                   /db_xref="UniProtKB/TrEMBL:E1REQ5"
FT                   /protein_id="ADN35002.1"
FT                   /translation="MKYDIPLDDELLLIRRGDPFLLVAKAQELFVLCIETYDKELCQTV
FT                   EAGDLIVASAPEGGDVRQAEILVELVRTYHQPVFVMPKDHPGSARLSMVVSAGPAVIPK
FT                   CDIVRGTHPEQDVICASEEFGNLRLSSVNGGVEISLPELEETFFSISKIQTIVAR"
FT   gene            242776..243099
FT                   /locus_tag="Mpet_0225"
FT   CDS_pept        242776..243099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0225"
FT                   /product="V-type H+-transporting ATPase subunit E"
FT                   /note="InterPro IPR020330; KEGG: mem:Memar_0281 V-type
FT                   H+-transporting ATPase subunit E; SPTR: V-type
FT                   H+-transporting ATPase subunit E; TIGRFAM: ATP synthase
FT                   archaeal, H subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35003"
FT                   /db_xref="UniProtKB/TrEMBL:E1REQ6"
FT                   /protein_id="ADN35003.1"
FT                   /translation="MKTEVLKSIKETEEEYKSMISTAHEEKKRAIANSEQEAGNLIAKA
FT                   KSDAEEYKNKRIADARAEAAKQYAEIVKEGEKRAEALKKNAASNLDKAVEQLVSQFKVK
FT                   VNV"
FT   gene            243092..245065
FT                   /locus_tag="Mpet_0226"
FT   CDS_pept        243092..245065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0226"
FT                   /product="V-type ATPase 116 kDa subunit"
FT                   /note="COGs: COG1269 H+-ATPase subunit I; InterPro
FT                   IPR002490; KEGG: mem:Memar_0282 V-type ATP synthase subunit
FT                   I; PFAM: V-type ATPase 116 kDa subunit; SPTR: V-type
FT                   ATPase, 116 kDa subunit; PFAM: V-type ATPase 116kDa subunit
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35004"
FT                   /db_xref="GOA:E1REQ7"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:E1REQ7"
FT                   /protein_id="ADN35004.1"
FT                   /translation="MFKVQRMSKLLIAASKDQLEPVIRELYRHNVFHIEDFVDQGEEEY
FT                   EGFKIGRPMEGASSTSGKLLRIRSLANMIGVSPDNVESVAVQGKGALSTKIESELPKIE
FT                   EEIGSLVERRNSLESSLRECVQKQADLETFAKVPMDLSLLRGYDGFDVFAGTIPQDIEL
FT                   PVDCEKYFTDQVPGNLLIAVVPKESSQEAERFLVDSGFTAVAIPNEDGTAESNIEKYTQ
FT                   EITRLESEIGKMSEQITAQKEKYAEFLVACEELLTADVERAEAPLRFATTEEAFVAEGW
FT                   VPSDVVEGLTSDLQAATGGKVFVTEEEINYDEDIVPIEYDSPNWAKPTEALMDIYSRPQ
FT                   YTEFDPTLLVAIVFPIFFGFILGDIAYGAILLIMSFWLRKFVKDSIAGNQLLDVLRNAS
FT                   VASIIFGVLYSEFLGFACPWNPIIMSRHFNIGAEHAGHGPDAILLLIVTAWVGILHITL
FT                   GRAIHARNAKVQLHPGEHRSKVIFAQIGWIIVMWGILLMIWTIAPIPMMPDLTGAMAIA
FT                   GYNIFLLVGALMILVGIIGIGRDSALELMELPTIISHVLSYTRLAAVGLSSVAIAAVVN
FT                   YIAIGMMIEPAIADFGIVSIVMIIVGIFVFLIGHTLNTALGLLGGGLHSIRLHYVEFFT
FT                   KFYQGGGKKYEPFGIIRKFTED"
FT   gene            245069..245317
FT                   /locus_tag="Mpet_0227"
FT   CDS_pept        245069..245317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0227"
FT                   /product="H+transporting two-sector ATPase C subunit"
FT                   /note="InterPro IPR000454:IPR002379; KEGG: mem:Memar_0283
FT                   H+-transporting two-sector ATPase, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; SPTR:
FT                   H+-transporting two-sector ATPase, C subunit; PFAM: ATP
FT                   synthase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35005"
FT                   /db_xref="GOA:E1REQ8"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:E1REQ8"
FT                   /protein_id="ADN35005.1"
FT                   /translation="MVDTMTLEVAQASAVGFKAIGAGLAVGLAGMGTGLAQLGIGGAAV
FT                   GATAENKEMFGLALLFTVIPETVVIFGLVVALLLLFT"
FT   gene            245344..245922
FT                   /locus_tag="Mpet_0228"
FT   CDS_pept        245344..245922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0228"
FT                   /product="H+transporting two-sector ATPase E subunit"
FT                   /note="COGs: COG1390 H+-ATPase subunit E; InterPro
FT                   IPR002842; KEGG: mla:Mlab_1219 hypothetical protein; PFAM:
FT                   H+transporting two-sector ATPase E subunit; SPTR: V-type
FT                   ATP synthase subunit E; PFAM: ATP synthase (E/31 kDa)
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35006"
FT                   /db_xref="GOA:E1REQ9"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/TrEMBL:E1REQ9"
FT                   /protein_id="ADN35006.1"
FT                   /translation="MALDAVVGEIKAKGEKEAAAIKAEGKAEADRILAEAGEQVAAIKT
FT                   SAEEDAARQSAQIVNREIAAGNLAVKRQILNAEKALLDEVHAATVKAISDLPEDFHKKA
FT                   VRELCKAAAKELGEGVFYCNERDKAAVEHAISDLKTLAGFSLAGTKNISGGVIAESKDG
FT                   QLQLDYSYGSYLTEVWETGLRDASEKLFG"
FT   gene            245938..246996
FT                   /locus_tag="Mpet_0229"
FT   CDS_pept        245938..246996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0229"
FT                   /product="ATP synthase A1, C subunit"
FT                   /note="COGs: COG1527 H+-ATPase subunit C; InterPro
FT                   IPR014272:IPR002843; KEGG: mem:Memar_0285 V-type ATP
FT                   synthase subunit C; PFAM: H+transporting two-sector ATPase
FT                   C (AC39) subunit; SPTR: H+-transporting two-sector ATPase,
FT                   C (AC39) subunit; TIGRFAM: ATP synthase A1, C subunit;
FT                   PFAM: ATP synthase (C/AC39) subunit; TIGRFAM: ATP synthase
FT                   A1, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35007"
FT                   /db_xref="GOA:E1RER0"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR014272"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:E1RER0"
FT                   /protein_id="ADN35007.1"
FT                   /translation="MAAVNTTGPAPYIYACTRMKVRKASLIPREEYMRMLNMELPEIAR
FT                   IIEETHYKAEIDELNSSFSGIDLFEIALSWNLAKDYQRVIAMVPGHLKGFTKCYLLRWD
FT                   IQNVLTIMRGKSQGVPQGKIKEITIPAGSLDKAALDKLIADDSVDRIVENLRGHELYPV
FT                   FEREMAGAVESGSFARMENELYKAYYADIIHAAKSGVKGGYVFLQYIRLAIDTKNLMTV
FT                   FRVKGSLESDDLRELMIPGGTFSVDELVRLAGSESSDEIIETIRNRLNIESFTEVLEKF
FT                   REEKSVHKIETALTKAKLAQLDKLAKRYQFSVCPILLYLELKQYEVSNIRAVARGKASK
FT                   LDAESIEACMVV"
FT   gene            247000..247302
FT                   /locus_tag="Mpet_0230"
FT   CDS_pept        247000..247302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0230"
FT                   /product="Vacuolar H+transporting two-sector ATPase F
FT                   subunit"
FT                   /note="COGs: COG1436 H+-ATPase subunit F; InterPro
FT                   IPR008218; KEGG: mem:Memar_0286 V-type ATP synthase subunit
FT                   F; PFAM: Vacuolar H+transporting two-sector ATPase F
FT                   subunit; SPTR: V-type ATP synthase subunit F; PFAM: ATP
FT                   synthase (F/14-kDa) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35008"
FT                   /db_xref="GOA:E1RER1"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR022944"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:E1RER1"
FT                   /protein_id="ADN35008.1"
FT                   /translation="MEIAVIGNSEFILGFRLAGIQKTYAAEESDAIADLVTMVLDDAEV
FT                   GILVMNGEDMAKLPLRMRTTLSDSVKPTVIAIGGEEGGLSIRERIKRSVGVDLWK"
FT   gene            247293..249041
FT                   /locus_tag="Mpet_0231"
FT   CDS_pept        247293..249041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0231"
FT                   /product="ATP synthase, A subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="COGs: COG1155 H+-ATPase subunit A;
FT                   InterProIPR003593:IPR005726:IPR020003:IPR004100:IPR
FT                   000194:IPR000793; KEGG: mhu:Mhun_1183 V-type ATP synthase
FT                   subunit A; PFAM: H+transporting two-sector ATPase
FT                   alpha/beta subunit central region; H+transporting
FT                   two-sector ATPase alpha/beta subunit domain protein; PRIAM:
FT                   Sodium-transporting two-sector ATPase; SMART: AAA ATPase;
FT                   SPTR: V-type ATP synthase alpha chain 1; TIGRFAM: ATP
FT                   synthase, A subunit; PFAM: ATP synthase alpha/beta family,
FT                   beta-barrel domain; ATP synthase alpha/beta chain, C
FT                   terminal domain; ATP synthase alpha/beta family,
FT                   nucleotide-binding domain; TIGRFAM: ATP synthase archaeal,
FT                   A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35009"
FT                   /db_xref="GOA:E1RER2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005726"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:E1RER2"
FT                   /protein_id="ADN35009.1"
FT                   /translation="MEVKGKSKGILKRISGPVVTAVDLDAHMYDVVKVGDEQLMGEVIK
FT                   IDGDNVIIQVYEATDGIRPGEPVENTGMSLAVELGPGLLTSIYDGIQRPLEVLMEKMGS
FT                   FIERGVSAPGLDHAKKWEFKPLKKKGDEVVPGEIIGEVQETNIVTKIMIPPTFKGGKIK
FT                   EIKKGEFTVDEIVCVLDSGEEVAMMQKWPVRVPRPVTEKKNPDIPLITGQRILDGLFPI
FT                   AKGGTAAIPGPFGSGKTVTQQALAKWSDAEIVVYIGCGERGNEMTEVLTEFPELEDPKT
FT                   GKPLMERTILIANTSNMPVAAREASVYTGITIAEYFRDMGYDVSLMADSTSRWAEAMRE
FT                   ISSRLEEMPGEEGYPAYLSARLSEFYERAGRVETLNHDFGSITVIGAVSPPGGDFSEPV
FT                   TQNTLRIVKCFWALDAKLSQRRHFPAINWLNSYSLYLDSLSSYYDEKISPEWNPLRTWA
FT                   MAVLQKESELQEIVQLVGSDALPDEEQVTIEVARLLREVFLQQNAFDPVDTYCSMEKQF
FT                   DIMKAIKKYADLGYDAQKSGAPIAAVVGVKAKNELAQIKFIAEYKPELGKILKQMDEEF
FT                   AKVKEA"
FT   gene            249047..250426
FT                   /locus_tag="Mpet_0232"
FT   CDS_pept        249047..250426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0232"
FT                   /product="H+transporting two-sector ATPase alpha/beta
FT                   subunit central region"
FT                   /note="COGs: COG1156 H+-ATPase subunit B; InterPro
FT                   IPR020003:IPR004100:IPR000194:IPR000793; KEGG:
FT                   mhu:Mhun_1184 V-type ATP synthase subunit B; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SPTR: V-type ATP synthase beta chain 1;
FT                   PFAM: ATP synthase alpha/beta family, beta-barrel domain;
FT                   ATP synthase alpha/beta chain, C terminal domain; ATP
FT                   synthase alpha/beta family, nucleotide-binding domain;
FT                   TIGRFAM: ATP synthase archaeal, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35010"
FT                   /db_xref="GOA:E1RER3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RER3"
FT                   /protein_id="ADN35010.1"
FT                   /translation="MKEYRTVTKVQGPLVFVEKTEPVGYSELVNVVQADGQIKRGQVLD
FT                   TSDEIVVVQIFESTAGIGKDSGIRFLGETIKMPVGKDMLGRILSGGGKPKDGGPEIVPE
FT                   KRLEITGAAINPYARASPDEFIQTGISTIDATNTLVRGQKLPIFSGSGLPHNEIALQIA
FT                   RQAKVPGSDEQFAVVFAAMGITKEEENQFMADFERTGALEHAVVFLNLADDPAVERIIT
FT                   PRLALTTAEYLAFELDYHVLVILTDMTNYCEALRQIGAAREEVPGRRGYPGYMYTDLAS
FT                   LYERAGIIKGKKGSVTQFSILTMPGDDITHPIPDLSGYITEGQIVVSRELHRKGIYPPI
FT                   NVMPSLSRLMNLGIGEGMTREDHKKVSDQLYAGYAEGVDLRGLVAIVGKDALSERDQRF
FT                   LEFADLFEDRFVRQGHDEDRSIADSLDLGWELLATLPEDQLTRIDREMIRKYHPNYRKK
FT                   E"
FT   gene            250436..251068
FT                   /locus_tag="Mpet_0233"
FT   CDS_pept        250436..251068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0233"
FT                   /product="V-type ATPase, D subunit"
FT                   /note="COGs: COG1394 H+-ATPase subunit D; InterPro
FT                   IPR002699; KEGG: mem:Memar_0289 V-type ATP synthase subunit
FT                   D; PFAM: H+transporting two-sector ATPase D subunit; SPTR:
FT                   V-type ATPase, D subunit; TIGRFAM: V-type ATPase, D
FT                   subunit; PFAM: ATP synthase subunit D; TIGRFAM:
FT                   H(+)-transporting ATP synthase, vacuolar type, subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35011"
FT                   /db_xref="GOA:E1RER4"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:E1RER4"
FT                   /protein_id="ADN35011.1"
FT                   /translation="MALKDVKPTRSELINLKKRIKLSERGYNILKMKRDGLILEFFKVL
FT                   EEAKKSKSELNDNYEKALKTIAVANTVEGAIRVKAAAMAVQENPQIALKQKNIMGVVVP
FT                   EIESSAVRKDIIQRGYGVLGSSAVIDETAEAFEELVDSIIRAAEIETTMKRLLDEIEST
FT                   KRRVNALEFKVIPELSEARDFIKMRLDEMERDELVRLKKIRAKAQAK"
FT   gene            complement(251134..253722)
FT                   /locus_tag="Mpet_0234"
FT   CDS_pept        complement(251134..253722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_2521 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35012"
FT                   /db_xref="GOA:E1RER5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:E1RER5"
FT                   /protein_id="ADN35012.1"
FT                   /translation="MESEKPLIIFPKPERVETVKRRGFGKNPEVPSHSDQILRLSPKLT
FT                   ALQTAFREQNVSIQDSNIGIEPEKVLVIEIIGSINDFSNAVKRIEGFEWLGQFDINDIE
FT                   PDHYFYYKENNQKRLSGKLFLIMTNQSAINEMISLWRRYQNDKNSDLGYGYNKFKTLFN
FT                   LIKDIRYWNSKDRLEETGILENWKESIENQDKEMVYFEIELWYRLNEKKRDSNVSEISR
FT                   IVSNSGGSIRSKCIIPEIGYHALLANLPIQVISKFLDNYDAELLSCESIMLFRPVGQMA
FT                   SGKQKTDIDLTDYNIDKITTPKGEPIIALLDGLPLSNHSILKQHLIIDDPDNWEVDYPA
FT                   KTRNHGTGMASLIIHGDLSNRTNPLPRPIYSRPIMKPDLSENEYEEYIPEENELMVDLI
FT                   HRAVKNIFESEDGFGGTAPTIKIINLSIGDPNRPYIRTISPLARLLDWLSIKYDVLFIV
FT                   SAGNQNSSIITGISDEEFNSLSAEEIEKLCIKKITENLFDRRILSPAESINCVTVGSLY
FT                   HDYSETQLKEPHVQIFNELIPSPISSFGNGFNRSIKPDFIFSGGKTLYEKEEVRSSNVE
FT                   LRDIRDRLPGNQPPGNLYATPGLPGDLKKVKYGHGTSNSAALTSHTAGQYYENLIEIFN
FT                   SNDIENDEYQKFLTPIIKAMLTHGCSWGKSGQYLQDIFKEDGLTSNHRKSLINRWMGYG
FT                   IPDVDKLINCNDQRATLIGYGELENDEGHLFTLPQLQALSNKFIQNKLTITLAWLSPTT
FT                   PTSQKYKNYRLWFDVMIGKKITRIDVADSNQVKRGTIQHEIFEWEGANPISEDDLIQIR
FT                   VNCLRDIGKSKIPIKYGLIVSYEIAEPLDVSVYNEVKNLIRQPIELHLNI"
FT   gene            complement(253673..254716)
FT                   /locus_tag="Mpet_0235"
FT   CDS_pept        complement(253673..254716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0235"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="COGs: COG0464 ATPase of the AAA+ class; InterPro
FT                   IPR003593:IPR003960:IPR003959; KEGG: she:Shewmr4_2522
FT                   ATPase central domain-containing protein; PFAM: AAA ATPase
FT                   central domain protein; SMART: AAA ATPase; SPTR: ATPase;
FT                   PFAM: ATPase family associated with various cellular
FT                   activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35013"
FT                   /db_xref="GOA:E1RER6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RER6"
FT                   /protein_id="ADN35013.1"
FT                   /translation="MVRADLLLSLVKNSLCCDKIKTKNIVESIIAEERAKNHSILANRL
FT                   EILLNSSFNNENFQNKNNGISDQRISNLVYEVTPHYRLDDLILPTEVIQICNELIHEHN
FT                   RVDLLRSYNLEPRNRILLIGPPGNGKTSLAEAIAESLMLPLFVVRYDGIVGSYLGETAN
FT                   RLRRLIEYASTRKCVLFFDEFETLGKERGDTHETGEIKRVVSSLLMQIDSLPSHVIVIG
FT                   ATNHAELLDRAVWRRFQIRLVLPKPDEKHLADWFKLFEKRIGFSLGYKPEFLAKKLSGI
FT                   NYSEAEEFGQTVFRQYVLMQPISNIKPIVDQNLKLWSARTAIVNQIEGEQDGIRETPNN
FT                   ISKTRKS"
FT   gene            254948..255151
FT                   /locus_tag="Mpet_0236"
FT   CDS_pept        254948..255151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0236"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="InterPro IPR005357; KEGG: mem:Memar_1245
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   UPF0150; SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterised protein family (UPF0150)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35014"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:E1RER7"
FT                   /protein_id="ADN35014.1"
FT                   /translation="MNIRIVLEPGEDRGYTVYVPSLPGCISEGDTREEAIENIREAIEL
FT                   YLEPIDDEMILGEKAEQIEIAV"
FT   gene            complement(255312..255776)
FT                   /locus_tag="Mpet_0237"
FT   CDS_pept        complement(255312..255776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbn:Mboo_2025 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35015"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF67"
FT                   /protein_id="ADN35015.1"
FT                   /translation="MMNNKKIPFFLIVSILLILVIAIALLQLNGSPETAAPDSVRSNII
FT                   GIDPLDSQYYADDEIVISGNTTLPAGDEIRVHFYQSSFIHGKIRPNKTSIEIVTDVLPG
FT                   ESGNNRWTTVINTTGFWPGENVVMAYSNTNKEINASRIVILNNRDKIGEY"
FT   sig_peptide     complement(255687..255776)
FT                   /locus_tag="Mpet_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(255786..256934)
FT                   /locus_tag="Mpet_0238"
FT   CDS_pept        complement(255786..256934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbn:Mboo_1187 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35016"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF68"
FT                   /protein_id="ADN35016.1"
FT                   /translation="MKVKFGMRALCLLFVMAFAGTVFVPVVSASENSEDYIPADQLINE
FT                   IPKLAFNKNMDETAINGELSISNEKNENSIPEGSIIYHLKSGTTTIFNSKGDQILIAND
FT                   SDAEKVSTPSGLKPATLVQEIPSGSHISTEGSTIFVQNEGKLILTILTEAPEEKLVNRV
FT                   AWPDQYIEGSESGSLNSLGQYHAKWNVPQSPQRVYDDVTERSQIAIWNGVQTTDGTKLI
FT                   QPVLEWYWKDHAYDPDPGNVWTGSSWFAYTGSSSVLHSTRLSGIQPGDVIEGDILYNHY
FT                   RDYWTITFRDVTRNIQTTYVAESMPNDNVDVETMLEGVTIPDNRYLCGDTTFNDFYVID
FT                   TGGYDISPATVTSYVNNAYWSHLSGLWVGNSWPSSITLNTAN"
FT   sig_peptide     complement(256848..256934)
FT                   /locus_tag="Mpet_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(257497..258306)
FT                   /locus_tag="Mpet_0239"
FT   CDS_pept        complement(257497..258306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mem:Memar_0124 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35017"
FT                   /db_xref="GOA:E1RF69"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF69"
FT                   /protein_id="ADN35017.1"
FT                   /translation="MEMNKNYIIAGASLILILLLIIMTATGVLFMLPRQLYLIINGTLP
FT                   LTILALLIIALFALMTGNPESTLGKIISSTAIIGLLVIIAGIFVPILYFEAFVHNQGQT
FT                   YESPEIPDYQNTNYSRENTTFIDISHKDGIGTILDPEDTDYPAIHAECLEQIRFINAQI
FT                   KTGFSRTELIAMRQNNSYVALRFPAPATFNTSNIVDGSPKTITIDEAIFFLDSEYDDII
FT                   ITPTRDGTGVWGTSGDRGRLRELADPVLQMLSDELQDNEILISQMNT"
FT   sig_peptide     complement(258226..258306)
FT                   /locus_tag="Mpet_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(258452..259675)
FT                   /locus_tag="Mpet_0240"
FT   CDS_pept        complement(258452..259675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0240"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kcr:Kcr_0638 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35018"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF70"
FT                   /protein_id="ADN35018.1"
FT                   /translation="MQKPDKSEFYPNFFPNFLKPNMNLKTIFCILALFGLIAITGCTEP
FT                   YITDAEAVVIKISPDGEKISETVITCPNIYHASSYIQTSAVEISGDGSLVIVQYPNRTT
FT                   ELITRAIIIDNDGKLIKDTVFPAIDNDIFDLIALENDTVVALSEDGMLYSFSLNGDLIS
FT                   ETSVYELDGDITNSGYPFASAAPASENSIILAGEDKKPGYVQVLNISPEEKTVRETRIK
FT                   IGGMPWVHKVVQTDDGDFLIGGSYSDSESFPLSRPWIAKTDDEGSLLWEHKLGNVGDGF
FT                   LGFYESEVGEYHIIYASSITDEKGSTRDQYIEAIVDNSGNLVSTTNDTILKYPSLISKD
FT                   GLVFTETISGTDGGKKLHIIKTNAEGETEWDSLYELTESSATSSSIGSGIVQTADGGYL
FT                   ITGARYYY"
FT   gene            complement(259662..259769)
FT                   /locus_tag="Mpet_0241"
FT   CDS_pept        complement(259662..259769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35019"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF71"
FT                   /protein_id="ADN35019.1"
FT                   /translation="MAEIPRTDTKTENIAVNRILKTVKAIKEMTGYAKA"
FT   gene            complement(259913..260302)
FT                   /locus_tag="Mpet_0242"
FT   CDS_pept        complement(259913..260302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mla:Mlab_1727 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35020"
FT                   /db_xref="GOA:E1RF72"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF72"
FT                   /protein_id="ADN35020.1"
FT                   /translation="MKDIKKTRKNIILLIASVCIITVVLIGSYAVYHHIFTPDTVYFAG
FT                   AYPFEETDLNSDAVVLDLSEFDFEQYPVLNQLVNDPEGGHITFNHFEWDYDKIQDFRDL
FT                   YCVKREVNRYVFWNGTYYQIVVGQS"
FT   sig_peptide     complement(260213..260302)
FT                   /locus_tag="Mpet_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(260352..260753)
FT                   /locus_tag="Mpet_0243"
FT   CDS_pept        complement(260352..260753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0243"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cps:CPS_4484 RND family efflux transporter MFP
FT                   subunit; SPTR: Prolyl oligopeptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35021"
FT                   /db_xref="GOA:E1RF73"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF73"
FT                   /protein_id="ADN35021.1"
FT                   /translation="MNKFQKLLASAVIIILIIVILAFPHLMPSTVPPDILQVIQVSEQK
FT                   AGEGKIIHLDNESVSNYPVLEEVLLNRDYYETDEPYQDGDLLIIGSVDFPEKIKQDTID
FT                   KYIFDNESGKRKYFEYAENYYRIGTIYAD"
FT   sig_peptide     complement(260688..260753)
FT                   /locus_tag="Mpet_0243"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(260901..261476)
FT                   /locus_tag="Mpet_0244"
FT   CDS_pept        complement(260901..261476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0244"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fma:FMG_P0174 hypothetical protein; SPTR:
FT                   Histidine kinase sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35022"
FT                   /db_xref="GOA:E1RF74"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF74"
FT                   /protein_id="ADN35022.1"
FT                   /translation="MIIIFIFIIIPILLSLSLYALLKNLNGKFKKIVLVSALYTILFII
FT                   IASYMNQIQPGDPLVIILGLILLTFSIACPSAIAVFYFKNTFERKYEMAEAFFFPLVSL
FT                   PYLAFFISPELIEGQPLPPDYFQSIIPLFGWFIDPVFKDAGLAVSPETSIITGLISDIG
FT                   IFFEVLITLFVLCIIMRKIKETVDNVGS"
FT   sig_peptide     complement(261417..261476)
FT                   /locus_tag="Mpet_0244"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(261533..262192)
FT                   /locus_tag="Mpet_0245"
FT   CDS_pept        complement(261533..262192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0560 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35023"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF75"
FT                   /protein_id="ADN35023.1"
FT                   /translation="MLETDFFDKLLDDWADGLLYPESQIAVFNRIRDLPYAIMPDQTDP
FT                   LRGPLNLLKEGRGDCTSKHFLLGILFERLGISVKYMSVPFLWDQQEFRYPDNLRELAES
FT                   LPVSYHLACRALIGERWVLVDATWDIPLAAAGFPVNKEWDGLSDTLLGVVPTLVIPPEE
FT                   EESVSEIVHESADERPELHRKVRRQYTPEDFARRKEFDEEFGLWLDEIRRGNRREE"
FT   gene            262350..263009
FT                   /locus_tag="Mpet_0246"
FT   CDS_pept        262350..263009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tva:TVAG_491630 Ras family protein; SPTR: Ras
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35024"
FT                   /db_xref="GOA:E1RF76"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF76"
FT                   /protein_id="ADN35024.1"
FT                   /translation="MEQKKVILALGLVAVFIVVISLSAVIFSGGSGQSFVEENPKNAEL
FT                   ICDIVGYTNAVEARFNTSESVPEYITEKYGTIYIPPDVMTCDLVEIHDLGLKRDNSTTL
FT                   KTRIYDAEYDLDYIFLETRVQKNNISVDDYSSIIYDINESELAGAILIDAEYNDGSGLR
FT                   FYHLEYIFQSQSGDNFVIRISPVQATESAMNSTKPLYIVYSTKDVDHDYRIPLPDL"
FT   sig_peptide     262350..262457
FT                   /locus_tag="Mpet_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            263021..263482
FT                   /locus_tag="Mpet_0247"
FT   CDS_pept        263021..263482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0247"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="InterPro IPR019734:IPR013026:IPR001440:IPR013105;
FT                   KEGG: mpl:Mpal_2057 TPR repeat-containing protein; PFAM:
FT                   Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SPTR: TPR repeat-containing
FT                   protein; PFAM: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35025"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF77"
FT                   /protein_id="ADN35025.1"
FT                   /translation="MKKMNILLTVILMVIPALLSSGCMGHPDEDYQERLAEFAAKVNAS
FT                   AEYYDQMVESDPENSTAWCVRAMYYNGNFNQYDKALESVNRSLELEPEYALAWYVKGII
FT                   LLNSGDKDGASVCFDNAVKYDPSLAGSIPDVDEFGSEGTDFIAVSYKEE"
FT   sig_peptide     263021..263095
FT                   /locus_tag="Mpet_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(263605..264447)
FT                   /locus_tag="Mpet_0248"
FT   CDS_pept        complement(263605..264447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0248"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2227
FT                   2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1 4-benzoquinol
FT                   methylase; InterPro IPR013216; KEGG: mac:MA4656
FT                   hypothetical protein; PFAM: Methyltransferase type 11;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35026"
FT                   /db_xref="GOA:E1RF78"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF78"
FT                   /protein_id="ADN35026.1"
FT                   /translation="MDLKRFERITQKPPIYEKGNCEMWNDDHISKILLETHLSQESDLA
FT                   SRRKPAIEKTVGWILDRLGKENAKILDLGCGPGLYCEMLTEAGHDVTGVDLSKRSIDYA
FT                   KKSAEESGLNIEYINKNYLDLDLSEKFDLVMMIFCDFDVLNPDERDNLLEKIYSVLKPG
FT                   GMFVFDTMNDNTPAIMNPGEKSWEATASGGFWRAEPYLALTESFHYEDEKVILSQTIIY
FT                   SEPDDYRIYRFWTNYYNSSDLKQILEGRGFSDVTCYENVLSTEDFYCAETVDFYTAIK"
FT   gene            264669..264896
FT                   /locus_tag="Mpet_0249"
FT   CDS_pept        264669..264896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0249"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsh:Dshi_2457 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35027"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF79"
FT                   /protein_id="ADN35027.1"
FT                   /translation="MNKGILISLLIVIILASGCLSEKEYTGDELTDIALADPGVADILD
FT                   GYEYAIIDYGPAERYPSIREENSRSLIWCL"
FT   sig_peptide     264669..264734
FT                   /locus_tag="Mpet_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(265200..265949)
FT                   /locus_tag="Mpet_0250"
FT   CDS_pept        complement(265200..265949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0250"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="COGs: COG3398 conserved hypothetical protein;
FT                   InterPro IPR001845; KEGG: mem:Memar_2162 regulatory
FT                   protein, ArsR; PFAM: regulatory protein ArsR; SPTR:
FT                   Regulatory protein, ArsR; PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35028"
FT                   /db_xref="GOA:E1RF80"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF80"
FT                   /protein_id="ADN35028.1"
FT                   /translation="MRQIYKISFFAIFILTFLITTASAATDYTVRPSLNIGKEPGTSVA
FT                   GETVTECQPIPAWLAVAIIIFPSMASFPIEIVGSLKGLLYLGLRRINQGNVLENSNREN
FT                   IYYFIRENPGIYLRELEKKCTVKRGSLEYHLKILELLHLVAVYKDNNKKRYFANGSTNP
FT                   EDMALISLIQNKNEKVILSTLYNNKNLDNKELAEKTGFAPSTLSRHLNHLKKSGLIVGE
FT                   IDGNRINYNISESYYGKLSYYITTESV"
FT   sig_peptide     complement(265878..265949)
FT                   /locus_tag="Mpet_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(265951..266370)
FT                   /locus_tag="Mpet_0251"
FT   CDS_pept        complement(265951..266370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0251"
FT                   /product="peptidase domain-containing protein"
FT                   /note="KEGG: mem:Memar_2161 peptidase domain-containing
FT                   protein; SPTR: Peptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35029"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF81"
FT                   /protein_id="ADN35029.1"
FT                   /translation="MIFLILAMISVSIVSANAETGYIVRPSENEDPIIITKLSDTITQS
FT                   ETNRHQMSVGNQVDYLEIYHNWQSTSDSLSLTIYTPSWQKIGTFHDLDDDTLDGKIHID
FT                   IVPNGNYVEQGTWTFDVYGESVSSRRSYTFNLISH"
FT   sig_peptide     complement(266317..266370)
FT                   /locus_tag="Mpet_0251"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            266699..267403
FT                   /locus_tag="Mpet_0252"
FT   CDS_pept        266699..267403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0252"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1749 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35030"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF82"
FT                   /protein_id="ADN35030.1"
FT                   /translation="MFVSVVSADNEQIDIKESRQIVSKTINESTPWDAKEAAKIEDQID
FT                   NILMNTMLIKSYGLSTYNVQRVRTDTLDVPDDGYSSADGSYKLYKVNEQDSSYDYYILW
FT                   MKATGMNNDDGLIPSYLREVKPGISLTNSNERITDWEPISDTYTSSLVKITVSLGVDHG
FT                   GITAGVSQEFDLQSGHVGPDELSTSSGGYFRPHWSGNYQGSQGLIGGAEFRVPQGGGYH
FT                   YDITLDVTGAGY"
FT   gene            267433..267636
FT                   /locus_tag="Mpet_0253"
FT   CDS_pept        267433..267636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ptm:GSPATT00034219001 hypothetical protein;
FT                   SPTR: Protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35031"
FT                   /db_xref="GOA:E1RF83"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF83"
FT                   /protein_id="ADN35031.1"
FT                   /translation="MKEDKIGKILKILSVPIIALAFLPVWIVVSSLKIFVEPDPRLLVG
FT                   AIYASVLTLSFIYFGLELRRID"
FT   gene            268047..268931
FT                   /locus_tag="Mpet_0254"
FT   CDS_pept        268047..268931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0254"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR010916; KEGG: mbn:Mboo_1308 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35032"
FT                   /db_xref="GOA:E1RF84"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF84"
FT                   /protein_id="ADN35032.1"
FT                   /translation="MNDKKILLFFIALILIILAIVISFLHISVLPEIFAQDSVKSQVIG
FT                   IDQPDSEYFINDTFTVSGNTTLSKDDEIRVYFYLSYFIHGIKARPDNISRDVVAQIVPG
FT                   QSGLNRWSATIDTTGFWPDEYIITVYNNNSQEINTSRIVVLINRNESIDHTPKMYTCHP
FT                   EEFPDIPIIKEYGNESNKIYYDEETWNAIGSAVAPYFTNNSRYWAYNGGIINGWGPDYC
FT                   IGGISVWLDPDTPVNETMMDEIYHVFSESAKAESLDEPYLIFIPVRFYPSTDYVPRLNM
FT                   LYSIHPDQLMDLL"
FT   sig_peptide     268047..268121
FT                   /locus_tag="Mpet_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(269089..269742)
FT                   /locus_tag="Mpet_0255"
FT   CDS_pept        complement(269089..269742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0255"
FT                   /product="Nitrogenase iron-iron accessory protein AnfO"
FT                   /note="InterPro IPR014287; KEGG: rci:RCIX1618 hypothetical
FT                   protein; PFAM: Nitrogenase iron-iron accessory protein
FT                   AnfO; SPTR: Putative uncharacterized protein; PFAM: Iron
FT                   only nitrogenase protein AnfO (AnfO_nitrog); TIGRFAM:
FT                   Fe-only nitrogenase accessory protein AnfO"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35033"
FT                   /db_xref="InterPro:IPR014287"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF85"
FT                   /protein_id="ADN35033.1"
FT                   /translation="MCPCEACEGNKTEVAVILGSEGTTGILSEPGTVRVYERGDDCSWQ
FT                   PIRETGFEMKGESLQEIRLKISGLMDFLGDCRIFVARAASGAVFFELQKAGFSIWEIEG
FT                   RPAEFLDDVVEEEEAEEKAGKSTVFEIPAPLEISPNNYTISIKDVQGKIPGISSKKILQ
FT                   HFVRTGDFERLEVICDHVPPWIELDAVMSGLDCESEKTGPGEYLVVLTPKRAES"
FT   gene            complement(269752..270060)
FT                   /locus_tag="Mpet_0256"
FT   CDS_pept        complement(269752..270060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0256"
FT                   /product="Sucraseferredoxin family protein"
FT                   /note="COGs: COG3411 Ferredoxin; InterPro IPR009737; KEGG:
FT                   mpl:Mpal_0554 ferredoxin, 2Fe-2S; PFAM: Sucraseferredoxin
FT                   family protein; SPTR: Ferredoxin, 2Fe-2S; PFAM:
FT                   Respiratory-chain NADH dehydrogenase 24 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35034"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF86"
FT                   /protein_id="ADN35034.1"
FT                   /translation="MQKPKYHIFVCSSSKPNGQQKGYCHSQAGVDILMRFVEEIDERDL
FT                   GGEVFVNNTGCFGICDKGPIVVVYPDNVWYGSVTPDDVEEILDEHIEGGNVVTRLEI"
FT   gene            complement(270076..271509)
FT                   /locus_tag="Mpet_0257"
FT   CDS_pept        complement(270076..271509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0257"
FT                   /product="Nitrogenase"
FT                   /EC_number="1.18.6.1"
FT                   /note="COGs: COG2710 Nitrogenase molybdenum-iron protein
FT                   alpha and beta chains; InterPro IPR000318:IPR000510; KEGG:
FT                   mpl:Mpal_0555 nitrogenase; PFAM: oxidoreductase/nitrogenase
FT                   component 1; PRIAM: Nitrogenase; SPTR: Nitrogenase; PFAM:
FT                   Nitrogenase component 1 type Oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35035"
FT                   /db_xref="GOA:E1RF87"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF87"
FT                   /protein_id="ADN35035.1"
FT                   /translation="MSDSIHTSTGRTDTAKLVNENQCHMCMPLGGVVAFKGVEGSMALV
FT                   HGSQGCSTYMRLTNVEHYHEPIDVASSSLNEKQTIYGGEQNLMKALDNVRRVYKPKVIG
FT                   VLTTCLTETMGEDLNRIISTYKAEKGEIDTDIIPVSTPSYDKSHTEGFWTATRDIIAHY
FT                   ARKDIAYHKRINVIIPHISTADIKAIKMILDTWGVEYTLLPDYSMTLDRPFAGKYMKIP
FT                   DGGTPTSAIAEMSGAPVTIQFGLTCEKNISPGHYLEENFGVPLINLPLPIGIGNTDMFM
FT                   DTLKRITGKPMPKNLGYERGWLIDAMADSHKYNASARPVIYGEPELVYAYTSLCLENGS
FT                   IPSVIATGSAHSRLIPALERLLEESDCDEYPVILEGADFSMIEAVALEAGSNIAIGHSG
FT                   GRLLEEKHDIRIVRAGFPIHDRVGGQRILSAGYAGTLSFLDRFTNTILEKKHSSYRELR
FT                   KQELLSKIAAVTETGFTAE"
FT   gene            complement(271509..272894)
FT                   /locus_tag="Mpet_0258"
FT   CDS_pept        complement(271509..272894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0258"
FT                   /product="nitrogenase MoFe cofactor biosynthesis protein
FT                   NifE"
FT                   /note="COGs: COG2710 Nitrogenase molybdenum-iron protein
FT                   alpha and beta chains; InterPro
FT                   IPR005973:IPR000318:IPR000510; KEGG: mpl:Mpal_0556
FT                   nitrogenase MoFe cofactor biosynthesis protein NifE; PFAM:
FT                   oxidoreductase/nitrogenase component 1; SPTR: Nitrogenase
FT                   MoFe cofactor biosynthesis protein NifE; TIGRFAM:
FT                   nitrogenase MoFe cofactor biosynthesis protein NifE; PFAM:
FT                   Nitrogenase component 1 type Oxidoreductase; TIGRFAM:
FT                   nitrogenase molybdenum-iron cofactor biosynthesis protein
FT                   NifE"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35036"
FT                   /db_xref="GOA:E1RF88"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005973"
FT                   /db_xref="InterPro:IPR042459"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF88"
FT                   /protein_id="ADN35036.1"
FT                   /translation="MDNTCSLTAETDNLITERRNSIVTTGKNKSSICCTSDSLAGAVSQ
FT                   RACVFCGARVVLNPVTDAIHLVHGPIGCASYTYDIRGSLSSGSENYRKSFSTDMKEKDV
FT                   IFGGEKKLAACIDELVEKYNPPAIFVYSTCVVGMIGDDIIAVCKNASQTYGIDVIPVES
FT                   SGFVSGNKVVGYRAAGEALYKLITPKEGDVIEKTRKLNFLGEYNLGGEKWVVERYLREM
FT                   GIEINVAMTGDSTVEALKKSPGSCLNLVQCTGSMHWLANKMQEDFGIPYIDVNFFGADN
FT                   TAESLRKIAEFYDDPEITARCEALIEREIGAVREVNEKYRKKLEGKRAAIYVGGAFKAF
FT                   AIIRQLQDLGMEIVLTGTQTGKQEEYERMGRLLSEGTVIIDDANPAEIEKFLVEKKVDV
FT                   MAGGVKERFLAYKLGVGFIDHNHDRKDGLIGFEGAIKFIREVYATTCSPVWKYMREEKG
FT                   GSE"
FT   gene            complement(272915..274285)
FT                   /locus_tag="Mpet_0259"
FT   CDS_pept        complement(272915..274285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0259"
FT                   /product="nitrogenase molybdenum-iron protein beta chain"
FT                   /EC_number="1.18.6.1"
FT                   /note="COGs: COG2710 Nitrogenase molybdenum-iron protein
FT                   alpha and beta chains; InterPro
FT                   IPR005976:IPR000318:IPR000510; KEGG: mpl:Mpal_0557
FT                   nitrogenase molybdenum-iron protein beta chain; PFAM:
FT                   oxidoreductase/nitrogenase component 1; PRIAM: Nitrogenase;
FT                   SPTR: Nitrogenase molybdenum-iron protein beta chain;
FT                   TIGRFAM: nitrogenase molybdenum-iron protein beta chain;
FT                   PFAM: Nitrogenase component 1 type Oxidoreductase; TIGRFAM:
FT                   nitrogenase molybdenum-iron protein beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35037"
FT                   /db_xref="GOA:E1RF89"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF89"
FT                   /protein_id="ADN35037.1"
FT                   /translation="MLDCVPKEPVTTHTTGKINPAKTCQPLGAMYAALGIHGCLPHSHG
FT                   SQGCCAYHRMALTRHFRDPAMASSSSFTEGASVFGGAANLKTSIKNVFEIYNPDIIAVH
FT                   TTCLSETIGDDIPTIIKQTEIPEGKYVIHCNTPSYYGSHITGFSNMCKGIVNYLAESDG
FT                   NPKKEQANIFPGFVNPADMREVKRIVTEMGVPSIMYPDTTNVMDSPLLKKYEMYPMGGA
FT                   KIEDIKDSGNSKLTLALGTWSSAEAAAILQEKCKVPGVPLKIPIGIKATDALIMAVKDG
FT                   FGVEVPQSLEIERGQVIDTLIDTHFHYQGKKVAIFGDPDTVIAMTEFLITMGMIPKYVL
FT                   TGTNGRKFEETISAMLEEAGIEGSKVKAEGDLFDLHEWIKEEPVDLLIGNTHGKYIARA
FT                   EDVPFVRFGFPIFDRAVHPLMPVTGYRGCLRLIEMISNALLDRRDRDCADEDYELVL"
FT   gene            complement(274288..275904)
FT                   /locus_tag="Mpet_0260"
FT   CDS_pept        complement(274288..275904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0260"
FT                   /product="nitrogenase molybdenum-iron protein alpha chain"
FT                   /EC_number="1.18.6.1"
FT                   /note="COGs: COG2710 Nitrogenase molybdenum-iron protein
FT                   alpha and beta chains; InterPro
FT                   IPR005972:IPR010143:IPR000318:IPR000510; KEGG:
FT                   mpl:Mpal_0558 nitrogenase molybdenum-iron protein alpha
FT                   chain; PFAM: oxidoreductase/nitrogenase component 1; PRIAM:
FT                   Nitrogenase; SPTR: Nitrogenase protein alpha chain;
FT                   TIGRFAM: nitrogenase molybdenum-iron protein alpha chain;
FT                   nitrogenase component I, alpha chain; PFAM: Nitrogenase
FT                   component 1 type Oxidoreductase; TIGRFAM: nitrogenase
FT                   component I, alpha chain; nitrogenase molybdenum-iron
FT                   protein alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35038"
FT                   /db_xref="GOA:E1RF90"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005972"
FT                   /db_xref="InterPro:IPR010143"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF90"
FT                   /protein_id="ADN35038.1"
FT                   /translation="MTLTELNTDEIMTPYPDKVKKNRKKHIVAKTGEAASCPQIEANTR
FT                   TVPGIISQRGCCYAGCKGVVVGPIKDMITITHGPIGCGYYSWGTRRNKARADEKTPPEH
FT                   LFGTMCFSTDMQESDIVFGGEKKLTKMIDEVVEIFHPRAINICSTCPIGLIGDDLSAVS
FT                   KAAEAKHGIPVLHYNCEGYKGVSQSAGHHIANNQIMERIIGTGTDELEGDYIINILGEY
FT                   NIGGDGWEIERILKDIGYNVNSILTGDSAYVNIKNLHKAHLNLVQCHRSINYIAEMMET
FT                   KYGTPWLKVNFIGVEATIESLRDMAQCFGDEDLIARTEMVIERELAAISPELERYRKIC
FT                   EGKTAFAFVGGSRSHHYQYLLRDLGMEVVVAGYEFAHRDDYEGREVIPTIKSDADSKNI
FT                   PELHLEPDPEMYEEPHLHLKMSKGKYDKMVEMGKLGNYDGMYPDMIDGSVMIDDPNHYE
FT                   TEELIEIFHPDLIFSGVRDKYISHKMGVPSKQMHSYDYSGPYAGFRGAIIFAQDVANAL
FT                   STPAWKMITPPWEKDETGGDE"
FT   gene            complement(275924..276343)
FT                   /locus_tag="Mpet_0261"
FT   CDS_pept        complement(275924..276343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0261"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="COGs: COG0347 Nitrogen regulatory protein PII;
FT                   InterPro IPR002187; KEGG: mpl:Mpal_0559 nitrogen regulatory
FT                   protein P-II; PFAM: nitrogen regulatory protein P-II; SPTR:
FT                   Nitrogen regulatory protein P-II; PFAM: Nitrogen regulatory
FT                   protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35039"
FT                   /db_xref="GOA:E1RF91"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF91"
FT                   /protein_id="ADN35039.1"
FT                   /translation="MKEILAIVRMKKTGATKRALIEAGVAGFTAMRVMGRGKLVHDENI
FT                   ITPCKDILKGMAPDDVIEEHESEEQIVTFLDDTRMFPRRLFTILAYDEDVPRIVEAIMK
FT                   ANRTERGAGDGKIFVTPVTDAIRVRTSESGDAAIW"
FT   gene            complement(276359..276685)
FT                   /locus_tag="Mpet_0262"
FT   CDS_pept        complement(276359..276685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0262"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="COGs: COG0347 Nitrogen regulatory protein PII;
FT                   InterPro IPR002187:IPR000408:IPR017918; KEGG: mpl:Mpal_0560
FT                   nitrogen regulatory protein P-II; PFAM: nitrogen regulatory
FT                   protein P-II; SPTR: Nitrogen regulatory protein P-II; PFAM:
FT                   Nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35040"
FT                   /db_xref="GOA:E1RF92"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF92"
FT                   /protein_id="ADN35040.1"
FT                   /translation="MLFVRAIVRPEKKDEVLENLSAGGFHAATVVDVVGRGKQKGIRMG
FT                   DVFYDEIPKTLILVAIEDKDKDKITDIIIKTAKTGTSGNFGDGKIFISPVEEAYTISKG
FT                   TKGL"
FT   gene            complement(276717..277538)
FT                   /locus_tag="Mpet_0263"
FT   CDS_pept        complement(276717..277538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0263"
FT                   /product="nitrogenase iron protein"
FT                   /EC_number="1.18.6.1"
FT                   /note="COGs: COG1348 Nitrogenase subunit NifH (ATPase);
FT                   InterPro IPR005977:IPR000392; KEGG: mbn:Mboo_1142
FT                   nitrogenase iron protein; PFAM: NifH/frxC-family protein;
FT                   PRIAM: Nitrogenase; SPTR: Nitrogenase iron protein;
FT                   TIGRFAM: nitrogenase iron protein; PFAM: 4Fe-4S iron sulfur
FT                   cluster binding proteins, NifH/frxC family; TIGRFAM:
FT                   nitrogenase iron protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35041"
FT                   /db_xref="GOA:E1RF93"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF93"
FT                   /protein_id="ADN35041.1"
FT                   /translation="MRQIAIYGKGGIGKSTTTQNTVAALAASGKKVMVVGCDPKADSTR
FT                   LLLHGLCQKTVLDTLRDEGDDIDLEDVLKPGFGETMCVESGGPEPGVGCAGRGIITSIN
FT                   LLESLGAYTDDLDYVFYDVLGDVVCGGFAMPIREGKAQEIYIVASGELMALYAANNISK
FT                   GIQKYAETGGVRLGGIICNSRKVDHELELLQAFATELGSQLIYFVPRDNLVQRAEINKK
FT                   TVVDFDPESNQANEYRSLAAAIDGNKMFVIPKPMSQDRLEELMMEHGFLGL"
FT   gene            277906..278493
FT                   /locus_tag="Mpet_0264"
FT   CDS_pept        277906..278493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2301 ABC transporter ATP-binding
FT                   component, degenerate; SPTR: ABC transporter ATP-binding
FT                   component, degenerate"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35042"
FT                   /db_xref="GOA:E1RF94"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF94"
FT                   /protein_id="ADN35042.1"
FT                   /translation="MPPLHYFKEKPILLYGFIASLIYLVFGLVLFAVTENLLKYGNSGN
FT                   SLSLYISSMFFLMSITASVLAAYRASRDPDGEVLSKKTKVIYGVLAALIVSLFPVLVYA
FT                   ALDLIMHNFLFSSLLDLQLYMTPLPAAVIGGLVGYFIEGTYSCFGDKGGIKKYIMIVSA
FT                   LLLLELALFLIIIFGATGMNLVPSDPGRNMKP"
FT   sig_peptide     277906..278001
FT                   /locus_tag="Mpet_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            278545..279345
FT                   /locus_tag="Mpet_0265"
FT   CDS_pept        278545..279345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0265"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="InterPro IPR003091:IPR013099; KEGG: mbn:Mboo_0262
FT                   ion transport 2 domain-containing protein; PFAM: Ion
FT                   transport 2 domain protein; SPTR: Ion transport 2 domain
FT                   protein; PFAM: Ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35043"
FT                   /db_xref="GOA:E1RF95"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF95"
FT                   /protein_id="ADN35043.1"
FT                   /translation="MKEADHSSDEYKGTGYEVFILLLSALSVFNIIFYLLPDLVPAATE
FT                   IVGIIDLFISLVFMADFLFRFFTYDSKYHYFFKNWGWADLLSAVPFPIAKIFRLFRIIR
FT                   IVYVMRKNGVDKIRKEMSKNRAEVALFFILIFIIIIIELSSVLVVQFESVSPKANILTG
FT                   GDAIWWACVTVTTVGYGDFYPVTVKGRIVGIVLMISGVSVFGTLAGFLSTKLVSRKEDT
FT                   LPDPEITAKIGEIHSLLKECRGFQDDLSSRLAELENNVPGKEKK"
FT   gene            complement(279348..280145)
FT                   /locus_tag="Mpet_0266"
FT   CDS_pept        complement(279348..280145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0266"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG0784 FOG: CheY-like receiver; InterPro
FT                   IPR001789; KEGG: mhu:Mhun_0118 putative PAS/PAC sensor
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; SPTR: Putative PAS/PAC sensor protein;
FT                   PFAM: Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35044"
FT                   /db_xref="GOA:E1RF96"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF96"
FT                   /protein_id="ADN35044.1"
FT                   /translation="MADTIKGNAKKILIVEDDDLVASLIEDVLGKRNYTIIDKVTTGEE
FT                   ALDKAIKHLPDIILMDIRLEGRIDGITATRYITSLFGIPVIFISGEKNEELFRIAATAG
FT                   PSSFITKPFTANDIYSNIEIALAKGEMKKKEKKNQFDLPAVILYKSLSEMDAYFILDEK
FT                   GGIIFLNPYAEHMINTNISGAARESINKYLLFYNAATREPYRDTFNSIVRECNFFGEKS
FT                   KIAIKMSNGSFRPAVTKSFVIYDLFQNQIGTVFRLHLKAKGEM"
FT   gene            280380..281468
FT                   /locus_tag="Mpet_0267"
FT   CDS_pept        280380..281468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spl:Spea_1428 hypothetical protein; SPTR:
FT                   Response regulator containing a CheY-like receiver domain
FT                   and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35045"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF97"
FT                   /protein_id="ADN35045.1"
FT                   /translation="MKKRMIAALIILIAFFLVVLFYIQADSDYISAQNKSELVPGAESA
FT                   PSGQNISTESAGQAESPDNSTGSYSSEGLDELFSEIASVAHGYGEYVLYDEDGMQILSE
FT                   GDERSDISLSFERTKIMERMYLKDLYSGHEYEISPPDGFKFLLVSVTAAPVTTHLERHT
FT                   TPVTGNFIVVDPSGNITPSLNFAEGLGAVIENDVSHDTMINGRFVIRGVGEIYVGKEVF
FT                   SSLNAVEGSGALTGWIIYDVPENYSVSPDTYLELELGGEKVYWRLHDIQVDVQVMKNYD
FT                   SGRITVSYNGGPESYFIRAIEAKLVKADGSVEKKSVEAAEDEEYLPETEFFLYGSPGEQ
FT                   DQLSVKVVSSYGEEYIKYKKKI"
FT   sig_peptide     280380..280454
FT                   /locus_tag="Mpet_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(281544..281858)
FT                   /locus_tag="Mpet_0268"
FT   CDS_pept        complement(281544..281858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_61030 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35046"
FT                   /db_xref="UniProtKB/TrEMBL:E1RF98"
FT                   /protein_id="ADN35046.1"
FT                   /translation="MKWLVAAGLIMIISCGCVAFTDEAVGTWENKSLPLQEIMTIKSDG
FT                   TYYMSDMDGNGLSGGTWVNIEDHYIFTPESGGEKMYAGITRGGRGQVFMIFDNITYLKI
FT                   "
FT   sig_peptide     complement(281796..281858)
FT                   /locus_tag="Mpet_0268"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            282054..282530
FT                   /pseudo
FT                   /locus_tag="Mpet_0269"
FT   gene            282648..283499
FT                   /locus_tag="Mpet_0270"
FT   CDS_pept        282648..283499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0270"
FT                   /product="transposase IS4 family protein"
FT                   /note="InterPro IPR002559; KEGG: mpl:Mpal_2299 transposase
FT                   IS4 family protein; PFAM: transposase IS4 family protein;
FT                   SPTR: Transposase IS4 family protein; PFAM: Transposase DDE
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35047"
FT                   /db_xref="GOA:E1RE61"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE61"
FT                   /protein_id="ADN35047.1"
FT                   /translation="MSENWYINFVKTSLEVIDNSHVPLRSSKFSKKKYTQHQLLTLIIL
FT                   KEKIGKDYRDFIELLPNLTTITDILQLEQIPHYTTLQKFLSRIPSLTFRIILKNVIRRL
FT                   HQKGNQIRITSIDSTGFTSSYASYYYSKRINKTRKSFIKASIAVDSDKLIIMGWKFSKV
FT                   PVHDSQHAKSLINQVSRITKTDCFTMDKGYDSEKIHQYIRDVIGAESIIPVRKWNGNIY
FT                   SGKYRKEMIENFNQEKYGQRNMVETVFSVIKRKYKENVRSRKYFNQIKEIKIRMLIHNM
FT                   TL"
FT   gene            complement(283540..284067)
FT                   /locus_tag="Mpet_0271"
FT   CDS_pept        complement(283540..284067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG2862 membrane protein; InterPro IPR005134;
FT                   KEGG: mmz:MmarC7_1747 hypothetical protein; PFAM: conserved
FT                   hypothetical protein; SPTR: Uncharacterized protein
FT                   UPF0114; PFAM: Uncharacterized protein family, UPF0114"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35048"
FT                   /db_xref="GOA:E1RFA0"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFA0"
FT                   /protein_id="ADN35048.1"
FT                   /translation="MSDNSPGLGKKLENSFERVLWSLRFIVLLGVIFGAISAIILFVVG
FT                   SFEIFSVLNEAFFEVESHLSHETILIGLIGAIDFYLIGLVLLIFSFGIYELFISQIDIA
FT                   RSCGSFTNILEVRNLDDLKNKILKVIIMVLIVTFFQRVLDLDMASSIDALAMAISICLI
FT                   CIGVYYMGRHNI"
FT   gene            284420..285229
FT                   /locus_tag="Mpet_0272"
FT   CDS_pept        284420..285229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0272"
FT                   /product="Hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="COGs: COG2145 Hydroxyethylthiazole kinase sugar
FT                   kinase family; InterPro IPR000417:IPR011144; KEGG:
FT                   mem:Memar_0262 hydroxyethylthiazole kinase; PFAM:
FT                   hydroxyethylthiazole kinase; PRIAM: Hydroxyethylthiazole
FT                   kinase; SPTR: Hydroxyethylthiazole kinase; PFAM:
FT                   Hydroxyethylthiazole kinase family; TIGRFAM:
FT                   hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35049"
FT                   /db_xref="GOA:E1RFA1"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFA1"
FT                   /protein_id="ADN35049.1"
FT                   /translation="MNGKDIAGIFARVRANRPLVHHITNIVTINDCANITISAGAAPVM
FT                   TSDKAEAAEMVSAANALVLNIGTLTSFQVESMLEAGKRANELGIPVILDPVGAGATKLR
FT                   TQTVMELLDRIDIAVIKGNAGEIGTIAGIEGGVRGVDSCGVLSDPEETVRACAESLNTT
FT                   VVMSGPVDIISDGKKVMLVENGVSMMGNLSGTGCMGASLTGAFAAVEKDYAISSTAAFA
FT                   TFGRAGELAAVKSKGPYSFRTALFDELFSLNEADLAEHAKVRAKDAV"
FT   gene            285219..285860
FT                   /locus_tag="Mpet_0273"
FT   CDS_pept        285219..285860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0273"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="COGs: COG0352 Thiamine monophosphate synthase;
FT                   InterPro IPR003733; KEGG: mem:Memar_0261 thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase;
FT                   SPTR: Thiamine-phosphate pyrophosphorylase; TIGRFAM:
FT                   thiamine-phosphate pyrophosphorylase; PFAM: Thiamine
FT                   monophosphate synthase/TENI; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35050"
FT                   /db_xref="GOA:E1RFA2"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFA2"
FT                   /protein_id="ADN35050.1"
FT                   /translation="MPYDLYVVTDREIGRGRTHQEIALEAAAGGADVIQFRDKTLLIRE
FT                   FIETAKEIRDITSASGAMFIVNDRIDAALAVGADGVHLGQNDMTADWARRISPPGFIIG
FT                   ISVGNVAEAIEAESAGADYVALSPVFSTVSKDDAGPGHGLEMLSRIRSNVDIPVIGIGG
FT                   IGLHNVKDVLSAGADGIAVISAVAGADDIRSAAEEMKKIIAVEKRKNGLG"
FT   gene            285941..286831
FT                   /locus_tag="Mpet_0274"
FT   CDS_pept        285941..286831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0274"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="COGs: COG0385 Na+-dependent transporter; InterPro
FT                   IPR002657; KEGG: aba:Acid345_1377 bile acid/sodium
FT                   symporter; PFAM: Bile acid:sodium symporter; SPTR: Bile
FT                   acid/sodium symporter; PFAM: Sodium Bile acid symporter
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35051"
FT                   /db_xref="GOA:E1RFA3"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFA3"
FT                   /protein_id="ADN35051.1"
FT                   /translation="MTPFDLILWLIYFFIVSSMFQIGLNLGVKEILDPFRKPGVLVNSL
FT                   LLNLIAIPLAGVGLAILLGLDGVALFGFLIMACSPGASYGPKIIEFAGGDVGHSIGVMF
FT                   LLCMIAIISAPLTVFLLVPGTGSIDIWPVIQTLAIIQVIPLFFGMFLKAKRPHLAERAS
FT                   GPVFWISNISALVVVILAFGLKFFSESESSLAGIIGIRGILAIVLLVFISLAAGYYLGG
FT                   SAEGTKKSMAVSTSIRNAGVAFLIGVGSFEDGHGVLSVIILYIFFQTLITGLLAGWWGW
FT                   KNFKENGMAETGISS"
FT   gene            286886..287497
FT                   /locus_tag="Mpet_0275"
FT   CDS_pept        286886..287497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_2438 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35052"
FT                   /db_xref="GOA:E1RFA4"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFA4"
FT                   /protein_id="ADN35052.1"
FT                   /translation="MKKEYGMYLAYIFQALIALNVIHAFLIGQYELMFTGLLMFILTLV
FT                   PYIIARKMNVNFPWFVYLLIAMALWFHTAGYIQGYYTTFYPYYDKIAHLVSGTTVALLG
FT                   FLGVIFLDKYWNMNLNTPFIIGFTIIFGMALAGFWEIYEFLIDTFFGGSMAGLMQHGNT
FT                   DTMLDMIFVLTGSIIVSIFGVFYFRHHRKEDITGSIEGTK"
FT   gene            287544..288287
FT                   /locus_tag="Mpet_0276"
FT   CDS_pept        287544..288287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0276"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dre:100002903 hypothetical LOC100002903; SPTR:
FT                   Possible oligosaccharide repeat unit polymerase Wzy"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35053"
FT                   /db_xref="GOA:E1RFA5"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFA5"
FT                   /protein_id="ADN35053.1"
FT                   /translation="MNSGKKHPRLLKNRVFVAGLIILILIPGFVAGAWYYFNLQSNLQK
FT                   ISDPGDFSGQRYSSGYGYYSPQEFLEGSGYFDLVYYIDNGSWIMPDNINDAIHFNVSDP
FT                   ETGTFVEGDYTPDFSIVNDTLYLDILVVNWNDYSHKGSCYQISDSSSAYLYYNDTGYDW
FT                   ESYHRALDVLSVSEYNKSIGTGEYDEIRIWLPVFGSFVTPVKTTDYPDYIDWEYILFER
FT                   NRNGSVCPVKVPVQTAIACNIEVVR"
FT   sig_peptide     287544..287639
FT                   /locus_tag="Mpet_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(288324..288899)
FT                   /locus_tag="Mpet_0277"
FT   CDS_pept        complement(288324..288899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0277"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="COGs: COG0655 Multimeric flavodoxin WrbA; InterPro
FT                   IPR005025; KEGG: mba:Mbar_A1385 iron-sulfur flavoprotein;
FT                   PFAM: NADPH-dependent FMN reductase; SPTR: Iron-sulfur
FT                   flavoprotein; PFAM: NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35054"
FT                   /db_xref="GOA:E1RFA6"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFA6"
FT                   /protein_id="ADN35054.1"
FT                   /translation="MKVVAFNGSPKKDGNTAILLQKVLTELEREGIDTEIIHIGGQKVH
FT                   GCTACMKCMENQDRKCVFDDDFVNNCIRKMEEADGIIIGSPTYFADVSTEVKALIDRAG
FT                   FVGMVNGGMFARKIGAAVIAVRRSGGIHAYDTINHFFGISSMITVGSSNWNLGLGLEPG
FT                   DVENDVEGMQTMQTLGINMAWILKKIHR"
FT   gene            289047..290261
FT                   /locus_tag="Mpet_0278"
FT   CDS_pept        289047..290261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0278"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="COGs: COG0126 3-phosphoglycerate kinase; InterPro
FT                   IPR001576; KEGG: mbn:Mboo_2342 phosphoglycerate kinase;
FT                   PFAM: phosphoglycerate kinase; PRIAM: Phosphoglycerate
FT                   kinase; SPTR: Phosphoglycerate kinase; PFAM:
FT                   Phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35055"
FT                   /db_xref="GOA:E1RFA7"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFA7"
FT                   /protein_id="ADN35055.1"
FT                   /translation="MKIGRLEDLGSLRGTALLRVDFNSPIDPSSNMILDDKRFREHAPT
FT                   VKALEDSKCVIVTHQSRPMKKDFTNLRAHAERLERLIGRPVDYIDDIFGACARDAVKTM
FT                   DYGEVLMLENVRFNSEEVLTMDGEDAMKTHLVKGLSAMADYYVFDAFGTAHRSQPTIVG
FT                   LPRVMRSVAGLLMDKEVSTLSKVLTDAPGPVTFVLGGTKVDDSLAVAKNALEAGITDNV
FT                   VFTGVVANVVYLAEGKKIGKPSTDLVHSLGYDKEIEVAAELLKKYSDRIVTPDHVAVKE
FT                   DGVRAEYPLENMPQDKGIMDLGIESLAELTGIISNSGTIVLNGPAGVFEDEQFSAGTYE
FT                   LIRASEKAEFSVVGGGHTAAVIEKMGVADRFSHISTGGGACIEFLTGKKLPAVEALEYS
FT                   KEKFW"
FT   gene            complement(290449..291579)
FT                   /locus_tag="Mpet_0279"
FT   CDS_pept        complement(290449..291579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0279"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="COGs: COG4032 thiamine-pyrophosphate-binding
FT                   protein; InterPro IPR011766; KEGG: mem:Memar_0112 thiamine
FT                   pyrophosphate binding domain-containing protein; PFAM:
FT                   thiamine pyrophosphate protein domain protein TPP-binding;
FT                   SPTR: Sulfopyruvate decarboxylase subunit beta /
FT                   sulfopyruvate decarboxylase subunit alpha; PFAM: Thiamine
FT                   pyrophosphate enzyme, N-terminal TPP binding domain;
FT                   Thiamine pyrophosphate enzyme, C-terminal TPP binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35056"
FT                   /db_xref="GOA:E1RFA8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR022494"
FT                   /db_xref="InterPro:IPR022502"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFA8"
FT                   /protein_id="ADN35056.1"
FT                   /translation="MPERKIESILREEGIEFVVSLPCDRTKDLCALLEKDFHYVNINRE
FT                   EDGVGVCAGLALAGRRYVLQMQSSGLGNSLNAMMSLTSLYGLPLPIIASWRGVYNEKIA
FT                   AQVPFNSRIPAILDAMGISHTIIKGSGDLEKIREAIRLSFENGGIHVILILPKLWEEGN
FT                   GGCAEKPFPPREREIRFEYNRSIKEPVMNRAGAISVIAGELEDEAVVVNIGVPCKEMHA
FT                   AGDRPKNFYMLGSYTQATPIGLGLALGQDKDVVVIDGDGSLLGTAILPTVAAEKPDNLT
FT                   IVALDNGAFGSTGMQITHSWTTCDLELIAKGAGIKNTIKVRTAEELKEAFLNRGKGPSF
FT                   IHVIIKPGNTDAPNLALTPEEIRDRFMDSIGKSAGK"
FT   gene            complement(291572..292846)
FT                   /locus_tag="Mpet_0280"
FT   CDS_pept        complement(291572..292846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0280"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="COGs: COG0498 Threonine synthase; InterPro
FT                   IPR001926; KEGG: mhu:Mhun_2977
FT                   pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; SPTR: Cysteate synthase; PFAM: Pyridoxal-phosphate
FT                   dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35057"
FT                   /db_xref="GOA:E1RFA9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR022401"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFA9"
FT                   /protein_id="ADN35057.1"
FT                   /translation="MGEYILRCPVCGEAIDDCYTNTCIKGCNGLVYADYSAKQITVRDL
FT                   PGMFRYHDWLPVSGWTQTDTCPATYRSEGLADHLGLKNLYITFNGYWPEKRAFIRTCSF
FT                   KELEAVPTMLRIKERLKNGILQISSAGNTGRAFAEVSAGTGTPVIISVPKKAAGSIWTT
FT                   RECDSVFLVTIEGDYSDAIALGNEICTVPGVISEGGAKNPARRDGMGTVMLDGTMAIGK
FT                   MPDWYFQAVGSGTGGIAAWEMGKRLLADGRFGDRLPRLYLSQNEPFVPMVNAWAERRRE
FT                   IIPEKDMPGGKEAAMETYATVLTNRNPPYSITGGLFDALSGTNGIMRGVKSGDAKKAGR
FT                   LFMDLEGPDLDPAAEVCVASLISAVESGDVNRDDNILLNITGGGYRRAAEDLDMIPVRP
FT                   SASLRSLDEADELKDKITEWRRKYA"
FT   gene            complement(292848..294086)
FT                   /locus_tag="Mpet_0281"
FT   CDS_pept        complement(292848..294086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0281"
FT                   /product="methanogenesis marker 16 metalloprotein"
FT                   /note="COGs: COG1900 conserved hypothetical protein;
FT                   InterPro IPR002708:IPR017677:IPR017896:IPR001450; KEGG:
FT                   mhu:Mhun_2978 hypothetical protein; PFAM: protein of
FT                   unknown function DUF39; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; SPTR: Putative uncharacterized
FT                   protein; TIGRFAM: methanogenesis marker 16 metalloprotein;
FT                   PFAM: Domain of unknown function DUF39; TIGRFAM: putative
FT                   methanogenesis marker 16 metalloprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35058"
FT                   /db_xref="InterPro:IPR002708"
FT                   /db_xref="InterPro:IPR017677"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFB0"
FT                   /protein_id="ADN35058.1"
FT                   /translation="MVKTVAEINKKIRDGTAVVLTAGEFKKKVRDGERLSPDDIDVVTC
FT                   GTCGVMSGTMAILSVPVAEPGTFRRADSITLNGVPAFPGPCPNEGLGQVDLVVYGTSHA
FT                   SNSYGGGNLFRDIASAEKEIEVQTEAGGKNFECTVYGDELHYARMITSRSAFKNYSAFV
FT                   NSGKDPVNTIFSVLPLSGGLTQATVSGCGEINPLQNDPDTRFLRSGAGVLLNGAEGLIL
FT                   GTGTRSSSEKPNLSVSAGMAGMNPEFMGEFKTSAGPECITSIAAAIPVIDNECIARLSV
FT                   LDEEILLPIVDVFDRRTLGFSDYGRIWQSAGRHITVDPTKCLLCGECPAQEHCPADAIM
FT                   PGGGILTSRCLSCGACLSTCIGEVYSMDTGSIALNGKEIPVVLRQSDRRKGEQICSNLK
FT                   EKIESGKFTLGGM"
FT   gene            complement(294080..294733)
FT                   /locus_tag="Mpet_0282"
FT   CDS_pept        complement(294080..294733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0282"
FT                   /product="Fe-S cluster domain protein"
FT                   /note="COGs: COG2000 Fe-S protein; InterPro IPR007202;
FT                   KEGG: hmo:HM1_0552 fe-s cluster, putative; PFAM: Fe-S
FT                   cluster domain protein; SPTR: Fe-s cluster, putative; PFAM:
FT                   Putative Fe-S cluster"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35059"
FT                   /db_xref="GOA:E1RFB1"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFB1"
FT                   /protein_id="ADN35059.1"
FT                   /translation="MKNTDPGEWIPPGKNCGACGASTCEEFVLMLAGGKKEKPDCPFYR
FT                   ESPDLNNPPESILTANYGDRDIHGDPFDFILHPLPREPSARKIVLPFRPDMTEKLEIKK
FT                   GDLVLGRPTGAGCPVQHVLSVIEADYLTGLLTCHVVSPLLAREKEDEVKSISAYHIIGF
FT                   EGVAQTINKEPEFGRRQKFLPGFCMMNLAHTGVVNMVLENRYGIHTRVEDIRIW"
FT   gene            complement(294739..295446)
FT                   /locus_tag="Mpet_0283"
FT   CDS_pept        complement(294739..295446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0283"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="COGs: COG0378 Ni2+-binding GTPase involved in
FT                   regulation of expression and maturation of urease and
FT                   hydrogenase; InterPro IPR012202:IPR003495; KEGG:
FT                   mem:Memar_0108 cobalamin synthesis protein, P47K; PFAM:
FT                   cobalamin synthesis protein P47K; SPTR: Cobalamin synthesis
FT                   protein, P47K; PFAM: CobW/HypB/UreG, nucleotide-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35060"
FT                   /db_xref="GOA:E1RFB2"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFB2"
FT                   /protein_id="ADN35060.1"
FT                   /translation="MKLIVIAGPPSAGKTAVVKQVIRKYSGEKRCAYLKIDVVRAFEDE
FT                   ELAGEFGILTKKVYSGDVCPDHVGILVISDAISWAESEGADLLIVESAGLCLRCSPYTT
FT                   QSLGIVVLSSISGVNTPLKMSAMLALADIAVVTRTDLVSQAEKEVFREKIREVNEGLDI
FT                   VETNAVQGTGLRYLFRAIDEQEEISDPQKITLKGAPPLGVCTICVGKKDIGWQNHFGVI
FT                   RKLEGADFLFRGD"
FT   gene            complement(295443..296222)
FT                   /locus_tag="Mpet_0284"
FT   CDS_pept        complement(295443..296222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0284"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1136 ABC-type antimicrobial peptide
FT                   transport system ATPase component; InterPro
FT                   IPR003593:IPR003439; KEGG: mem:Memar_0107 ABC
FT                   transporter-related protein; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: ABC transporter-related protein;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35061"
FT                   /db_xref="GOA:E1RFB3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFB3"
FT                   /protein_id="ADN35061.1"
FT                   /translation="MDPLTIEDITILPGRNRKGMTENFSSLTICPGDTISIVGPTGSGK
FT                   SALINDIEIFAHRDTVTGRTVLVNGEPAPEEFVRDPAKKPVALITQNTKCLADMTAGDF
FT                   LKMHVRSRKIEDEKIVERTIALANEFTGEKILPEVRMTSLSGGQTRSLMVADAIMISNA
FT                   PIILLDEIENAGIFKEKVIECLKTHHKALIFVTHDPVVSLLSAKRIVMKNGAVERILEP
FT                   GEEERDALAEIIRMDRTLCRLRELIRAGEIIRSVNPA"
FT   gene            296520..296828
FT                   /locus_tag="Mpet_0285"
FT   CDS_pept        296520..296828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0285"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yli:YALI0B06347g YALI0B06347p; SPTR:
FT                   YALI0B06347p"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35062"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFB4"
FT                   /protein_id="ADN35062.1"
FT                   /translation="MELSGADVATGIAEDEYIEFGISPFDELHEIELSINDALDSCGGD
FT                   ILPALYLLNYCRNLVEDGDMEEYIEACTLLSDTCRSLPGNRGGRLRAVGDYLDFCID"
FT   gene            296889..297380
FT                   /locus_tag="Mpet_0286"
FT   CDS_pept        296889..297380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0286"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="COGs: COG4800 transcriptional regulator protein with
FT                   an HTH domain; InterPro IPR001387; KEGG: mhu:Mhun_0501 XRE
FT                   family transcriptional regulator; PFAM: helix-turn-helix
FT                   domain protein; SMART: helix-turn-helix domain protein;
FT                   SPTR: Transcriptional regulator, XRE family; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35063"
FT                   /db_xref="GOA:E1RFB5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFB5"
FT                   /protein_id="ADN35063.1"
FT                   /translation="MFSQRIFQVGFKTALQEEIDRKGVSIRELAERAGIPVATLYKITS
FT                   GERDPRFSTVQAIVNALQPQDSDFVAVIAAKFLLDDIESSRPDVGAKKVKVRGYPAYTM
FT                   EECIISAVRAEKDGALGIVCAPVLASMIERIVEIPVVIMKPQAETIIEALKTLDRRLEK
FT                   "
FT   gene            complement(297402..299831)
FT                   /locus_tag="Mpet_0287"
FT   CDS_pept        complement(297402..299831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0287"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="COGs: COG2217 Cation transport ATPase;
FT                   InterProIPR001757:IPR000695:IPR006403:IPR006416:IPR
FT                   006121:IPR018303:IPR008250:IPR005834; KEGG: mem:Memar_1873
FT                   heavy metal translocating P-type ATPase; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; SPTR: Heavy metal translocating
FT                   P-type ATPase; TIGRFAM: heavy metal translocating P-type
FT                   ATPase; copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase; Heavy-metal-associated domain; haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: copper-(or
FT                   silver)-translocating P-type ATPase; heavy metal
FT                   translocating P-type ATPase; ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35064"
FT                   /db_xref="GOA:E1RFB6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFB6"
FT                   /protein_id="ADN35064.1"
FT                   /translation="MSEKPVKKTSLKVTGMHCAACAANVESALKKLEGVDSASVSIASE
FT                   DAQVSFDPEKISLGDIESTIKKSGYGVSLAEQKIKIGGMHCAVCAGSVKTALEKVNGVM
FT                   SADVNLVDNSAVISYIPGDTDKREFKTAVESAGFQYMGTEEDFSSEKEEEEFEKEQKNK
FT                   LVRIVLGLGTAAVLIAIMYSGLSAFIPVNLLMFIISTPVLIYLAYPIFSATFISLRNRT
FT                   LSMDVMYALGIGTAYIASVFGTFGIVLTSDFMFYETAVMLTAFLTLGRYLEANAKGRTN
FT                   DAVKKLLNLKPAKALVKKDGEYVEIPAEDLMEGAEILVKPGGRVPVDGTVLSGEAYVDE
FT                   SMITGEPVPVLKKQGDTVTGGTLLTGGSVAFTATKVGKDTVLSQIISLVEETQRTKPPV
FT                   QRIADVAVAWFIPVILLIAIVASSIWYFLLGSTTLFALTVFISIIVVACPCALGLATPT
FT                   AVTVGIGRGAELGILIRNGEALEISEKLKTIVFDKTGTLTRGKPEVTDITSFGMEEKEM
FT                   IGLAAAAENFSEHPIAKAILDYAKDKEIAVPEGENFRSEAGGGVEVTAGGKAVTAGTRD
FT                   FVSNSGAVIDEKTEETLAAYESAGKTTVTVAADGKIVGVLAISDVLKDSAGKAVSEIKA
FT                   MDLSVSMITGDNAITALSVAKEAGIDDVHANVLPGEKAAQVKKIREESGMTAFVGDGIN
FT                   DAPALAEADVGIAVGSGTDIALESADIVLMKSDLRDVAAAIQLSRKVMGRIKLNLFWAF
FT                   AYNTALIPVAAGVLYPFYGIIFRPEYAGAAMVLSSVTVISLSLMLKGYRPPAVAER"
FT   sig_peptide     complement(299766..299831)
FT                   /locus_tag="Mpet_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(299813..301273)
FT                   /locus_tag="Mpet_0288"
FT   CDS_pept        complement(299813..301273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0288"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789:IPR000014:IPR003594:IPR013767; KEGG:
FT                   mhu:Mhun_2026 putative PAS/PAC sensor protein; PFAM:
FT                   response regulator receiver; PAS fold domain protein;
FT                   ATP-binding region ATPase domain protein; SMART: response
FT                   regulator receiver; PAS domain containing protein;
FT                   ATP-binding region ATPase domain protein; SPTR: Putative
FT                   PAS/PAC sensor protein; TIGRFAM: PAS sensor protein; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   Response regulator receiver domain; PAS fold; TIGRFAM: PAS
FT                   domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35065"
FT                   /db_xref="GOA:E1RFB7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFB7"
FT                   /protein_id="ADN35065.1"
FT                   /translation="MIDILIVDDDPEVLDITKIFLERTGYFRVSTGNSAAEGLLKLEEQ
FT                   NFEAVISDYEMPDMNGLDFLKEIREEGNIIPFIIFTGRSREEVVIEAMNSGADYYIQKG
FT                   TDLKALFAELTHKVLLAVEKKRSEKALSEANEYKNRLIESHIDPLLTIDDSYKIMDINS
FT                   AMEKLSGYRKDEIEGKDLAVLFRDHENAKSALAIALKENNLRDYPLDIVTSYGEVIPIL
FT                   FHAAPYINEKMEFLGFFTEFHEYKEDKNEHAGEKISKNEFYLDILTHDIRNMIMVETGC
FT                   LEIDGNPEEEQSLWERRMRNLIGNVKHLIENTEAMRRSDENCHDLKPVELRPLICREAE
FT                   NYPDLDITIGDFGCMVVADDLLGSVFYNLFNNVKKHCGAGTEVRISVPEYEEGSEISVF
FT                   FEDSGPGIPNDIIEDFNVGDLAENGSSGKKSHGMGLIWSLIDNCGGQIMILTNEGRTGT
FT                   KYIISLKKHFPYEESLLLSEKSVCLKNR"
FT   gene            complement(301413..301577)
FT                   /locus_tag="Mpet_0289"
FT   CDS_pept        complement(301413..301577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hmg:100207798 similar to predicted protein;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35066"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFB8"
FT                   /protein_id="ADN35066.1"
FT                   /translation="MNSELLTHINGELKHVHDDIEHVERDIQELVAHLKNLDEHMHHMM
FT                   EEAETGKIQ"
FT   gene            301784..302476
FT                   /locus_tag="Mpet_0290"
FT   CDS_pept        301784..302476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0290"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="COGs: COG2095 Multiple antibiotic transporter;
FT                   InterPro IPR002771; KEGG: mhu:Mhun_1557 multiple antibiotic
FT                   resistance (MarC)-related proteins; PFAM: multiple
FT                   antibiotic resistance (MarC)-related protein; SPTR:
FT                   Multiple antibiotic resistance (MarC)-related proteins;
FT                   PFAM: MarC family integral membrane protein; TIGRFAM:
FT                   conserved hypothetical protein TIGR00427"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35067"
FT                   /db_xref="GOA:E1RFB9"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFB9"
FT                   /protein_id="ADN35067.1"
FT                   /translation="MEELSLFIAFFGALFALTNPFGNLPFFITYTEALTPRVQKAMAIL
FT                   LSVFLVVFFGLFFFAGNAILHFFGISIPAFQIAGGIIVLIIALSMVSGEHMDRQKKIMH
FT                   VDGVSGENKSLEEDFEEAEAFLPKVLVPLGIPIYAGPGALSVVIMYGNKAFSAGWGAVI
FT                   YSLIVIVVICLIVCIVNFLATPIRSGLGDQGLEILVRIMGLILAAIAVTLFIEGLAAIN
FT                   STFTVPAV"
FT   gene            302523..302963
FT                   /locus_tag="Mpet_0291"
FT   CDS_pept        302523..302963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0291"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="COGs: COG1321 Mn-dependent transcriptional regulator
FT                   protein; InterPro IPR001367; KEGG: mem:Memar_2411 iron
FT                   dependent repressor; PFAM: iron dependent repressor; SMART:
FT                   iron dependent repressor; SPTR: Iron dependent repressor;
FT                   PFAM: Iron dependent repressor, metal binding and
FT                   dimerisation domain; Iron dependent repressor, N-terminal
FT                   DNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35068"
FT                   /db_xref="GOA:E1RFC0"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFC0"
FT                   /protein_id="ADN35068.1"
FT                   /translation="MMMTSYRGKKLTRKTEDYLEAILVVSLEKGYAKTRDVAALLAVTP
FT                   SSTVEMFIKLDKMGLIEYRKYEGVRLKSDGLEIARTIKFRHDTLFNFLRLIGVNNDIAD
FT                   RDACKMEHELDRETISAIDSLVDFLGRDDNKGILNDLKRYRE"
FT   gene            303252..303404
FT                   /locus_tag="Mpet_0292"
FT   CDS_pept        303252..303404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35069"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFC1"
FT                   /protein_id="ADN35069.1"
FT                   /translation="MSHSGGRSSIGGVRDLSRISPVLLELAGLKSKTESSLETGNKQVY
FT                   GGVRM"
FT   gene            303665..304129
FT                   /locus_tag="Mpet_0293"
FT   CDS_pept        303665..304129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0293"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="COGs: COG1321 Mn-dependent transcriptional regulator
FT                   protein; InterPro IPR001367; KEGG: mem:Memar_2411 iron
FT                   dependent repressor; PFAM: iron dependent repressor; SMART:
FT                   iron dependent repressor; SPTR: Iron dependent repressor;
FT                   PFAM: Iron dependent repressor, metal binding and
FT                   dimerisation domain; Iron dependent repressor, N-terminal
FT                   DNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35070"
FT                   /db_xref="GOA:E1RFC2"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFC2"
FT                   /protein_id="ADN35070.1"
FT                   /translation="MSGKIHLSRKAEDYLEAIYVVSREKGYARTKDVAAELKVSPSSVV
FT                   EMFRKLDKQGLVRYRKYEGVVPNPEGLRIGKMIKSRHDTLKAFFMRIGVPEDIADEDAC
FT                   MMEHELNPRSIEQIQFLLNFVDERADRSHTFADFEAYCRIRRSEEDKSDL"
FT   gene            304304..304528
FT                   /locus_tag="Mpet_0294"
FT   CDS_pept        304304..304528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0294"
FT                   /product="FeoA family protein"
FT                   /note="InterPro IPR007167; KEGG: mem:Memar_2417 FeoA family
FT                   protein; PFAM: FeoA family protein; SPTR: FeoA family
FT                   protein; manually curated; PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35071"
FT                   /db_xref="GOA:E1RFC3"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFC3"
FT                   /protein_id="ADN35071.1"
FT                   /translation="MFLTELSQSERGRITMIPGWGRARQDLALRGLSEGCTVKMISAGC
FT                   GPVVVEVKGITLAIGRRMAGRIRVLRIDS"
FT   gene            304544..304765
FT                   /locus_tag="Mpet_0295"
FT   CDS_pept        304544..304765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0295"
FT                   /product="FeoA family protein"
FT                   /note="InterPro IPR007167; KEGG: mem:Memar_2416 FeoA family
FT                   protein; PFAM: FeoA family protein; SPTR: FeoA family
FT                   protein; PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35072"
FT                   /db_xref="GOA:E1RFC4"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFC4"
FT                   /protein_id="ADN35072.1"
FT                   /translation="MKKKLSEMDFGDYGTVCEISSNKSGLRALGVREGKTLTMVTKQPV
FT                   KGPVVVMLGEVEVAMGLEMADSVFVECS"
FT   gene            304783..306613
FT                   /pseudo
FT                   /locus_tag="Mpet_0296"
FT   gene            306620..307096
FT                   /locus_tag="Mpet_0297"
FT   CDS_pept        306620..307096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_2413 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35073"
FT                   /db_xref="GOA:E1RFC5"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFC5"
FT                   /protein_id="ADN35073.1"
FT                   /translation="MKNSSNEKFSGLSIYVLVIGIVAFAFGCADILVWAGFSPGIEFGI
FT                   MEIAGDDFFRWAWGGLVVLMGGVIMLSGAVKSYDIRQFAKVTLGALMVLMIAATDLFAR
FT                   FCESIPAGEDSPEFFNSLGGFIGGFAPPYSPAILLLPFILVLVYLAVRYDKENQ"
FT   sig_peptide     306620..306700
FT                   /locus_tag="Mpet_0297"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            307790..308038
FT                   /locus_tag="Mpet_0298"
FT   CDS_pept        307790..308038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0298"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Basic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35074"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFC6"
FT                   /protein_id="ADN35074.1"
FT                   /translation="MPEKKKFEAFPSLLNTKGRTGSLDNVKSGQEFHRTVNISGILKPG
FT                   FKEIYNFGEILSAMRDKNCDQNTEGSLTGIFKKVTSL"
FT   gene            308111..309091
FT                   /locus_tag="Mpet_0299"
FT   CDS_pept        308111..309091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0299"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterPro IPR003594:IPR005467:IPR011495; KEGG: mbn:Mboo_1806
FT                   signal transduction histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase
FT                   dimerisation/phosphoacceptor; SMART: ATP-binding region
FT                   ATPase domain protein; SPTR: Signal transduction histidine
FT                   kinase; PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35075"
FT                   /db_xref="GOA:E1RFC7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFC7"
FT                   /protein_id="ADN35075.1"
FT                   /translation="MVKGGYFFTVLIFIVVLAGMVLPGSCTTGLGFDQASNPGSGLICA
FT                   VDNGPGQTGIQGSPSYNSGDLPVEKELRQSLFEIPVLNDYIAVGTTIILSFSAVLFIGY
FT                   FYSSRLKMTRNGYIKMIEERETLLSGVNERFNNTFAVICSLISMQILNSNEEETKQKLT
FT                   EINNRILSISLVHKCLLQSKVVSKVNIHDVFLSLGEQMVQTYFLGKDIDFKVKGEECLL
FT                   DIDQAIPLSMVMNEIISNSLKYAFAGRVSGDISVDYNCENDKFELCVRDDGVGIPGNLI
FT                   DESQESLGLSLIRNLVSLQLKGSADLTVESGTKWMITFPVKIEDT"
FT   sig_peptide     308111..308164
FT                   /locus_tag="Mpet_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(309153..309914)
FT                   /locus_tag="Mpet_0300"
FT   CDS_pept        complement(309153..309914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0300"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="COGs: COG1378 transcriptional regulator protein;
FT                   InterPro IPR002831; KEGG: mac:MA0287 hypothetical protein;
FT                   PFAM: transcriptional regulator TrmB; SPTR: Putative
FT                   uncharacterized protein; PFAM: Sugar-specific
FT                   transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35076"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFC8"
FT                   /protein_id="ADN35076.1"
FT                   /translation="MPEELVENLRNYGFTEYEAKAYTAIVGLGRGTAREICEISGVPQG
FT                   RIYTVLNTLADRAFLEIQEGTPTFYLAENPAEVFAAIKDEYCNSIDEMIEDLRKLNYEA
FT                   KPPSPFWSIHSEQGIINREKMLIRYAEHDIIIIIKDPAPLRPLLRDLKAAKKQVKLTIL
FT                   SDNIERSTYEALRIEEMSSDLSGLFMEMGRLGPVMKDPGWKTELFMIIDGVTAFTAGYR
FT                   AGRKSATVIKMPPICFMMKRLIEILEPAARE"
FT   gene            310018..311475
FT                   /locus_tag="Mpet_0301"
FT   CDS_pept        310018..311475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0301"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR001411:IPR004638:IPR011701; KEGG: mpd:MCP_1479 MFS
FT                   transporter; PFAM: major facilitator superfamily MFS_1;
FT                   SPTR: MFS transporter; TIGRFAM: drug resistance
FT                   transporter, EmrB/QacA subfamily; PFAM: Major Facilitator
FT                   Superfamily; TIGRFAM: drug resistance transporter,
FT                   EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35077"
FT                   /db_xref="GOA:E1RFC9"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFC9"
FT                   /protein_id="ADN35077.1"
FT                   /translation="MKNQNKENTGRYDRNKRKTVMAVALLGMYMSVLDGVIISIALPTI
FT                   TSYFDADIALSQWTITGYYVAMTAAMLLFARLSESSGKNRMFLAGMAIFTISSLGCGLA
FT                   PSLPVLIGFRIIQGLGAAMSVSIVMAIIFELYPFSEHGKAMGLLGSTIALASLSGPVLG
FT                   GFLLGVFGWHAIFMINVPIGILLVAFGIYSMDLDKPEKSVKEKMDWIGAGTLAVAIASS
FT                   MLFLGLIAEDTTIGVYVIAALFVCIVSLALFIITERRRSDPLLDLSVFSERMFVVPLLC
FT                   MALVFTAYMILSVSLPFYLEGVMDFSSLEVGVVFVLVAAILTVGAPFVGRFYDLHPWKY
FT                   FTGIGLFIGAFGFLAVAYFAQIMDLTLLIGALIIFAIGFTLFQSPINAEIMHGLPIEKS
FT                   ALASGLNSAGRQYAMGLGSSVASIIFAFQLQQEGYTGVVTDAAPSLIADATTVAMIVAA
FT                   LLCFAGVVLQALKRNSGGEKNTAMLKT"
FT   gene            complement(311501..311797)
FT                   /locus_tag="Mpet_0302"
FT   CDS_pept        complement(311501..311797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0302"
FT                   /product="Domain of unknown function DUF1805"
FT                   /note="COGs: COG3377 conserved hypothetical protein;
FT                   InterPro IPR014931; KEGG: mem:Memar_2012 hypothetical
FT                   protein; PFAM: Domain of unknown function DUF1805; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DUF1805)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35078"
FT                   /db_xref="InterPro:IPR014931"
FT                   /db_xref="InterPro:IPR036493"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFD0"
FT                   /protein_id="ADN35078.1"
FT                   /translation="MKGEIIRLGKKEIEGFVIPIGKVNLVFARTDKGLVGCGAFDVMAL
FT                   EKFGYAAAKVRPKGESVGDLDDLMNGEIAAANPSAEKLGIKEGMTGKDAIALL"
FT   gene            complement(311911..312750)
FT                   /locus_tag="Mpet_0303"
FT   CDS_pept        complement(311911..312750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0303"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="COGs: COG0863 DNA modification methylase; InterPro
FT                   IPR001091:IPR017985:IPR002941; KEGG: mem:Memar_1626 DNA
FT                   methylase N-4/N-6 domain-containing protein; PFAM: DNA
FT                   methylase N-4/N-6 domain protein; SPTR: DNA methylase
FT                   N-4/N-6 domain protein; PFAM: DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35079"
FT                   /db_xref="GOA:E1RFD1"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFD1"
FT                   /protein_id="ADN35079.1"
FT                   /translation="MKKNNINENSEYAELNVIYNVDCLKGMKKIPDNFIDIIVTSPPYN
FT                   IGIKYNTHNDNQPLDSYLNWMNLISKEFKRILKDDGSIFLNIGGKPSDLWIPFDVLNEF
FT                   RSDFKLQNIIHWIKSIAIEKKDVGNYDCLRKDMAVGHYKPVNSKRFLSQCHEHIFHLTK
FT                   NCDINLDKLSIGVKYQDKSNIGRWKSANSDKRERGNVWFIPYETILSSRPHPTSFPVRL
FT                   PEMCIKLHGFDEKTVVMDPFMGIGSTALACKKLETNYVGFEIDKEYYKFALERLAKY"
FT   gene            312853..314562
FT                   /locus_tag="Mpet_0304"
FT   CDS_pept        312853..314562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0304"
FT                   /product="protein of unknown function DUF262"
FT                   /note="InterPro IPR004919:IPR011089; KEGG: mno:Mnod_7747
FT                   protein of unknown function DUF262; PFAM: protein of
FT                   unknown function DUF262; protein of unknown function
FT                   DUF1524 RloF; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF1524); Protein of unknown
FT                   function DUF262"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35080"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFD2"
FT                   /protein_id="ADN35080.1"
FT                   /translation="MVDENFTSRKTGISDILLNDIKYVVPPYQRDYSWEVEQLDKMWED
FT                   LNESVETNSHFLGSMIFQISGNKKEYIVIDGQQRLATITILLAVIRDLLSKKGMDNSGA
FT                   IRINQNYILKEFEGEEETKKLELNLRNKDFFYNCIQKFSDESSESKFKDYEQNFGKLEK
FT                   TNKKIKDAYFYFEKRILDNIENLDLERTQKYLNNITKTIRGNLILIETLVVSEEEAYLI
FT                   FETINDRGLDLSVSDLFKNYLIRKSSQDTRDEIVGIWNEIALSLDEKIRPFLLHYWLYK
FT                   YEDTTEKKLFSKLHELIEKKNVKVLNFVTDLKKEAIVYSNLLNPSISYWNDDDTVELLE
FT                   DLNILGITQCMPILMSSRYHFSGNNKEFKKVIKVLINFTFRYRTICNLANNAQDRVFKI
FT                   ITKKLRTGDIKYANQISQQLKDIFPNNEEFKGNFIEKEFRIPKLAKYLLEQIELKIKDY
FT                   PENLDFKSLTLEHIFPKNPDNEWIEYLKNQNSHLIENSEKYVYKIGNMTLLDLKMNKGA
FT                   SNYIFPKKRDEYYFNSHMKINEELKEKACWNETIINERSANFANLALDIWKL"
FT   gene            314570..314767
FT                   /pseudo
FT                   /locus_tag="Mpet_0305"
FT   gene            315046..315441
FT                   /pseudo
FT                   /locus_tag="Mpet_0306"
FT   gene            315725..316132
FT                   /locus_tag="Mpet_0307"
FT   CDS_pept        315725..316132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0307"
FT                   /product="Sporulation protein YtfJ"
FT                   /note="COGs: COG3874 conserved hypothetical protein;
FT                   InterPro IPR014229; KEGG: mhu:Mhun_1634 hypothetical
FT                   protein; PFAM: Sporulation protein YtfJ; SPTR: Putative
FT                   uncharacterized protein; PFAM: Sporulation protein YtfJ
FT                   (Spore_YtfJ)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35081"
FT                   /db_xref="InterPro:IPR014229"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFD3"
FT                   /protein_id="ADN35081.1"
FT                   /translation="MSSEELFEKTLKEVDRLIHEGSTLGDPVEINGCTIIPVFAYGFGF
FT                   GAGFGGSDKTGQSGGAGAGGGISPIALVVIDKNTEGIEGVRVVPVKKPGPVTEAINAIG
FT                   EEIIPKVVEMMNKKEEEGKEEVKKEETKKGK"
FT   gene            316151..316783
FT                   /locus_tag="Mpet_0308"
FT   CDS_pept        316151..316783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mem:Memar_0067 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF2953)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35082"
FT                   /db_xref="GOA:E1RFD4"
FT                   /db_xref="InterPro:IPR021338"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFD4"
FT                   /protein_id="ADN35082.1"
FT                   /translation="MFSFLLAAALIIGIILVVLAVHILVLPVKISGRLRSNRSDLFLTW
FT                   IRWGFLRVSVKVSASGIATFYLFSFRLKEFSMGKEGTSPEETEKDKQPFDPGKIKPLLD
FT                   EAAVILREISFDYLRVNARVGLGDPAGTGMLFGLVSALKGVLSCSDRFKLNVLPVFETE
FT                   ALECDIEAGFRIGRFYRIIAPAIRIFRISGEKKERNKVDIAGGVPAA"
FT   sig_peptide     316151..316210
FT                   /locus_tag="Mpet_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            316780..316983
FT                   /locus_tag="Mpet_0309"
FT   CDS_pept        316780..316983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35083"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFT1"
FT                   /protein_id="ADN35083.1"
FT                   /translation="MKIVKEKITSGKVTAGGVKISSAADISAFAYPGGFVLSVCPISII
FT                   VETESGTYSFDLKREELPLQIR"
FT   gene            complement(316990..318135)
FT                   /locus_tag="Mpet_0310"
FT   CDS_pept        complement(316990..318135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0310"
FT                   /product="protein of unknown function DUF214"
FT                   /note="COGs: COG4591 ABC-type transport system involved in
FT                   lipoprotein release permease component; InterPro IPR003838;
FT                   KEGG: mhu:Mhun_2932 hypothetical protein; PFAM: protein of
FT                   unknown function DUF214; SPTR: Putative uncharacterized
FT                   protein; PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35084"
FT                   /db_xref="GOA:E1RFT2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFT2"
FT                   /protein_id="ADN35084.1"
FT                   /translation="MSTPIFFEFAKRSVRLHWLRSLLAVIGIVIGVAAIASMGMLGNSL
FT                   TLSISDSLSDVGDSVVVYSHGGSVVDDKITKRMLKDIVRAAGSNDVIPVYNTADEIEAG
FT                   GEEGFVTVYAFETQDIPVILDLEEGQYLKSSAGALAGSRIAEEYDLKVGSRVKLGDDNL
FT                   RIVGILKERGMGFDINPDSALVVTDKFFSSTYDQEDYDFVVVKMRNLDDIEDVKDSIDA
FT                   KMNKKDDVVDIFDTKAILEAISSAFSQISMFTTAIGGISLVVAGVSIFNIQMMSVTERI
FT                   KEIGIIRSIGTKKSEVLKMFLYEAFLLGLFGAIVGAFFSFVAGFVVLMVMLNSTTYLFE
FT                   PSTLVYIPYGMLFGIGTSLISGFYPAWKAANLNPIEALRFE"
FT   sig_peptide     complement(318028..318135)
FT                   /locus_tag="Mpet_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(318132..318797)
FT                   /locus_tag="Mpet_0311"
FT   CDS_pept        complement(318132..318797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0311"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1136 ABC-type antimicrobial peptide
FT                   transport system ATPase component; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: mhu:Mhun_0321 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: ABC transporter related; PFAM: ABC
FT                   transporter; TIGRFAM: putative bacteriocin export ABC
FT                   transporter, lactococcin 972 group"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35085"
FT                   /db_xref="GOA:E1RFT3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFT3"
FT                   /protein_id="ADN35085.1"
FT                   /translation="MHVIQLEGVSRIYRMTFGDVVALNNVSLSIEEGDFIAIMGPSGSG
FT                   KSTLLNMIGSLDVPTKGRLYINGTDVSRLSDDQLTDLRRDTIGFIFQQFNLIPLLTVRE
FT                   NVEYPYILKYRKKDTEGRCDELIRQMGLTESLSHHKPNELSGGQQQRVAIARALVNDPK
FT                   ILLCDEPTGNLDSKTGLQVMELLKSLNEQGKTIIMVTHDNHIAEYSKRIITIADGEIQ"
FT   gene            complement(318825..319997)
FT                   /locus_tag="Mpet_0312"
FT   CDS_pept        complement(318825..319997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_1820 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: CARDB"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35086"
FT                   /db_xref="GOA:E1RFT4"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFT4"
FT                   /protein_id="ADN35086.1"
FT                   /translation="MKSGIIILLILTAFLATAASAASTSTNDAASYIEITSYEVSPSVF
FT                   MKGDTGTIQVTIKNTGTSSVEIQSADLFSKDLTLVNEESYSTVGTVGPGTSRDFTFTIK
FT                   ADASDGIYYPRFYINFAGGGSMSGLIPVKVESTPLEISIIDIPDEFGKDVKDPVTVLVG
FT                   NPRENAVNGVVVKPESDTASFIQNSYFIGELQSDGSQQVEFEVIPLESGKIVFNVEYRN
FT                   GINLHTTEQVLTYTIGEGKMDAEIVVNNVEVSSGSSYYTVTGDVTNAGLKNAKSVIVTS
FT                   SDPAVPTDPNRLYVVGELEPDDFSSFEVTFTAENTKEIPLSIIYKDEDGNSYEEKVTVS
FT                   LGASYSQSSGQSSQDSSGDGFPVGLVILVIIIAAGVGGAILYSWKKEGRL"
FT   sig_peptide     complement(319935..319997)
FT                   /locus_tag="Mpet_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(320009..320644)
FT                   /locus_tag="Mpet_0313"
FT   CDS_pept        complement(320009..320644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0313"
FT                   /product="Protein of unknown function DUF2143"
FT                   /note="InterPro IPR019222; KEGG: mbn:Mboo_0062 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2143; SPTR:
FT                   Hypothetical membrane protein; PFAM: Yip1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35087"
FT                   /db_xref="GOA:E1RFT5"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFT5"
FT                   /protein_id="ADN35087.1"
FT                   /translation="MISVKEILITPGHFFEKKCREEASLKVPVLIVLITAVISGISAYI
FT                   VSGKTIEAMGSGLEGYAFIASLFGFAVAFIGMFISWAIWALAFLVMIYILKGTATFKQL
FT                   AEVAGYGFIPQIFGGIITTAIMMTSIQNLVIPATSNMQEIEVAMKAFTTSAPMMAASFV
FT                   SIIFTIWSANIWLFGIKESSGLEFKKAAICVGVPLVIFIILSLSSFVM"
FT   gene            complement(320753..321136)
FT                   /locus_tag="Mpet_0314"
FT   CDS_pept        complement(320753..321136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0314"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfo:BRAFLDRAFT_205481 hypothetical protein;
FT                   SPTR: MOSC domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35088"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFT6"
FT                   /protein_id="ADN35088.1"
FT                   /translation="MKEILVLWSHADDPAIPPLVCPDTCRTVKEVVIDFQNARGTDKCR
FT                   ITFSEEILKGKKGNDSSLTIDGLPLEELVPLPDPSKYCGMACEGCGTGKKGEERSCSRI
FT                   YEQIPESVLRLALSKALEKRITG"
FT   gene            complement(321146..321565)
FT                   /locus_tag="Mpet_0315"
FT   CDS_pept        complement(321146..321565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0315"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /note="COGs: COG0394 Protein-tyrosine-phosphatase; InterPro
FT                   IPR017867; KEGG: srm:SRM_02678 low molecular weight
FT                   phosphotyrosine protein phosphatase; PFAM: Protein-tyrosine
FT                   phosphatase, low molecular weight; SMART: Protein-tyrosine
FT                   phosphatase, low molecular weight; SPTR: Low molecular
FT                   weight phosphotyrosine protein phosphatase; PFAM: Low
FT                   molecular weight phosphotyrosine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35089"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFT7"
FT                   /protein_id="ADN35089.1"
FT                   /translation="MRIVNENRSVLFICTHNSVRSFMAEYIGRSKYPDIVFRSAGIYPL
FT                   EPDPAAGAVLKEEGIDTGDHRPSTIGSYSGDCFDLIVFMCPHAMRNAYSLPKSKEILLH
FT                   EISVPAGGTGNLSGFRELRDSLKVFIDEIAETIRI"
FT   gene            complement(321562..322266)
FT                   /locus_tag="Mpet_0316"
FT   CDS_pept        complement(321562..322266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_0521 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Putative small
FT                   multi-drug export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35090"
FT                   /db_xref="GOA:E1RFT8"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFT8"
FT                   /protein_id="ADN35090.1"
FT                   /translation="MEAEYTNSEIRILNAGKIVLNLALPFAILGFYILILWMLLPYSLF
FT                   LSMLTLMFIYFVPPAGKESVIPIGIALGIPWWTVAFSIAMMDILSTLFMVLNFDLVLKI
FT                   PIAGTKWMKTFMEHGESFFRKHRWLEKLSTLGLAIFVMIPMQGTGGIATPIVGRMIGIP
FT                   PLQIILAVIAGALSGCFLIALGSEFLKDLLVYNLSLGIIVIIAIAVCAAAAWFLWKRKQ
FT                   NRLKERKPVHRI"
FT   gene            complement(322315..322998)
FT                   /locus_tag="Mpet_0317"
FT   CDS_pept        complement(322315..322998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0933 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Putative small
FT                   multi-drug export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35091"
FT                   /db_xref="GOA:E1RFT9"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFT9"
FT                   /protein_id="ADN35091.1"
FT                   /translation="MTDLISPEVPEIKDPFIKRLLFLTLPFIVIGIYIFLLYIILTPEK
FT                   FEIILGLMAINLIPPAGKESVIPLGIAAGIPWYIIGTTTAMMDVAAALFMILNFDLALK
FT                   IPILGKWIYGFMHKGSAFFLKYKWLEGLSIFGLMIFVMVPFQGSGGIGGTLLGRIMGLP
FT                   PLQLFIGIAAGSFLGSYILAIGFEFATSVLAINPLYLALVIVALVIIATATNYFYKKMK
FT                   NSRES"
FT   gene            complement(323003..324148)
FT                   /locus_tag="Mpet_0318"
FT   CDS_pept        complement(323003..324148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0318"
FT                   /product="aminotransferase class I and II"
FT                   /EC_number="2.6.1.1"
FT                   /note="COGs: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; InterPro IPR004839:IPR004838; KEGG:
FT                   mbn:Mboo_0056 aspartate aminotransferase; PFAM:
FT                   aminotransferase class I and II; SPTR: Aminotransferase,
FT                   class I and II; PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35092"
FT                   /db_xref="GOA:E1RFU0"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFU0"
FT                   /protein_id="ADN35092.1"
FT                   /translation="MRPLSEKISSIPPSATIEITDRARRMKSEGIDVISLSIGEPDFET
FT                   PKHITDACINALREGKTHYEASQGTLELREAISEKLRKDNGVDVDASGIVVACGAKNNI
FT                   YEAMEACLNPGDEVIIIDPSWVSYEPAVRIAGGTPVHHSLNGKDFQIDDSLLEKVTGKT
FT                   KMIVLNTPSNPTGSVLSKESLSIVADICRDNDIIALSDEIYEKLIYDKEHLSIGAMNDM
FT                   AERTITINGFSKAYAMTGWRIGYAAASPEIAKAMTKVQQHTISHPATFAMWGALAALKG
FT                   DQSCIKDMRVEFDRRRRYVCGELESMGFKTAPADGAFYAFVNINGDDMERGERWLEEAH
FT                   LAATPGTAFNAPGWIRISYAAKMDTLKEAMRRIREFEDRRD"
FT   gene            complement(324174..324581)
FT                   /locus_tag="Mpet_0319"
FT   CDS_pept        complement(324174..324581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0319"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="COGs: COG0054 Riboflavin synthase beta-chain;
FT                   InterPro IPR002180; KEGG: mhu:Mhun_2477
FT                   6,7-dimethyl-8-ribityllumazine synthase; PFAM:
FT                   67-dimethyl-8-ribityllumazine synthase; PRIAM: Riboflavin
FT                   synthase; SPTR: 6,7-dimethyl-8-ribityllumazine synthase;
FT                   TIGRFAM: 6,7-dimethyl-8-ribityllumazine synthase; PFAM:
FT                   6,7-dimethyl-8-ribityllumazine synthase; TIGRFAM:
FT                   6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35093"
FT                   /db_xref="GOA:E1RFU1"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFU1"
FT                   /protein_id="ADN35093.1"
FT                   /translation="MTVKLGFVVAEFNRDLTYMMEIEGEEHAKFLGAEVTERIYVPGAY
FT                   DMPLAIKKMLKENKVDAVVTIGCVIEGATQHDEIVVQHAARKIIDLSLEFDKPVTLGIS
FT                   GPGMTRLEATERIDYAKRAVESAIKLVKRLK"
FT   gene            complement(324649..325110)
FT                   /locus_tag="Mpet_0320"
FT   CDS_pept        complement(324649..325110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0320"
FT                   /product="riboflavin synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="COGs: COG1731 riboflavin synthase; InterPro
FT                   IPR002180:IPR006399; KEGG: mpl:Mpal_0419 riboflavin
FT                   synthase; PFAM: 67-dimethyl-8-ribityllumazine synthase;
FT                   PRIAM: Riboflavin synthase; SPTR: Riboflavin synthase;
FT                   TIGRFAM: riboflavin synthase; PFAM:
FT                   6,7-dimethyl-8-ribityllumazine synthase; TIGRFAM:
FT                   riboflavin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35094"
FT                   /db_xref="GOA:E1RFU2"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR006399"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFU2"
FT                   /protein_id="ADN35094.1"
FT                   /translation="MKVGVADTTFARVDMGAEAIDELRRHASVAIERYTVPGVKDLPVA
FT                   SKILLEERKCDIVIALGMPGGKEKDRMCAHEASQGLIRAQLMTNKHIIEVFVHEDEAEN
FT                   DSELAWLAKRRAREHAENAVLLIQHPERLVKQAGTGQRQGFEDAGPARQ"
FT   gene            complement(325127..326257)
FT                   /locus_tag="Mpet_0321"
FT   CDS_pept        complement(325127..326257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0321"
FT                   /product="aminotransferase class V"
FT                   /note="COGs: COG0075 Serine-pyruvate aminotransferase/
FT                   aspartate aminotransferase; InterPro IPR000192; KEGG:
FT                   mhu:Mhun_2475 serine--glyoxylate transaminase; PFAM:
FT                   aminotransferase class V; SPTR: L-aspartate
FT                   aminotransferase / phosphoserine aminotransferase; PFAM:
FT                   Aminotransferase class-V"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35095"
FT                   /db_xref="GOA:E1RFU3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFU3"
FT                   /protein_id="ADN35095.1"
FT                   /translation="MQDEILLMMPGPVPMPQRVRMAMARQAINHRGPEFGECLNDINRM
FT                   LKPMFGTKNDCLILSGSGTAGMEAAVANFCAKKKIACLVNGKFGERLYDIGKIYASEAV
FT                   ELSSEWGTPLPLERLEEELENGVEAVTLVHNETSAAIKNPAEAVGKLCKKHDALFIMDG
FT                   ITSIGGDEVLADKWGADVAIVGSQKCLAAPAGLSAVSVSDKAWENIAEWRPYYLDLKKY
FT                   KKSAEKNETPYTPAVPLFFALREACRIVEEEGLEKRIARHRNLADAVRAAAAAWELDLY
FT                   PTVDELHTYSNTATAICYPEGIKDSEFRGLVKKEGIEFSGGQDRLKGKIFRIGTMGATG
FT                   VPEVLAVIGAAEKALRQLGYERGTCGVKAAAKVLNA"
FT   gene            326717..327106
FT                   /locus_tag="Mpet_0322"
FT   CDS_pept        326717..327106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0322"
FT                   /product="Phosphoribosylaminoimidazole carboxylase"
FT                   /EC_number="4.1.1.21"
FT                   /note="COGs: COG0041 Phosphoribosylcarboxyaminoimidazole
FT                   (NCAIR) mutase; InterPro IPR000031; KEGG: rci:RCIX236
FT                   phosphoribosylaminoimidazole carboxylase; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; PRIAM: Phosphoribosylaminoimidazole
FT                   carboxylase; SPTR: Phosphoribosylaminoimidazole
FT                   carboxylase; PFAM: AIR carboxylase; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, PurE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35096"
FT                   /db_xref="GOA:E1RFU4"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFU4"
FT                   /protein_id="ADN35096.1"
FT                   /translation="MSGVAIISGSASDSHIVEKVKAVLDENNTKYDIQVLSAHRNPVEL
FT                   EKYIAGSDAEVFICIAGLSAALPGVVASRTDKPVIGVPVSGTLGGLDALLSIAQMPKGV
FT                   PVACVGIDNGANAAHLALRILKLKK"
FT   gene            complement(327113..328381)
FT                   /locus_tag="Mpet_0323"
FT   CDS_pept        complement(327113..328381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0323"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="COGs: COG0422 Thiamine biosynthesis protein ThiC;
FT                   InterPro IPR002817; KEGG: mbn:Mboo_0044 thiamine
FT                   biosynthesis protein ThiC; PFAM: thiamine biosynthesis
FT                   protein ThiC; SPTR: Thiamine biosynthesis protein ThiC;
FT                   TIGRFAM: thiamine biosynthesis protein ThiC; PFAM: ThiC
FT                   family; TIGRFAM: thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35097"
FT                   /db_xref="GOA:E1RFU5"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFU5"
FT                   /protein_id="ADN35097.1"
FT                   /translation="MQTLARECKSGIPEIVRKTAESQNIEPERLARSIAAGKAVIPANR
FT                   IREHKLCAIGEGCTVKVNVNIGTSGIRCDPGLEIEKAKCAISEGADAIMDLSTGGDLEE
FT                   MRKKILDLDITVGTVPVYEAVRRAGSAPDLDSDTLFNVIRDHCKQGVDFLTLHCGVNRQ
FT                   ALDALKKDPRVMGVVSRGGAFHIAMMTASGEENPLFAEYDYLVEMLAEYDVVISLGDGM
FT                   RPGAMVDAVKRAKAVEYLTLGDLAQRAHEAGVQRMIEGPGHIPIDQIEYNVRMIKELTA
FT                   GAPLYLLGPLVTDIVPGYDHVSGAIGGAIAAMNGADFLCMVSPSEHLALPSVEDIREGT
FT                   RVAKLAAHVGDTIRPGINWFGTGEEEMAYARRDLDWKKQFSLAMFGEHAKQIHERDGET
FT                   DTCSMCGDLCAVKIVRESLYKDS"
FT   gene            328421..329026
FT                   /locus_tag="Mpet_0324"
FT   CDS_pept        328421..329026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0324"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; InterPro IPR001969; KEGG: mem:Memar_0052
FT                   beta-lactamase domain-containing protein; SPTR:
FT                   Beta-lactamase domain protein; PFAM: Metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35098"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFU6"
FT                   /protein_id="ADN35098.1"
FT                   /translation="MPVEWIPGTGYFSNSYVYGSVLIDTGATPTAVEPYRDDIGTIVLT
FT                   HCHYDHIAHLREIRDMCGNPEICIHELDAPGITEPSRSLSTMFGERGPDIGPDVILSEG
FT                   DEIGGLKVIHTPGHTPGGICLYDAEEMVLFSGDTVFADGAFGRFDFPGGSLEQLSNSVK
FT                   KLSELDVEGLCPGHGTPAFSNGRRHILAALRALNTGYF"
FT   gene            329030..329464
FT                   /locus_tag="Mpet_0325"
FT   CDS_pept        329030..329464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0325"
FT                   /product="protein of unknown function DUF123"
FT                   /note="COGs: COG1833 conserved hypothetical protein;
FT                   InterPro IPR002837:IPR000305; KEGG: mac:MA4145 endonuclease
FT                   III; PFAM: protein of unknown function DUF123; SMART:
FT                   Excinuclease ABC C subunit domain protein; SPTR:
FT                   Endonuclease III; PFAM: Domain of unknown function DUF123"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35099"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR002837"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFU7"
FT                   /protein_id="ADN35099.1"
FT                   /translation="MNEKGIYCLVFRNPGTTLGIGSLGDVEFSPGWHIYVGSALGQAGF
FT                   SRVRRHVSLSVEKNKKPRWHVDYLLTSAYFELESVFCGKTAERLECILAGLLGGENVPG
FT                   FGCSDCRCGSHFFHRDDNPEDEVRSAFEALNLPVHMKKIK"
FT   gene            329487..330065
FT                   /locus_tag="Mpet_0326"
FT   CDS_pept        329487..330065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0326"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="COGs: COG0655 Multimeric flavodoxin WrbA; InterPro
FT                   IPR005025; KEGG: mem:Memar_0050 NADPH-dependent FMN
FT                   reductase; PFAM: NADPH-dependent FMN reductase; SPTR:
FT                   NADPH-dependent FMN reductase; PFAM: NADPH-dependent FMN
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35100"
FT                   /db_xref="GOA:E1RFU8"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFU8"
FT                   /protein_id="ADN35100.1"
FT                   /translation="MKVLGISGSMRPEGNTSILVKRVVDYIEAEGCDEFNTEYISLAGK
FT                   KISPCIGCDKCRETKWCVLDDDWDDIAEKLMECDILILGSPTYYYDVNGQTKNFIDRTY
FT                   SLFHDRKLAGKYAVVISVCADRGGERTLSTLEGFVNTHEFGYIGYVAGKGAAAGDVRKD
FT                   ESAMAKSIEVAENILKMVSRTHRDGKRKQ"
FT   gene            330142..333438
FT                   /locus_tag="Mpet_0327"
FT   CDS_pept        330142..333438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0327"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="COGs: COG0457 FOG: TPR repeat; InterPro
FT                   IPR013105:IPR001440:IPR019734:IPR013026; KEGG:
FT                   mar:MAE_58050 tetratricopeptide TPR_2; PFAM:
FT                   Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SMART: Tetratricopeptide repeat;
FT                   SPTR: Tetratricopeptide repeat family; PFAM:
FT                   Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35101"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFU9"
FT                   /protein_id="ADN35101.1"
FT                   /translation="MPRLTIGRYITSEDDCIIPAEFTISFNNVEKNRFEGVFSKYRVLY
FT                   VDYDTNRLSVRLPDEQKFIPAAAAEIEKLMDYAHLLEEGDMEICEPSEISPEEFIEGIN
FT                   RFSAPSMRSYSKFHHPSDGFFSVESPDVPSEFGSLSFEGMDEDADFNEKIADLIEEEPV
FT                   PGTLTEDLVQDSGELKIDAPPVQEEEVSFDDLDDMDLDLIPESHEEIVGFDETVSGEVP
FT                   SPDESVSFDDLDDMDLDLLPDSEEAVPEAGENISSEAPVFDEPVSFDNLDDMDLDILSK
FT                   PEEAVPESGETISSGVSPVEDSISFDDLDEMDLDLLPDSGEDIPEFEELTGVEPDLSPG
FT                   DGEPDVSLSAGSFPEIEGFEGSIVLEEDDFPDIAAAEIPDSGSLTDIEDEEFPGELSSG
FT                   FEVNDEFSDLEDLVEESAVDTLLVEAKELVSEGKYEDAMNLLGGSVLEKSGSADLWIMR
FT                   GDICAMAEHLTDAIESYERALELDPDNMTAVLSLYRLYKESENYYDAAELLDSYIKKNP
FT                   EDSHLWFEKGWLSEKSGDFGEALMDYDQAISLDAGCTRAVASKALLLMREKRPEEALEC
FT                   YDLLIEIKPGNAAVHHSRGLVLKVMGEYDEAIDSFKEAIRLDPSDSDTLLEVAILLLET
FT                   GRFKDALGYYNRLIDSGFEGSEVFSGQGDAYLALGMSGEALSSYERAIDAGGNILGALK
FT                   GRAEILAASGNPAEAVEAYNSVLEINPMDTDVLRKLAALYEDAGHPGQALTAYDRILIA
FT                   DPENSYAISGRIKCLVSLERYSEAIPLYDGLIVTSPGRSDLIAGKAFSLAKTGRKDDAV
FT                   VLYVSALQLEPENVGYLLELVSILSDLGRYGESLSYYDRLISLVPGESGFVMSRALALY
FT                   TLGRYEDSVADFEKVLRKKPDDTDALINMGTALFRLGDRRAAMVCYKRSIDFDPSLEEE
FT                   WLMRGISASSFIEWEIDRIHRISESSIIYGSGDAKPKLRASKMEKEDFTQAGTGSVSSP
FT                   VMESSEYDSVNIPDTRTPTKEQLDDPDYLYKKGVALARRGYYRASLKCFSRIETLTEDC
FT                   SDAVFSKGIIYAKNGYFNEALDCFDRVLKMNPSHEKAQKAKRMAEIKRKI"
FT   gene            complement(333472..334005)
FT                   /locus_tag="Mpet_0328"
FT   CDS_pept        complement(333472..334005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0328"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apr:Apre_1818 copper amine oxidase domain
FT                   protein; SPTR: Putative surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35102"
FT                   /db_xref="GOA:E1RFV0"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFV0"
FT                   /protein_id="ADN35102.1"
FT                   /translation="MRIVLTVDEELCQKIEKTAAKEDLSRNEWIIESISGLVSGNNRAD
FT                   AELKELKSALNGKNTENSRLREEIKLQVELREAYAKLLDEKNNRIDDLKEEVARIEVLS
FT                   VTATDQINQDKDDRIKDLTKMIEHLQGQAAAHSLALQSAIKSIEKDEKESDEQTKENTG
FT                   QKELIEKPKWMFWK"
FT   gene            complement(334011..334385)
FT                   /locus_tag="Mpet_0329"
FT   CDS_pept        complement(334011..334385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0329"
FT                   /product="TPR repeat-containing protein"
FT                   /note="InterPro IPR001440:IPR019734:IPR013026; KEGG:
FT                   ptm:GSPATT00001104001 hypothetical protein; PFAM: TPR
FT                   repeat-containing protein; SMART: Tetratricopeptide repeat;
FT                   SPTR: Chromosome undetermined scaffold_2, whole genome
FT                   shotgun sequence.; PFAM: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35103"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFV1"
FT                   /protein_id="ADN35103.1"
FT                   /translation="MKVGVRYWYNKGIALLEAELPEKAVECLDRALQEDPENDTIIFKK
FT                   GIALFYSERLEEAAGIFDEALRKNPENYSALNNKGMILLRLNRIDEAENCFRSAKEISR
FT                   KSGCVDLNFSLIKKIHIGER"
FT   gene            334686..337688
FT                   /locus_tag="Mpet_0330"
FT   CDS_pept        334686..337688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0330"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR013656:IPR004089:IPR004090:IPR000700; KEGG:
FT                   mhu:Mhun_2032 methyl-accepting chemotaxis sensory
FT                   transducer with PAS/Pac sensor; PFAM: chemotaxis sensory
FT                   transducer; PAS fold-4 domain protein; SMART: chemotaxis
FT                   sensory transducer; SPTR: Methyl-accepting chemotaxis
FT                   sensory transducer with Pas/Pac sensor; PFAM:
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain;
FT                   PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35104"
FT                   /db_xref="GOA:E1RFV2"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFV2"
FT                   /protein_id="ADN35104.1"
FT                   /translation="MEMSLDTINNILKKALDGDVLARVNESEVSDEFKNLAATVNRVVE
FT                   KLGDAAEAKKLQKRAEAFLQLNPQGIAVLAGDKHRLDLNKEYERIWRGGYDELMAKKLY
FT                   DFNIEITGGDDFYASFETKKPAISDMEISWENGEKTYLRLFQTPILDEKGEIDVNYYIY
FT                   QDLTPQREEMAEIQKLQKRAEAFLQLNPQGITVLAADKHRLDLNKEYERIWRGGYDELM
FT                   AKKLYDFNINITGGDDFYASFETKKPAISDMEISWENGEKTYLRLFQTPIIDEKGEIDV
FT                   NYYIYQDLTDQVEKLNEIKTLEEQSNAIVSENPMPILLWNTDLTIRKYNKAFLKLSGFS
FT                   DAAAENLKLSDFKYLKQSGKSIRDTIEEKKANHGEAEMEFPSGIKVLERYNIPLLDESG
FT                   RVDAVMTVYNDITILKQEMAETAKLQRRAEAFLQENPQAITVLAPDKHRLDLNKEYQRV
FT                   WRGGYDELMAKKLYDFNINITGGDDFYGSFESRRRAVTEMEISWENGEKSYLRLFQTPI
FT                   LDEKGEIDVNYYIYQDMTPEVTISNYMNGEVDRISENLEKLSKGNLDMNLDAGAANEYT
FT                   SETRRMFNRVDKSLGEAKEAVESLVEDSKMLAQAAINGRLNVRSDASKHEGKFKHIVEE
FT                   LNKTIDSIAAPIHEAIRVIGEYAENNYTEFFDDKVVVKGEFAEFKESINLLGQNTSNVI
FT                   SDVINAVDHVFVGTNEASKGSDEVAKAAEHVAMTSQKCADISREMLDKMTAIQQQIADL
FT                   SASNEEVAATSQDVLKNSEEVTKMGNDAQVLGNDANRKMASVVEITNRSAEEIKELNDQ
FT                   IKEINKIVKMITDITSQINLLALNAAIEAARAGEHGRGFAVVAGEVKNLAADARKATEH
FT                   IDKVIGEIQNNSIRTADAIQTASTEVVSGVESVDAAIKALNTIVEGSEKVTMDMSEIAK
FT                   AIEDQANIANIVVSATDEGSLLSKDNLREVEELAALAEEASASTEEIGSAIHEVNKMSQ
FT                   KLQGDMKAFKI"
FT   gene            complement(337832..338926)
FT                   /locus_tag="Mpet_0331"
FT   CDS_pept        complement(337832..338926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0331"
FT                   /product="7,8-didemethyl-8-hydroxy-5-deazariboflavin
FT                   synthase, CofH subunit"
FT                   /note="COGs: COG1060 Thiamine biosynthesis protein ThiH;
FT                   InterProIPR007197:IPR006638:IPR005244:IPR019940:IPR 020050;
FT                   KEGG: mem:Memar_0047 radical SAM domain-containing protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; SPTR: FO synthase subunit 2; TIGRFAM:
FT                   7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH
FT                   subunit; PFAM: Radical SAM superfamily; TIGRFAM:
FT                   7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH
FT                   subunit; radical SAM domain protein, CofH subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35105"
FT                   /db_xref="GOA:E1RFV3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019940"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFV3"
FT                   /protein_id="ADN35105.1"
FT                   /translation="MKDAELKNLLNDVLEGHRMTEEEAVSLMMIRDRNIFRIAEAADRL
FT                   RERKVGDIVTYVRNHNLHVTNICKNLCGFCGFGRPKKAEDAYLHDEEEIRARALLAKER
FT                   NVTEICLLSGVHPDFDAERYAEIISWVHDVIPEADIHTMSPDEISYSAKKSGISTKEVI
FT                   GMMRSAGLGTLQGTAAEILVDSVRKTICPAKVPTAEWVRIIKEAHSMGIKSTATILPGS
FT                   VETEADRVEHLRVLRGIQDETGGFTELVPLPYLHHNTPLFNKGLAPPGATGRTDILLFA
FT                   VSRLYLDNFDNIQISWGKLGRKFTQVGLLSGGNDFGGTMFSDEVSVDAGGDESDYLDPG
FT                   EMKRITEDIGRVLKQRSTTYEILD"
FT   gene            complement(338923..339579)
FT                   /locus_tag="Mpet_0332"
FT   CDS_pept        complement(338923..339579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0332"
FT                   /product="peptidase S26B, signal peptidase"
FT                   /note="InterPro IPR001733; KEGG: mpl:Mpal_0410 peptidase
FT                   S26B, signal peptidase; SPTR: Peptidase S26B, signal
FT                   peptidase; TIGRFAM: peptidase S26B, signal peptidase;
FT                   TIGRFAM: signal peptidase I, archaeal type"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35106"
FT                   /db_xref="GOA:E1RFV4"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFV4"
FT                   /protein_id="ADN35106.1"
FT                   /translation="MKKPESGNKPKESLIKRFLKSEEPAFSLARDAAWIVLVVGLVALL
FT                   LFLFSGTWPAVVAVESESMVPNMNKGDLVFVVAADRYGELQTWNESLSTGYGKFNEYPN
FT                   LYGNAVYGDVIIYKPNGVDSVHPIIHRAVEWYDNASDGGYITWGDNNPYPDQMGGISGI
FT                   GQLMPVEKEWIVGKAWFAIPLVGYIPLHIIEFAILIIILMFAHELYLNSREKKKK"
FT   sig_peptide     complement(339406..339579)
FT                   /locus_tag="Mpet_0332"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            339681..339908
FT                   /locus_tag="Mpet_0333"
FT   CDS_pept        339681..339908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0333"
FT                   /product="urea permease"
FT                   /note="KEGG: pic:PICST_55023 urea permease; SPTR:
FT                   CBS/transporter associated domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35107"
FT                   /db_xref="GOA:E1RFV5"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFV5"
FT                   /protein_id="ADN35107.1"
FT                   /translation="MESGYLSLGMGLLIAIIVLAFTFLTALITAGLQSYNLAISISFVM
FT                   GGLLCICLSAVFRSCPFSKKENCNDSPADR"
FT   sig_peptide     339681..339740
FT                   /locus_tag="Mpet_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            340097..341023
FT                   /locus_tag="Mpet_0334"
FT   CDS_pept        340097..341023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0334"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="InterPro IPR001440:IPR013105:IPR019734:IPR013026;
FT                   KEGG: mth:MTH83 O-linked GlcNAc transferase; PFAM:
FT                   Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SMART: Tetratricopeptide repeat;
FT                   SPTR: Tetratricopeptide repeat family; PFAM:
FT                   Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35108"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFV6"
FT                   /protein_id="ADN35108.1"
FT                   /translation="MTERKTGSGDSAGTPDAERLLEEGDPLFEESKYEEALSAYDLIRA
FT                   TDDGYLAAQNRKGNILSILGRNDEALEVFRDVLRIVPENPILYDAALNNMANVLRRLER
FT                   FEEALELYDKALEAEPDNVMALNNRGNVLSDMGRDEEALLMYERALEIEPGNSPVLVNK
FT                   AYSLIGLRRNDEALIALDGALRLNPGNIMAMNNKANLLSELGRTKEAIKIYNQALDLNP
FT                   AHVPTIVNCGIAYAASGESERALAYFDQALILDPSNILALDNKGCVLVDLGRYREALVA
FT                   YERARSLDPDDEAIRKNIDDLMKRIRE"
FT   gene            341047..341595
FT                   /locus_tag="Mpet_0335"
FT   CDS_pept        341047..341595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0335"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="COGs: COG1853 Conserved protein/domain typically
FT                   associated with flavoprotein oxygenase DIM6/NTAB family;
FT                   InterPro IPR002563; KEGG: msl:Msil_3722 flavin reductase
FT                   domain protein FMN-binding; PFAM: flavin reductase domain
FT                   protein FMN-binding; SPTR: Flavin reductase domain protein
FT                   FMN-binding; PFAM: Flavin reductase like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35109"
FT                   /db_xref="GOA:E1RFV7"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFV7"
FT                   /protein_id="ADN35109.1"
FT                   /translation="MEDYDLGKVFKLIEPGPVVLVTTSSNGRPNIMTMSWHMAMEFVPP
FT                   LIGCIISPEDYSFEALYATGECVIGIPTVEMMKKTVDIGNCSGKDVDKFEEFGLTPLPA
FT                   GKVKAPLLAECFANIECRVVDRSMVDKYGLFVLEAVKAWTDPEHKERRTFHANGDGTFV
FT                   VDGESVDLKDRMVKFPECL"
FT   gene            complement(341669..341741)
FT                   /locus_tag="Mpet_R0006"
FT   tRNA            complement(341669..341741)
FT                   /locus_tag="Mpet_R0006"
FT                   /product="tRNA-Gln"
FT   gene            342011..343270
FT                   /locus_tag="Mpet_0336"
FT   CDS_pept        342011..343270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0336"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="COGs: COG1413 FOG: HEAT repeat; InterPro IPR004155;
FT                   KEGG: mhu:Mhun_3137 heat repeat-containing PBS lyase; PFAM:
FT                   PBS lyase HEAT domain protein repeat-containing protein;
FT                   SMART: PBS lyase HEAT domain protein repeat-containing
FT                   protein; SPTR: PBS lyase HEAT-like repeat; PFAM: PBS lyase
FT                   HEAT-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35110"
FT                   /db_xref="GOA:E1RFV8"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFV8"
FT                   /protein_id="ADN35110.1"
FT                   /translation="MRIAGHLETVNRNNGDFVRLFVLVVYFLVVGILAIYAFSPIGGEM
FT                   GYILARLIPHLFYIPLVLTALWYPKKRLAHFIIFSLIFFCLISGFLMNGWSLDALFMVF
FT                   TSFIYLWVFIAILAIPQVQLGKTGEDTASGESIAPPALQAPLSAESSPAPAASGGNAGL
FT                   IRRTPSIGPSQINPLIESFRHGEELVTRNTSAALKAIGVPAIPYIVRGLKSDSIPVREN
FT                   CARLLGEMDDTDSIDLLVAAMADPSRRVHNAATQALARIGEPSVPALKRGLTSEKWKIR
FT                   AGSVVALRIIGSHDAVPLLTGMLDDRSHYVRKEVVKSLARVGREENLDYLVGMLGDESR
FT                   GVRLAAVGGLGRSGKDEAVEPLVRVLEEEEDAEVRIRAVHSLELIGTAVAYEAMRVALD
FT                   DNDPEVSSEAEDILRQNYKI"
FT   gene            complement(343280..344449)
FT                   /locus_tag="Mpet_0337"
FT   CDS_pept        complement(343280..344449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0337"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2271 Sugar phosphate permease; InterPro
FT                   IPR011701:IPR001958:IPR005829; KEGG: mem:Memar_1844 major
FT                   facilitator transporter; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Major facilitator superfamily
FT                   MFS_1; PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35111"
FT                   /db_xref="GOA:E1RFV9"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFV9"
FT                   /protein_id="ADN35111.1"
FT                   /translation="MEKTTRSILGLSAAHMVNDIYSPVLPAILPLLILQNGYSYFLAGL
FT                   IVTAYNLSSSFTQPVVGWLYDKKNIRMPVAVSVMISAFFMSFIGFVEDYYFLIAFAIIG
FT                   ALGHAFFHPSALGLVSRMAAGANRGRLTSLFVVGGNLGFAIGPILAGVAVASYGLHGLA
FT                   LIIIPGILIVPLLRKVLPPVSELENSYSKDNGKKDPEAKFPYLPITLLVTASAFRAWVI
FT                   FGSVAYLPTYLAKTGMSLVTANLLTSGMLMAGVVGQVIGAGMSDKYGRKEYVLASLILS
FT                   ILPFTLFIMSDGIISLISLMAFGYLLWSSFSVTVAMSHEMAPQGTGTVSGLMLGLAVGA
FT                   GGLGVAITGYIADITNVSTAFGLLVIPVVISILIFSATPYPWKSIRRKI"
FT   gene            complement(344457..345056)
FT                   /locus_tag="Mpet_0338"
FT   CDS_pept        complement(344457..345056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0338"
FT                   /product="ribosomal L11 methyltransferase"
FT                   /note="COGs: COG2263 RNA methylase; InterPro
FT                   IPR010456:IPR002296:IPR002052; KEGG: mem:Memar_1845
FT                   methyltransferase small; PFAM: ribosomal L11
FT                   methyltransferase; SPTR: Methyltransferase; PFAM:
FT                   Methyltransferase small domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35112"
FT                   /db_xref="GOA:E1RFW0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFW0"
FT                   /protein_id="ADN35112.1"
FT                   /translation="MKLRKLEMLLEGFEAFENPDPALEQYMTPPVVAARLLYHAYMKGD
FT                   IEGRSVLDLGCGTGIFACGAALLGAEQVTGADIDPAAVAAAYRNAERAGVTADFVVSDI
FT                   PDFNCRSFDTAVMNPPFGAQKKYADRPFIDKALKCAGVTYGIFNEGSTPFIRSYISGRG
FT                   VIDETVRCDFPIKRTFAHHRKDSLEIRVEIIRITKI"
FT   gene            complement(345069..346064)
FT                   /locus_tag="Mpet_0339"
FT   CDS_pept        complement(345069..346064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0339"
FT                   /product="diphthamide biosynthesis protein"
FT                   /note="COGs: COG1736 Diphthamide synthase subunit DPH2;
FT                   InterPro IPR002728:IPR016435; KEGG: mpl:Mpal_2082
FT                   diphthamide biosynthesis protein; PFAM: Diphthamide
FT                   synthesis DPH2 protein; SPTR: Diphthamide biosynthesis
FT                   protein; TIGRFAM: diphthamide biosynthesis protein; PFAM:
FT                   Putative diphthamide synthesis protein; TIGRFAM:
FT                   diphthamide biosynthesis protein 2-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35113"
FT                   /db_xref="GOA:E1RFW1"
FT                   /db_xref="InterPro:IPR016435"
FT                   /db_xref="InterPro:IPR022428"
FT                   /db_xref="InterPro:IPR035435"
FT                   /db_xref="InterPro:IPR042263"
FT                   /db_xref="InterPro:IPR042264"
FT                   /db_xref="InterPro:IPR042265"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFW1"
FT                   /protein_id="ADN35113.1"
FT                   /translation="MSSKRTTESVQAQPEDLTVRILSLLKEKEKERPVRKVALQFPEGL
FT                   KRKAHGISEALRRAGYEIVISGEPCWGACDLDLDLLKNSDILIHIGHAPVDERENVIFE
FT                   YFSQDFDISQLEDAITSIESRRVGLITTIQHVHLLDDIIQFFSDRGIECVIAAGSERTP
FT                   FKGQVLGCTFEAAKNTGCSEIVYIGTGLFHPLGVHLATGARVVAFDPYTGRTEIPDERR
FT                   MLIKRHALIEKAKEARSFGILLSKKSGQRREELARKLEVLSDKADIIEIGEITPDALLN
FT                   FGYDVYVNTACPRLAYDDQARFPVPVLSPQEFEIVCGAREWEEFEIDEIT"
FT   gene            complement(346042..346593)
FT                   /locus_tag="Mpet_0340"
FT   CDS_pept        complement(346042..346593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0340"
FT                   /product="phosphoribosyltransferase"
FT                   /note="COGs: COG0503 Adenine/guanine
FT                   phosphoribosyltransferase and related PRPP-binding protein;
FT                   InterPro IPR000836; KEGG: mbn:Mboo_2167 adenine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase;
FT                   SPTR: Phosphoribosyltransferase; PFAM: Phosphoribosyl
FT                   transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35114"
FT                   /db_xref="GOA:E1RFW2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR026597"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFW2"
FT                   /protein_id="ADN35114.1"
FT                   /translation="MFNKLVESLEKCPIVKRGEYNYFIHPISDGVPIVEPELLREVAAL
FT                   MLRNLDLDHADKLVVAEAMGIHIGVALSLITDLPLTIVRKRKYELPGELPLHQTTGYSK
FT                   GELYLNGIEEGDRVVIVDDVFSTGGTMKALLKGLEQKNAEVVDVLVVIKRGECDIGRPY
FT                   KYLVEIDVDETGVNVIKKNY"
FT   gene            complement(346593..347684)
FT                   /locus_tag="Mpet_0341"
FT   CDS_pept        complement(346593..347684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0341"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="COGs: COG0076 Glutamate decarboxylase and related
FT                   PLP-dependent protein; InterPro IPR002129; KEGG:
FT                   mem:Memar_1848 L-tyrosine decarboxylase; PFAM:
FT                   Pyridoxal-dependent decarboxylase; SPTR: L-tyrosine
FT                   decarboxylase; PFAM: Pyridoxal-dependent decarboxylase
FT                   conserved domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35115"
FT                   /db_xref="GOA:E1RFW3"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020931"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFW3"
FT                   /protein_id="ADN35115.1"
FT                   /translation="MLEDGLREDELFRHLSSIKEKDRSYRKVLSSMCSIPHPVAVRAHN
FT                   IFIESNLGDPGLFMGTASLEAELIERLGSLMSLPEACGYATSGGTESNIQALRIARENA
FT                   GKKSPNVIIPESAHFSFEKACDILSIEMRQAPSTEKYIVDTERMEDLIDGNTIGMVGVA
FT                   GTTEYGTVDPIEHLSDIALDRDLFLHVDAAFGGLVLPFIKGSPPFDFRLDGVSSISVDP
FT                   HKMGMSTIPCGCIMVRNPDFFRSTEVDTPYLTVKKECTLCGTRPGGPVAGALAVLDHLG
FT                   RKGMIEVVERCMENTRFLIRGMEELGHPVAVQPSVNVASFSCDETPDGWIVSRTRHGHM
FT                   RTVCMPHITRETLEEFLKDVGEM"
FT   gene            complement(347691..349970)
FT                   /locus_tag="Mpet_0342"
FT   CDS_pept        complement(347691..349970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0342"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="COGs: COG0574 Phosphoenolpyruvate synthase/pyruvate
FT                   phosphate dikinase;
FT                   InterProIPR002192:IPR008279:IPR000121:IPR006318:IPR
FT                   018274:IPR006319; KEGG: mem:Memar_1849 phosphoenolpyruvate
FT                   synthase; PFAM: pyruvate phosphate dikinase
FT                   PEP/pyruvate-binding; PEP-utilising protein mobile region;
FT                   PEP-utilizing protein; SPTR: Phosphoenolpyruvate synthase;
FT                   TIGRFAM: phosphoenolpyruvate synthase; PFAM: PEP-utilising
FT                   enzyme, TIM barrel domain; PEP-utilising enzyme, mobile
FT                   domain; Pyruvate phosphate dikinase, PEP/pyruvate binding
FT                   domain; TIGRFAM: phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35116"
FT                   /db_xref="GOA:E1RFW4"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFW4"
FT                   /protein_id="ADN35116.1"
FT                   /translation="MSKMPDILWLADIKKEDIPSVGGKGASLGEMTAVGLPVPPAFVVT
FT                   AQAFRKFLVTSGIDEKIFSTLKDIDVEDSDLLENVAEKVKEIVMSAKMPEDIRNETISA
FT                   YDKMGDDAVVAVRSSATAEDLPDASFAGQQETYLNISGEKNLIESLQKCWASLYGARAI
FT                   YYRVKQGFDHSAVDIAVVVQKLVYSEKSGVMFSSHPVTGEPTTIIEGSWGLGEAVVSGM
FT                   VSPDNYVYDSRSGRVIDRYIATKEIEILPDGTHGTKEIRVPDERQKTAVLSDAEIARLA
FT                   KFAKISEEHYGVPQDVEWGIVGDEIFILQSRPITTIKGTATTKKGEKVEGSGNIILEGQ
FT                   GASPGIATGKVVIVGSTKDLSKVNTGDIMVAKMTNPDMVPAMRKAAAIITDEGGMTCHA
FT                   AIVSRELGTPAAVGTKKATSILIDGQVVSVDGEKGLVYEGRISIPESAVPAAAAPAGVA
FT                   VSSAPIITATSIKVNVSLPEAAKRAAATGADGVGLLRIEHLILGLGKTPGWFIRNKKEE
FT                   DFINELYVGIKTVMDEFPGKPVWVRTIDAPTDEFRNMKGGEDEPEEHNPMLGWRGIRRD
FT                   LQSKDQFRLQIEAFKRLWEQGYDNLGIMFPLVGHPDEFVAAKELMREFGVDVDNKTLGI
FT                   MIEIPSSAILIDDFIKEGIAFASFGTNDLIQYTLAIDRNNQNVADMYKPKHPAVLKLIK
FT                   YAIEKCRAGGVECSICGQAGSDPEMVKWLVETGITSVSANIDAVQKIRETAARTEKKIL
FT                   LDAARK"
FT   gene            350108..351694
FT                   /locus_tag="Mpet_0343"
FT   CDS_pept        350108..351694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0343"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="COGs: COG0111 Phosphoglycerate dehydrogenase and
FT                   related dehydrogenase; InterPro
FT                   IPR006139:IPR006140:IPR002912:IPR006236; KEGG:
FT                   mem:Memar_1850 D-3-phosphoglycerate dehydrogenase; PFAM:
FT                   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase catalytic
FT                   region; amino acid-binding ACT domain protein; PRIAM:
FT                   Phosphoglycerate dehydrogenase; SPTR: D-3-phosphoglycerate
FT                   dehydrogenase; TIGRFAM: D-3-phosphoglycerate dehydrogenase;
FT                   PFAM: D-isomer specific 2-hydroxyacid dehydrogenase, NAD
FT                   binding domain; ACT domain; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, catalytic domain; TIGRFAM:
FT                   D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35117"
FT                   /db_xref="GOA:E1RFW5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFW5"
FT                   /protein_id="ADN35117.1"
FT                   /translation="MTYKVLVSDPLADEGIEILRGFCEVDINTGLSEDELIKIIGDYDG
FT                   LLVRSGTEVTANVIEAAAKLKFIGRAGAGVDNIDTNAATQRGIIVANAPAGNTLAACEH
FT                   TLAMMASLARKIPQATASVKRGEWKRSAFMGVELNEKTLGIVGFGRIGQELARRAIALD
FT                   MKVVAYDPYINEERAKELGVEVMTLDQLFPVADFITVHTPLIKETKHLINKKSIAVMKD
FT                   GVRIINCARGGIINESDLYDAIVAGKVAGAALDVYENEPPKDSKIITLDEVITTPHLGA
FT                   STVEAQLNVAVSVAKQCIEVLKGGSAKFVVNAPMISPDQQDRIDPYVKLVRNMGSLLIQ
FT                   LVEGRIESVEIEYGGKAAEFGSGSKYITRMALKGILDPILQTPVNIVNAELAAKERGIR
FT                   VSEVITDKSLGFTNLVTISIKTDKMSETVSGNVSSPEKLRIVKIGEYMTDMTPGGDVVI
FT                   SRHHDVPGVIGHFATIIGKYGVNIAGMQVGRNQPGEEAVMVLNVDSEVPQEAMDKILKI
FT                   EGVYTAKYAHI"
FT   gene            351809..352444
FT                   /locus_tag="Mpet_0344"
FT   CDS_pept        351809..352444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0344"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lwe:lwe0048 hypothetical protein; SPTR:
FT                   Complete genome"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35118"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFW6"
FT                   /protein_id="ADN35118.1"
FT                   /translation="MRIISFLSAMVSLSALLKTTYDRLYAAEDTQPEMESPLHARFRKT
FT                   IESMEKLMESIYIAFGSSVLGMVIDPPDPLWQADQVFNEFLRSYRDFVGEFRGLIAEIR
FT                   NSGEDVRNKLGSEWITLDNLGRLFDKGRIEWDEVASEGSLKIADPVMNNPRRFNNHLVG
FT                   RFREFLKDEMDIHDFEPVDLISSLLRENELISIAGARLMRFIDGEDQK"
FT   sig_peptide     351809..351859
FT                   /locus_tag="Mpet_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            352701..353978
FT                   /locus_tag="Mpet_0345"
FT   CDS_pept        352701..353978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_1820 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: CARDB"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35119"
FT                   /db_xref="GOA:E1RFW7"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036238"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFW7"
FT                   /protein_id="ADN35119.1"
FT                   /translation="MKRINIFLILLVLFAAIPFIAAADDSEDSSYTDVTVTSVEYDPEV
FT                   FMPGDEGTITITVKNTGDESVTISRAEIYSQDVTNLNDEAYDTVGALGAGNSMEFTFNV
FT                   KAPLKEGIYYPRFYLDFYGSSGLSYNVPVKVDDTGLTISVINSPDAWQEDVSKSIQIRV
FT                   GNPSQVTADGVIIYASGDGIESDQTSFFVGALEPNEYVDVTFEITPSKETTLKLNAEWN
FT                   NGMNSHTSEISVPVEFGEDTTGADLVINNVEVSGGTVTGDVSNAGLEDAYSVIVTVGSP
FT                   AEAIEPYKQYVLGSLESDDFSSFEVTYSIQGSSSSFPLVITWKDENGNTYSSEYTVSAS
FT                   SSGMAVEGDDSASSGGAPSGMGSGGPSGGGMGMMGMSGAGFANMPIAEIIIGLIIVIGL
FT                   VVAWKKGYLAKAVKVVKEKLNKGDRK"
FT   sig_peptide     352701..352769
FT                   /locus_tag="Mpet_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            353991..354686
FT                   /locus_tag="Mpet_0346"
FT   CDS_pept        353991..354686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0346"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1136 ABC-type antimicrobial peptide
FT                   transport system ATPase component; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: mem:Memar_1821 ABC
FT                   transporter-related protein; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: ABC transporter-related protein;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35120"
FT                   /db_xref="GOA:E1RFW8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFW8"
FT                   /protein_id="ADN35120.1"
FT                   /translation="MTDRPVIKLENVTKVYSLPTDDVIALDNINLEVKKGEFLAIMGTS
FT                   GSGKSTLLNQIGCLDVPTSGNLYIDGRSVRDLNDNELTDLRRDKIGYIFQNFNLIPLLD
FT                   LCENVEYPLILKYKKRDDTGRPKKLLEMVGLDETRVWHKPNEISGGQRQRVAIARALVN
FT                   DPAILLCDEPTGNLDSRTSVQIMDMITDLHKEGRTIVMVTHEPDIANYAEKTIVMGDGK
FT                   IISEGRGFS"
FT   gene            354683..355909
FT                   /locus_tag="Mpet_0347"
FT   CDS_pept        354683..355909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0347"
FT                   /product="protein of unknown function DUF214"
FT                   /note="COGs: COG4591 ABC-type transport system involved in
FT                   lipoprotein release permease component; InterPro IPR003838;
FT                   KEGG: mem:Memar_1822 hypothetical protein; PFAM: protein of
FT                   unknown function DUF214; SPTR: Putative uncharacterized
FT                   protein; PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35121"
FT                   /db_xref="GOA:E1RFW9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFW9"
FT                   /protein_id="ADN35121.1"
FT                   /translation="MIFGDIFFDLSVRNVRLNFLRSLLAAIGIVIGVVAITSIGIMGAN
FT                   MTLSITAELSESGNVIMISPDSGGGGGGMMGGGGSDDEDEYIDKTQLRKIEQVAATGDN
FT                   LVVPLYTTSENIEVGGEEGRATIYGIDMTLVPDLVDIEEGSMPLSTSGVLVGSSLAERY
FT                   DLVVGSRIKIGDEDVEDDDDVPQFTVRVTGILEEKGMSSDLSTDNAIIMDEDLYTAHLG
FT                   SEYEYDQVNIIAGDIDDIEELEDDLDYALNYREDEVRIQDSGSMIDTISETVGTMTSFM
FT                   SAIGAISLLVAAVSIFNVMMMSVTERIKEIGILRSIGTRRSEIRKMFLYESLILGVVGA
FT                   GIGAVASFIGGYILTYGMIGTTDYFFTFSSLMYVPLGMVLGIVICVLSGVYPAYRASCL
FT                   DPIEALRSE"
FT   gene            complement(356191..356385)
FT                   /locus_tag="Mpet_0348"
FT   CDS_pept        complement(356191..356385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0348"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="COGs: COG1476 transcriptional regulator protein;
FT                   InterPro IPR001387; KEGG: mem:Memar_1819 XRE family
FT                   transcriptional regulator; PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein; SPTR:
FT                   Transcriptional regulator, XRE family; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35122"
FT                   /db_xref="GOA:E1RFX0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFX0"
FT                   /protein_id="ADN35122.1"
FT                   /translation="MKNRIKVFRAMHDLTQEGLAKELGVTRQTILAIEKGKYDPSLDLA
FT                   FKIAKYFNVKIEEVFVYEG"
FT   gene            complement(356369..356821)
FT                   /locus_tag="Mpet_0349"
FT   CDS_pept        complement(356369..356821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_1818 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Predicted membrane
FT                   protein (DUF2178)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35123"
FT                   /db_xref="GOA:E1RFX1"
FT                   /db_xref="InterPro:IPR019235"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFX1"
FT                   /protein_id="ADN35123.1"
FT                   /translation="MKLSLKRNTSYIIVAFIALIEIGIIWWAADYNRPPATELTTIALA
FT                   AGIIIAYFILEQVNTVEPGMTDERLALVNYKSALRTLQIFWILTFSILLTMIIRFIDFE
FT                   RDVRRLIFGPVFSQLIMLVGIIFLFVAFRIYYNTKYGGYDSDEESD"
FT   gene            357269..357751
FT                   /locus_tag="Mpet_0350"
FT   CDS_pept        357269..357751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0350"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ptr:462550 valyl-tRNA synthetase; SPTR:
FT                   NADH-ubiquinone oxidoreductase chain 4"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35124"
FT                   /db_xref="GOA:E1RFX2"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFX2"
FT                   /protein_id="ADN35124.1"
FT                   /translation="MDFYSFLMDFQVFFIRAPFFVADMIVSISLYNGSSIPRFFDPVIG
FT                   CNYLEVRVYAEGFDLLLPATVSVSVECKDRVEFILWIFLRAPGLPASIHLSIFPGQRFM
FT                   GVSPACVVSLPVFETPEHVMMVMPMIPETFLFGILFSLAFPAGGDCCLDIIIQVGF"
FT   gene            complement(357671..358090)
FT                   /locus_tag="Mpet_0351"
FT   CDS_pept        complement(357671..358090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0351"
FT                   /product="DGC domain protein"
FT                   /note="COGs: COG4273 conserved hypothetical protein;
FT                   InterPro IPR014958; KEGG: mla:Mlab_0814 hypothetical
FT                   protein; PFAM: DGC domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: DGC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35125"
FT                   /db_xref="InterPro:IPR014958"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFX3"
FT                   /protein_id="ADN35125.1"
FT                   /translation="MRRSKLPDEQKCSCSCGGKEPERIIFPCARQANTGQITNLAAIQL
FT                   TEEGFGKIACTALLATGEKGLIKRAKDTGGVVVLDGCPMNCAKKIADTNDVPVSQHLIM
FT                   TELGITKGPSKSYLDDDVETAVSACWEGKGKKNSE"
FT   gene            complement(358077..358316)
FT                   /locus_tag="Mpet_0352"
FT   CDS_pept        complement(358077..358316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0352"
FT                   /product="redox-active disulfide protein 2"
FT                   /note="InterPro IPR005243; KEGG: mem:Memar_0018
FT                   redox-active disulfide protein 2; SPTR: Redox-active
FT                   disulfide protein 2; TIGRFAM: redox-active disulfide
FT                   protein 2; TIGRFAM: small redox-active disulfide protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35126"
FT                   /db_xref="GOA:E1RFX4"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFX4"
FT                   /protein_id="ADN35126.1"
FT                   /translation="MKIEVLGTGCMKCKRQMKNVEKAVAESGIPADIQKIKDIEEIINR
FT                   GVMLTPAVAVNGEIKVSGRVADVAELKKILDEAQ"
FT   gene            complement(358321..358575)
FT                   /locus_tag="Mpet_0353"
FT   CDS_pept        complement(358321..358575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_0017 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35127"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFX5"
FT                   /protein_id="ADN35127.1"
FT                   /translation="MTNKDIPCCAADAMRRVKQIDVEGTVVGITMLEEIIAEVRQTDLR
FT                   SKTEITETLLKKVRIYNYIPDAAETKYKIALFKEYENRK"
FT   gene            complement(358583..359656)
FT                   /locus_tag="Mpet_0354"
FT   CDS_pept        complement(358583..359656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0354"
FT                   /product="permease"
FT                   /note="COGs: COG0701 permease; InterPro IPR005524; KEGG:
FT                   mem:Memar_0016 permease; PFAM: permease; SPTR: Permease;
FT                   PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35128"
FT                   /db_xref="GOA:E1RFX6"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFX6"
FT                   /protein_id="ADN35128.1"
FT                   /translation="MIEAIIGSFIVGWNTLAGYLADHVLTCLIPAFFIAGAIAAFVKKE
FT                   VILKYFSPDARKSIAYGLASISGTVLAVCSCTILPMFAGLFKRGSGIGPATTFLYAGPA
FT                   INILAIVYTANVLGFDLGVARAAFAITMAIIIGLIMAAIFRSHDEETKKNMIAMPSVPA
FT                   GGETDRPRWVVPLFFVFLVGILIAGTAQADWMIKFPVIYALTIGIAVLAIYFFERDEVS
FT                   EWGLETWDLTKKIFPILIAGTFILGMISYFIPPETFSPFFGTNSFASSLLAAIVGTILY
FT                   MPTLLEVPVIGTTFGYTSGIMAGGPALALLLSGPSVSLPSLLVISRIMGAKKTAAYAVL
FT                   VILSSAIAGIIYGMIIG"
FT   gene            359859..360218
FT                   /locus_tag="Mpet_0355"
FT   CDS_pept        359859..360218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0355"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="InterPro IPR001845; KEGG: mem:Memar_0011 regulatory
FT                   protein, ArsR; PFAM: regulatory protein ArsR; SMART:
FT                   regulatory protein ArsR; SPTR: Transcriptional regulator,
FT                   ArsR family; PFAM: Bacterial regulatory protein, arsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35129"
FT                   /db_xref="GOA:E1RFX7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFX7"
FT                   /protein_id="ADN35129.1"
FT                   /translation="MEKKCSCSEETMSLPDEIVMSLRKYGGIAGLLKRLPDDETLASSG
FT                   EIHKALSDPIRLKIMSMLGIQPLCVCVLKAGLGIADSRLSYHLSVMKRAGLIEGEQQGN
FT                   WIIYSLTEEGGKWVL"
FT   gene            complement(360235..360654)
FT                   /locus_tag="Mpet_0356"
FT   CDS_pept        complement(360235..360654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0356"
FT                   /product="Protein of unknown function DUF1628"
FT                   /note="InterPro IPR012859; KEGG: mbn:Mboo_2384 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF1628; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1628)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35130"
FT                   /db_xref="GOA:E1RFX8"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFX8"
FT                   /protein_id="ADN35130.1"
FT                   /translation="MHHNPPDDSALSPVIGEMMMIALAVLLVSIFSVTLFGLLPAERSD
FT                   SIDILQEPYNNTNHELKFWHKGGDWVKKSDLKVVTIRDDHTTETISLSDDNLEGDSFDL
FT                   GDKITIKSTDFNNGLKNGDIIRLISDKNMIYSGII"
FT   gene            complement(360836..361690)
FT                   /locus_tag="Mpet_0357"
FT   CDS_pept        complement(360836..361690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0357"
FT                   /product="8-oxoguanine DNA glycosylase domain protein"
FT                   /note="COGs: COG0122 3-methyladenine DNA
FT                   glycosylase/8-oxoguanine DNA glycosylase; InterPro
FT                   IPR012904:IPR003265; KEGG: mem:Memar_0653 8-oxoguanine DNA
FT                   glycosylase domain-containing protein; PFAM: 8-oxoguanine
FT                   DNA glycosylase domain protein; HhH-GPD family protein;
FT                   SMART: HhH-GPD family protein; SPTR: 8-oxoguanine DNA
FT                   glycosylase domain protein; PFAM: 8-oxoguanine DNA
FT                   glycosylase, N-terminal domain; HhH-GPD superfamily base
FT                   excision DNA repair protein; TIGRFAM: 8-oxoguanine
FT                   DNA-glycosylase (ogg)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35131"
FT                   /db_xref="GOA:E1RFX9"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFX9"
FT                   /protein_id="ADN35131.1"
FT                   /translation="MEGYRSIEINEDSPFSLDSTLASGQAPRWEKVNGWWYGVVKDNVI
FT                   KTRQLDDKIYFSGCSERYYREYFSLDYNLKEFYDSFSDDMYLKSAIEANPGLRLVGQDP
FT                   WECLCFQLTINKKRTSPGEDCFTRISQKFGDEIELDGKIYHTFPTAETLVKEGLSKLKT
FT                   CNLGYKANNIHSAAKKVAEDPLWSKKIESMKSEDAIKIISGFRGVKPTVAEWILIFAFR
FT                   RYELFPVDSHIRSRMVKKYLSDVHFPNNSKTIDNYILNFAQDHFQEYSAYALEYLFASP
FT                   NSL"
FT   gene            361820..362383
FT                   /locus_tag="Mpet_0358"
FT   CDS_pept        361820..362383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0358"
FT                   /product="Protein of unknown function DUF1628"
FT                   /note="InterPro IPR012859; KEGG: mbn:Mboo_0980 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF1628; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1628)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35132"
FT                   /db_xref="GOA:E1RFY0"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFY0"
FT                   /protein_id="ADN35132.1"
FT                   /translation="MRFFVEDAVSAVIGVMLMLAVTIIIASTVAAFAGGASTTFEDTPS
FT                   ASLAVYCDGSVDDGNFNIIFEHLGGDKISTDDLKIVTWIEDGGGGVIKSNHTAKSPRSS
FT                   YDPYLRLPCVYDSQMSLSNDSEFGEALWKPGAVAGTDSTDATREFLGIPEGDSLGNYGG
FT                   TPVEVTIVYLPSGNTILKTEFLLE"
FT   sig_peptide     361820..361918
FT                   /locus_tag="Mpet_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            362391..362942
FT                   /locus_tag="Mpet_0359"
FT   CDS_pept        362391..362942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0296 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1628)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35133"
FT                   /db_xref="GOA:E1RFY1"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFY1"
FT                   /protein_id="ADN35133.1"
FT                   /translation="MKFYRDHLSGLSEVFGVMLMLTVTLIIACVVAAFACGHSFDAVDD
FT                   SISANIVASDWGRDDISPYIIFDHLSGDPVDLNSIEINLANRSSAKDKTVVSNKDGPTG
FT                   FDGNSHAYIENYGNIDDKTVTVGDRFILRVDDVVGDEIYWKNAEAGTGFSVQADEYLDY
FT                   RIIDLRSGRAISAGSIPVEI"
FT   sig_peptide     362391..362495
FT                   /locus_tag="Mpet_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            363724..365130
FT                   /locus_tag="Mpet_0360"
FT   CDS_pept        363724..365130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0360"
FT                   /product="cell surface protein"
FT                   /note="COGs: COG1520 FOG: WD40-like repeat; KEGG:
FT                   mba:Mbar_A1993 cell surface protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35134"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR025666"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFY2"
FT                   /protein_id="ADN35134.1"
FT                   /translation="MVLALFVPAAMAASYPQNGQFIAQYDEDKLAKDTSSENGGTTYYA
FT                   GEATKAAASLVSATTRSLDQYDWPQFMYDEANMGDSPCSSLPDDNTSVVIFDDREVIGT
FT                   VNPIVADGKIFLYTGYAGFDEPSGLTEINLTCIDESTMTVDWDFPLPRTQHLGSWGAPA
FT                   TDGTYVYAASDNKIYKIRISDCYEMWNFTTIENAMCNGGLTVTDDYVFGSDWYGDYYCL
FT                   FKDNGSQKWVFNNSDTRNYDMTYSQSTPAYDPDEGTAGMMYVCGWGYDSNTTYSGFLYK
FT                   VNVATGREVWSKGVGTGYSESFCGSPSTDGTNVYVASYSFSSDGNLYAYEIDGTYINKT
FT                   PIERTDATPSLDTENDLVYVSGGWNGGSWGSADPGVRCFQMDEYLTPVWDRENEEMGGW
FT                   TCSVAIGDGYVFVGKESGDMNSFCYNTTYALNASTGATEWFYPAGGATAAIANDKVYTA
FT                   GNDGFLYIFS"
FT   sig_peptide     363724..363759
FT                   /locus_tag="Mpet_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(366004..366834)
FT                   /locus_tag="Mpet_0361"
FT   CDS_pept        complement(366004..366834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0361"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR013373; KEGG: mhu:Mhun_0267 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF1628); TIGRFAM: archaeal
FT                   flagellin N-terminal-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35135"
FT                   /db_xref="GOA:E1RFY3"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFY3"
FT                   /protein_id="ADN35135.1"
FT                   /translation="MKKIKNDRETEAASPVIGVMLMLVVTIIIAAVVSGLAGDMGLDKK
FT                   TGPNVVLSEPVLDFDSDVTTGDLISVTTYAEDIETGDEDWVQAGYYNVHLPSTVNDQHG
FT                   LTFTHLGGDPIDLKDLQMSFNSNDLGIVVDYDSVRAQVSSGAFEPVYEVGDSCWDGWGI
FT                   VTRIELSYYGDPGREVDFTLDELADMINNKHYGYFVKISPETEDDTIIRTGDQFKVYTD
FT                   DGGQPWSIVAINDAGITQSFSFEFGSGNNWILSHKPSGEILGQGDLVFPDKTNE"
FT   sig_peptide     complement(366724..366834)
FT                   /locus_tag="Mpet_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(366892..367422)
FT                   /locus_tag="Mpet_0362"
FT   CDS_pept        complement(366892..367422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0362"
FT                   /product="Protein of unknown function DUF1628"
FT                   /note="InterPro IPR012859:IPR013373; KEGG: mhu:Mhun_0267
FT                   hypothetical protein; PFAM: Protein of unknown function
FT                   DUF1628; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF1628); TIGRFAM: archaeal
FT                   flagellin N-terminal-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35136"
FT                   /db_xref="GOA:E1RFY4"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFY4"
FT                   /protein_id="ADN35136.1"
FT                   /translation="MRLFSKKTEAVSPVIGVMLMIVVTIIIAAVVSGFAGGMSSTESKV
FT                   PNVAFTVDPDLDGNGTIMFKHTGGDELLIDEVLVQLEYDDRSITLSNLDNMTGHSDYDY
FT                   LSEMGGDTDGFITGGDRMVLTCDDNNAEEKAFIFKPDNAAINFTIPYYGHVNYMILDKE
FT                   SAKAIQTGEFVLR"
FT   sig_peptide     complement(367318..367422)
FT                   /locus_tag="Mpet_0362"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(367419..367997)
FT                   /locus_tag="Mpet_0363"
FT   CDS_pept        complement(367419..367997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR013373; KEGG: mbn:Mboo_0980 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF1628); TIGRFAM: archaeal
FT                   flagellin N-terminal-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35137"
FT                   /db_xref="GOA:E1RFY5"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFY5"
FT                   /protein_id="ADN35137.1"
FT                   /translation="MKKMEIREDAVSPVIGVMLMIVVTVIIAAIVSGFAGGMSDNQNTA
FT                   PTAAIQCSIVKEDADNVVMTLKHVSGDSLKTADLRFYVSYVNSTGTPVQERTQGVSVEG
FT                   FTDTEGNTVNATVPYLTDVKVGDVGDDDTNYGNFIWNPGQIITTGNGEGFEAITGLDPE
FT                   DVEIGDIISIRLVDTSSQKAIFDKDVRVQ"
FT   gene            complement(368020..368517)
FT                   /locus_tag="Mpet_0364"
FT   CDS_pept        complement(368020..368517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0364"
FT                   /product="Protein of unknown function DUF1628"
FT                   /note="InterPro IPR012859:IPR013373; KEGG: mhu:Mhun_0267
FT                   hypothetical protein; PFAM: Protein of unknown function
FT                   DUF1628; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF1628); TIGRFAM: archaeal
FT                   flagellin N-terminal-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35138"
FT                   /db_xref="GOA:E1RFY6"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFY6"
FT                   /protein_id="ADN35138.1"
FT                   /translation="MILKTEDAVSPVIGVMLMIVVTIIIAAVVSGFAGGYSDEDRKAPT
FT                   AIISCKATDNGLLFTHESGDFVDLVDCNIILTNGEDTRSFAGISELEKVDPIYSYSKDT
FT                   QITTGNQFYLTADSDGNGSGVDGAYLGWEDPDFYLTTDEIGTYKIIDRESGQIISEGVI
FT                   AI"
FT   gene            complement(368514..369074)
FT                   /locus_tag="Mpet_0365"
FT   CDS_pept        complement(368514..369074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0365"
FT                   /product="Protein of unknown function DUF1628"
FT                   /note="InterPro IPR012859:IPR013373; KEGG: mbn:Mboo_0980
FT                   hypothetical protein; PFAM: Protein of unknown function
FT                   DUF1628; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF1628); TIGRFAM: archaeal
FT                   flagellin N-terminal-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35139"
FT                   /db_xref="GOA:E1RFY7"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFY7"
FT                   /protein_id="ADN35139.1"
FT                   /translation="MNILPEDKESGVSPVIGVMLMLVVTIIIAAVVSGFAGGLTDSSTD
FT                   TPVATFEFKVYSAYVIASTHGDVEPYVEATMKGGEAIDTADLKIVSYHEDENGTLSSYE
FT                   FTKSAVTRPAHYTPNAFLSFTGTSTDNFFGETGCYWHTGEKFTGGPEYLLNVASPQAGD
FT                   KIEINMIYEPANTIIWSDEVTVI"
FT   gene            complement(369074..369685)
FT                   /locus_tag="Mpet_0366"
FT   CDS_pept        complement(369074..369685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0366"
FT                   /product="Protein of unknown function DUF1628"
FT                   /note="InterPro IPR012859:IPR013373; KEGG: mbn:Mboo_0980
FT                   hypothetical protein; PFAM: Protein of unknown function
FT                   DUF1628; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF1628); TIGRFAM: archaeal
FT                   flagellin N-terminal-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35140"
FT                   /db_xref="GOA:E1RFY8"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFY8"
FT                   /protein_id="ADN35140.1"
FT                   /translation="MEKKHRDLSLEAVSPVIGVMLMLVVTIIIAAAVSAYAGGMVSDQE
FT                   ETPTAQLDVQLKTEGTYPKLVFTHLGGDSLDTSELKIITYFHDITRTIDGTEVKGIYKH
FT                   TTDGSLNPMDPANYFDATDYEAGNGSLVSNNGYPCTVSNGVPVKYWGNSTMMPGDIYTT
FT                   IDQASIKSIITSGTVGDEPIEVEIIHIPSGKTIFSGEVIY"
FT   sig_peptide     complement(369575..369685)
FT                   /locus_tag="Mpet_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            370003..372624
FT                   /locus_tag="Mpet_0367"
FT   CDS_pept        370003..372624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0367"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mla:Mlab_1535 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35141"
FT                   /db_xref="GOA:E1RFY9"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFY9"
FT                   /protein_id="ADN35141.1"
FT                   /translation="MSVLKIKNPRGVVFLIILVVIGVLIAVPASARYPSPEGSNAGVNP
FT                   GDTVFNGERGLNFSTFQTMPPLEAPLWLACDDSGSALAMQTLKDSAVLSGRLNVGSSYL
FT                   DRPFKLYNGSWGNSICIVSEPDGGIEIRTGTALGTDVNPATTDTKTPAVIPLNMNVQFK
FT                   IDSTNLNNGNFVNPWYEYSLKTASGLKLSTVTNMNGDSVSLTDLMEDPTKNNNTLAFSI
FT                   GDQNLNPEEGSYVMEFTAYNGQNSFYTAEYDFDVVRYTLAASVSPSTVQMGDSTTLTIT
FT                   GRPYTYYTISIEDTMEGKPELSPTGNYDIYVNEYEAVVHPDWSGTVTVQLNIPEVEGDY
FT                   SRTTRNFYPKIYETNNPDTYTTAQITVEPGTSKDIELYDLPLSDEQYYCLGDTIPVEGT
FT                   LAAAASDDMYIYFYITGYNLDSNGDKPSSPSTGVVDYDNSTFDYVKISKGSAEFYFDWD
FT                   TSGTGLSSGTYTIFATTEPVGYESRGLSEEEVKDYLAVDLNDASINVKFPEEAPGFFAQ
FT                   GDHVVSLWSARGSPNSSSYTGTIRYWIIGKNFKYTGYTQFPLLKVDSDSTDAEQLSILA
FT                   EDNDFPGYSGLNLPRSFSNNMSEGSFYVIYQHPMNNQVFDVLPEEGNSYSGTITTIVTT
FT                   SGKTIDFSSLQSDSALAAIEEAFDSPYIDDTMVKQKFVIERARVNVDPVIDYEVGEAVP
FT                   ITGTTNLECAIDYPYNQIDLSGDSLTLAVYEADMYYSGKTQSTYRVYSDSTHPGRDTVD
FT                   LDSRSFSFEIPADISAQMKPGDYVGVMKCEEIKFEKPFLFTLHEEGYGKEQASASQNVG
FT                   EGLSDQPQSTKKTATATSQYTRSATTRATTEPTAKSSGPGPLFYIISLSSVAWAVLYRK
FT                   RR"
FT   sig_peptide     370003..370095
FT                   /locus_tag="Mpet_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            372629..374356
FT                   /locus_tag="Mpet_0368"
FT   CDS_pept        372629..374356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0368"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mla:Mlab_1536 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35142"
FT                   /db_xref="GOA:E1RFZ0"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFZ0"
FT                   /protein_id="ADN35142.1"
FT                   /translation="MDLAINQDLLSKITIAIVIGIVIVGAIIGLKVAGFLGGDESGSIT
FT                   SGPNSLSTATESSSTIRTQTSSQSTNEDSDEKVVDFNWTYKDKPFSIDFTIENSTYNSF
FT                   KTNHPLYSSDEETGDVITEYIVTDGDGGLVRGLANYILEQSVENGWGDYDTIMNTIACI
FT                   EQFGPGDFENTANDGSYRYPLETVWEGEGDREDMSILAASILDQMGYPVAIMVYPDQYD
FT                   RGQVIWEYPAIGIRCEEGTDGKTYTVLGSLPVGDVNCYIQAGTFNIPSMQSFKPENGYF
FT                   EGNGAVEYSGGQTAAAGEVSWDIPAATLETPENFTTRPGMVPVVCRIENASWVAGDSYV
FT                   YIDVLNSSVLPGEIPGELSKAEPVIFDSLIDPENGIEIVRDDEIDSTMTPLLRRPSPLE
FT                   EISDTEFKAGISEFLGLPPGPVGLVDEINEANNALEDEYWENVWYDTNVNYYDQTWYLN
FT                   VINYEIAEPVLLYTKSNEIYVSPPSAWRIECVARPVDPPDRDLDEISSFSDIRIAVFRV
FT                   DEDNGTAELAGEMSYGYKTGQENVKYLPFYETGNFYIAVFVRNCEAEISIQVHGRGAA"
FT   gene            374359..376104
FT                   /locus_tag="Mpet_0369"
FT   CDS_pept        374359..376104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0369"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG0630 Type IV secretory pathway VirB11
FT                   protein involved in flagella biosynthesis; InterPro
FT                   IPR001482; KEGG: mla:Mlab_1537 aminoacyl-tRNA hydrolase;
FT                   PFAM: type II secretion system protein E; SPTR: Type II
FT                   secretion system protein E; PFAM: Type II/IV secretion
FT                   system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35143"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFZ1"
FT                   /protein_id="ADN35143.1"
FT                   /translation="MNETEITGENAYSFEEIPSPGTETNPVESSSPPLKDGLTGKLDNF
FT                   LNSLNRKKEKSGKSDSNDTLSMLVGMLKQVKAGETDPVEELLPHDPYAETPPLPPLAPD
FT                   EEGWVIDRYWLVPPFTYVKIMKNWEMDLEYVIVEPKVSEKEFVLLEETYEELRNVLIYT
FT                   SPHQKDEVAFEERKVKRIIRSFDPEIPDDRLEILIYFLKRNFAGYGKIDPLMKDANIED
FT                   ITCNGKDMPIFIYHRKYANLATNITFGDEELNKYALKIAQKADKQMSLTTPLVDAALPG
FT                   GSRAQLTYSDIISSKGSSFTIRKFKADPMTPVDLITLGTYSSELMAVIWLCVENNKSMI
FT                   IVGGTASGKTSTMNAASFFIPPVSKTVSIEDTREIQLPHKNWLPLVTREGGKNFDMGDV
FT                   DMFTLLKASLRQRPEFIIVGEVRGKEAQTLFQAMNTGHTTFSTLHAGGVREAINRLTHD
FT                   PINVPPVMFGALDLMLIQGLQFNAGIGYRRCLSLNEMYADEGTIRWNPLYEWDLRSDKF
FT                   ERKYNESRVLESIAYTHGWTDDELSRQIDIRKRLLERLCEKKIYDINEISHFIHELRKK
FT                   TYNAD"
FT   gene            376094..377896
FT                   /locus_tag="Mpet_0370"
FT   CDS_pept        376094..377896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0370"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="COGs: COG1955 flagella assembly protein J; InterPro
FT                   IPR018076; KEGG: mla:Mlab_1538 hypothetical protein; PFAM:
FT                   Type II secretion system F domain; SPTR: Type II secretion
FT                   system protein; PFAM: Bacterial type II secretion system
FT                   protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35144"
FT                   /db_xref="GOA:E1RFZ2"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFZ2"
FT                   /protein_id="ADN35144.1"
FT                   /translation="MQINTFVESLLDVKKLGRSLKGARLPINPNLYLHFCIILTLLSAF
FT                   ALLIVQLFLLVFGVEFNLIPILPYSISQLLVFVIAVFAIFAALFYYPSLVAAGRKTRID
FT                   IDLPYALTYMEALSTNVTLYSLFKSVFEAEDLYGEVSHECGMIVRDVEIFGEDLLTAMR
FT                   NLQKITPSENFADLLNDLALVFRTGGNLKEFFNSRSDSYRELARQELEATLQIMEMIAE
FT                   VYVTAFVAGPIALIIMLVAQNLSGRGQLGGIMPLMYVGLPLGAIALIMILYYLLPSDNL
FT                   TISHQEIRETEFTDEIIEEKTEKEYDPGFFKNLEKRKKFLMVEKILRDPFRFYISDYQV
FT                   GLFFGLAFSMIVAWQYVSGGVAAIFPEFTFEVFICLFVIALVLPVSIAYESRKMYTRRV
FT                   EAQMPEFLRDIADMKDLGMTLQTAIEMVSSSKLGLLSSELKIASREVKWGYSVSSALVR
FT                   MEERIGLVSVKRAISLIVKASEITDQLRDILTIAISDLDHYLKMQSKRFNVSFVYLAVI
FT                   YLSFGIYLYCSYQLNDSFVASFEDLDVTFDITGNLRDMFRVGIIIGGFSGIMAGQLSSN
FT                   NILAGLKHTIIFLIASIVLFVYIL"
FT   gene            377912..378895
FT                   /locus_tag="Mpet_0371"
FT   CDS_pept        377912..378895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbn:Mboo_2383 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35145"
FT                   /db_xref="GOA:E1RFZ3"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFZ3"
FT                   /protein_id="ADN35145.1"
FT                   /translation="MKGVRELKISGEVSCKRNLEEAVAPVIALMLILAVVATFISLYST
FT                   EYLPGLKEQSEIAQVSEVKEAFMDFSNDIGHIVSEKKGASYGHTIPLGAGDVIMSPEKS
FT                   SGTLSVSDAGTIFDVYNDSSGDPVASAGMVKAEFKPSYTFWEGQGYSWQYGYINVTKDD
FT                   IEVPLEDYTMADVTGSEEFSAFAESLIDFEDAGFYNSTSGETELSSLEIDLVTFVQGDK
FT                   NFVSGNSAAVLKILARENATSFNTSYLSFRFENSTGSDVIPEFSVFLFDKIETEMEALH
FT                   DSYGNVPSPEVTRVSGGYDTIVLDMSESPSPVLVGIDSLEVVVSTS"
FT   gene            complement(378904..379236)
FT                   /locus_tag="Mpet_0372"
FT   CDS_pept        complement(378904..379236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0372"
FT                   /product="small multidrug resistance protein"
FT                   /note="COGs: COG2076 Membrane transporter of cations and
FT                   cationic drugs; InterPro IPR000390; KEGG: mbu:Mbur_2325
FT                   small multidrug resistance protein; PFAM: small multidrug
FT                   resistance protein; SPTR: Multidrug resistance protein;
FT                   PFAM: Small Multidrug Resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35146"
FT                   /db_xref="GOA:E1RFZ4"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFZ4"
FT                   /protein_id="ADN35146.1"
FT                   /translation="MMRWLLLATGILMELAGSTCMKLSDGFSNIYASILTFVFWGISFT
FT                   VFIFALKHFDLSFAYAIWAGMGILLVSMIGILYFKEPASSMKVLSIIVIVAGVIMLNLS
FT                   ENPAAV"
FT   gene            complement(379413..379826)
FT                   /locus_tag="Mpet_0373"
FT   CDS_pept        complement(379413..379826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0373"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hya:HY04AAS1_1153 MscS mechanosensitive ion
FT                   channel; SPTR: MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35147"
FT                   /db_xref="GOA:E1RFZ5"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFZ5"
FT                   /protein_id="ADN35147.1"
FT                   /translation="MTTENFKKIKEWGFFIYVCLIFAYFFLNILCHNTMTKDAVSGWVF
FT                   IGPWIIFPFIGFFISMYLISGKEPVDESDKTEIRERCTGLKASVVAFVTWLIVLVLLEQ
FT                   IQLEANNIISVVCGCFFFLGIFGLLKRIDKKSE"
FT   gene            complement(380132..380545)
FT                   /locus_tag="Mpet_0374"
FT   CDS_pept        complement(380132..380545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mem:Memar_0094 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35148"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFZ6"
FT                   /protein_id="ADN35148.1"
FT                   /translation="MKVTALFGSLILAIIAIIYLIGSEHLDDGVNPPSLFSIYNDDKAP
FT                   HEVNITIFGVNGTHNNTQVCSETFWVKAGGKKKSSFKNDDGGEYLFKISIDEGALQEFT
FT                   LLIERSNSLAISVLTEKDIEISTMAQNRTMEKD"
FT   gene            380999..381850
FT                   /locus_tag="Mpet_0375"
FT   CDS_pept        380999..381850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0375"
FT                   /product="transposase IS4 family protein"
FT                   /note="InterPro IPR002559; KEGG: mpl:Mpal_2299 transposase
FT                   IS4 family protein; PFAM: transposase IS4 family protein;
FT                   SPTR: Transposase IS4 family protein; PFAM: Transposase DDE
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35149"
FT                   /db_xref="GOA:E1RE61"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:E1RE61"
FT                   /protein_id="ADN35149.1"
FT                   /translation="MSENWYINFVKTSLEVIDNSHVPLRSSKFSKKKYTQHQLLTLIIL
FT                   KEKIGKDYRDFIELLPNLTTITDILQLEQIPHYTTLQKFLSRIPSLTFRIILKNVIRRL
FT                   HQKGNQIRITSIDSTGFTSSYASYYYSKRINKTRKSFIKASIAVDSDKLIIMGWKFSKV
FT                   PVHDSQHAKSLINQVSRITKTDCFTMDKGYDSEKIHQYIRDVIGAESIIPVRKWNGNIY
FT                   SGKYRKEMIENFNQEKYGQRNMVETVFSVIKRKYKENVRSRKYFNQIKEIKIRMLIHNM
FT                   TL"
FT   gene            complement(381949..383121)
FT                   /locus_tag="Mpet_0376"
FT   CDS_pept        complement(381949..383121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0376"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fpl:Ferp_0236 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35150"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFZ8"
FT                   /protein_id="ADN35150.1"
FT                   /translation="MALTKPIFIFFMSEERKRTAKKGFLLILLLSAFTMMTIPASASSF
FT                   GLSSNNINSSDTDSHYFSYLNLSINEVMNYRDKMPAISYNISDQDNRFNYNALFFPDVP
FT                   EDAELAGYYMQVLPNGVSSSYMELFDANATLPSQDIFLARANEWIGGEETSVIGTMNDC
FT                   FQNGIYFYSGYHEIARHTTVRKYQGIGKITATTVVSQYLNDGDSERDYFCIGSYVEMTP
FT                   EDETGNGTGWKNSKFLVNYDFNTGYCSTKPLEVESPISNPQTSPHYLKPQGDLLGGFLN
FT                   NFDKIGLLSGLFGHSVSLHSNVEDSTKMSWVTECGYFTENAAESLSLTPVSEVMPLQSA
FT                   VDGDNWHVLARIGIDADSGWSRVGGLIKEPSPSSEWISYILMHSVPAAEN"
FT   sig_peptide     complement(382996..383121)
FT                   /locus_tag="Mpet_0376"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(383132..384226)
FT                   /locus_tag="Mpet_0377"
FT   CDS_pept        complement(383132..384226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0377"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fpl:Ferp_0236 hypothetical protein; SPTR:
FT                   Serine-rich repeat protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35151"
FT                   /db_xref="UniProtKB/TrEMBL:E1RFZ9"
FT                   /protein_id="ADN35151.1"
FT                   /translation="MVLALVGAMFVPAVSAGNTSQSSPKDQDVQYNVEKYTVRLVDSEI
FT                   TLDEIDTQTQKILDDFQGEFKNVSSRYIGAAEPDVSKDEKIVGYVFRILPSGESFSYTE
FT                   TVSADDSISTKEISSKIDAWIDGPLKIKTTESLNKASRSKSRSEPDPIHTAYTSVKNYP
FT                   DIGKAQLITTWYWDNQETNSNQDYFFTKTTLATDPGIDISGYDIYQNYHFNIEINSDYS
FT                   LGSYQHLPNVAVSQNNPQTTTGFTTLGLSLGTSSCSLGWSTTIPDSSVILHHSSGNIYN
FT                   WDEEFTHYTNCARSHFEFTPGQESVCSQSSARGGSTYIISRVKADVSNGWAKINDGILC
FT                   FAPSGTNAWGHYCKVRWNGDYNHV"
FT   sig_peptide     complement(384179..384226)
FT                   /locus_tag="Mpet_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(384558..384965)
FT                   /locus_tag="Mpet_0378"
FT   CDS_pept        complement(384558..384965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0378"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mem:Memar_0094 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35152"
FT                   /db_xref="UniProtKB/TrEMBL:E1RG00"
FT                   /protein_id="ADN35152.1"
FT                   /translation="MVALVGSFIVACSAIFYLIGSERLDDLVTPPSLFSVYNDDEVPHE
FT                   VNITIFSVNGTHNNTQVCSETFRVKSGGKKKSSIMNDDGGEYLFKISIDKGALQEFTLL
FT                   IERSDSLVISVITEQDIEISTIVRNRTMEKD"
FT   gene            complement(385028..385993)
FT                   /locus_tag="Mpet_0379"
FT   CDS_pept        complement(385028..385993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA0506 hypothetical protein; SPTR:
FT                   Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35153"
FT                   /db_xref="UniProtKB/TrEMBL:E1RG01"
FT                   /protein_id="ADN35153.1"
FT                   /translation="MENKKIIIGTLFAVAIIACLVISFEVIGNISEQAYSTGYDSGIVM
FT                   KSAGGSVPEFVLNTQFTNEKDTVQLYNVNNKKLNSEQIQSIAEFFDLKGDLETYSKNTG
FT                   ELKIVDDSYDPQRQISYYPKSGAIVYSIPDEEYPNTVESQPSLPSKDEAIKIAESFVQK
FT                   TNTYEEEGFVKNVEVNQKQQVWKSGATEPEKSYDITTAVRYSRDLDGIPVYGDEFSVII
FT                   GDGGKVVGLVKSWREVEQGGTGRLKTAEDAYDDLCNRDTVNPLNLADYDKITIDEISLG
FT                   YWMEPRIYEQDQVKPVYVFSGTATRGDKTDPYVEYVYALE"
FT   sig_peptide     complement(385925..385993)
FT                   /locus_tag="Mpet_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(386172..387125)
FT                   /locus_tag="Mpet_0380"
FT   CDS_pept        complement(386172..387125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0039 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35154"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGE3"
FT                   /protein_id="ADN35154.1"
FT                   /translation="MTGIIDDNSGALNPESVAYQPSAVGEGFGIGLYDAPFHIPDHSLH
FT                   YSKELLENESFKGYLYINNQLAENNSFLIFCLVDYNQTSFSCDGSEKGILHKISLNPFE
FT                   ERFVQFSIDPLEKGVHDFEIFTLLKTDQHSLNKSFRLSTDFSYLGSKRMNLFVVDDKLP
FT                   EVQYTNFSLLSASNCGYDYPINDGIILTKEPCSSKGWFTEDVRSGEVLHYWINLAADKE
FT                   YPVSFAVITLLDYKQVPLRTNMQDKCWFGSLSAGEKISVPASIISPSEDGVHELMSIYL
FT                   PLPYQRLETSPGVPTQFNQWTWSEPSIRIGLNVSTV"
FT   gene            complement(387248..387922)
FT                   /locus_tag="Mpet_0381"
FT   CDS_pept        complement(387248..387922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_1015 putative DNA-binding
FT                   protein; SPTR: Putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35155"
FT                   /db_xref="GOA:E1RGE4"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGE4"
FT                   /protein_id="ADN35155.1"
FT                   /translation="MLQGFCPTIRNGQIPYVPGGINVNGLKNYLKPLTILSPGAEKNGD
FT                   KNMKIKKGMRALSLLLIVALVGVMFVPAVSAEQSDDQQFSQGQVIDPEGMELTRTSQSK
FT                   ISDTSASGVLKSSYDWIAGTNIYREFPDPVKSKFYSESRLSGTTTPYNVYKVGVRGRAW
FT                   REGIFKFDKTDENYYSADAAVNYECSDTYVGGHWLAQSDHTFEYPANNDYYYPTTTDDM
FT                   DL"
FT   gene            388055..388516
FT                   /locus_tag="Mpet_0382"
FT   CDS_pept        388055..388516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A3376 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35156"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGE5"
FT                   /protein_id="ADN35156.1"
FT                   /translation="MRGKILIFLTALLITALLTAPVMAGEVIEKKMENNVIVVPSVDGF
FT                   IQELSGTKAQHQISQGEMVCHSRSVWPLTSKIDVTLTWDEHYGDLELYVYTPDDSFVGH
FT                   YTDLYDSSVRDGMIDIDIRSSTGYLPVGNWKLNVYGRQVSGSSISYSLL"
FT   sig_peptide     388055..388126
FT                   /locus_tag="Mpet_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            388556..389287
FT                   /locus_tag="Mpet_0383"
FT   CDS_pept        388556..389287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0383"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COGs: COG3398 conserved hypothetical protein;
FT                   InterPro IPR000835; KEGG: mem:Memar_1272 hypothetical
FT                   protein; PFAM: regulatory protein MarR; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35157"
FT                   /db_xref="GOA:E1RGE6"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGE6"
FT                   /protein_id="ADN35157.1"
FT                   /translation="MKYQGAAIAVVLILILAYAHQATIYSNIIVTPSEEPPDLLREDNV
FT                   HVLNWWEVSPRHYFVLLISLYSPFLIPLAAIVTVLAGLSFGIRQIEKKNILENEWREDI
FT                   FRLITENPGITQIEVEHMAEINRSSLRYHLKMLMREEKIVSIKASKKIHYFENHNGYIP
FT                   EAQVAKTILDSPAAKNIFRYIYTNPGCTQKDLAEYMNLSCSTISWHIERLSSGNLVNIQ
FT                   KESNFNHYYAENNFEMDAAFL"
FT   sig_peptide     388556..388612
FT                   /locus_tag="Mpet_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(389735..390184)
FT                   /locus_tag="Mpet_0384"
FT   CDS_pept        complement(389735..390184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A2065 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35158"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGE7"
FT                   /protein_id="ADN35158.1"
FT                   /translation="MQKKALLAGLFLMILILSVLFFLSISNVEDSPDSCLPPPTSIFRL
FT                   VNKDINQSHSVSVIINDPSNNTLAKESYNLAPYGSTKSTFVITSETSTTTNPYYLIFNV
FT                   DDNISSEIAVNVSYHSIPEFHIDPVNGEVSLYIYLLNGDYGCKVE"
FT   sig_peptide     complement(390101..390184)
FT                   /locus_tag="Mpet_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(390208..391692)
FT                   /locus_tag="Mpet_0385"
FT   CDS_pept        complement(390208..391692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0385"
FT                   /product="Peptidase M12B, propeptide"
FT                   /note="InterPro IPR002870; KEGG: mem:Memar_0093 peptidase
FT                   M12B, propeptide; PFAM: Peptidase M12B, propeptide; SPTR:
FT                   Peptidase M12B, propeptide; PFAM: Reprolysin family
FT                   propeptide"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35159"
FT                   /db_xref="GOA:E1RGE8"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGE8"
FT                   /protein_id="ADN35159.1"
FT                   /translation="MLQGFCPTIRNGQIPCVPGGINVNGLKNYLKPLTILSPGAEKNGD
FT                   QKMKLKLKMPALSLLLIVALAGAIFVPVVSAENVVPVDATINMKYFTDISDQLKSRSTE
FT                   SVPISEYSLVTVDPIAFMRDADNGKLLEYSLNGENYSIELSEVPSIIAPDAKLYIKTND
FT                   GTTVSDIPTIKQYQGRIVGTKSGDAFFTVDDNVILGRITMDDESYFISQSERQADGKIV
FT                   HIVYNSKNEIEREILPNEDDIIPITISQEQLELSDNNEIENTISSKSVTTVSLLAVYDS
FT                   QFHNAYPSSTSEITSMMSTVAEAFSPSYIGVNFQINAFSWDATLTSTDKDDLAEELVDS
FT                   QSSYRDSTNSDLVSLFTGRDLDGNDIGNGGQFTNGVYEESAYSLTQMTDSGTSYTASSY
FT                   QRPILITHELGHNFGAMHQTAPSSYSGAPFYIPSYARASTWTSWWTDYYSAMWAPFQTG
FT                   TSMKNEFSSLDSGHGDSNHNNALRISQVKATVAGYQ"
FT   gene            complement(392181..393161)
FT                   /locus_tag="Mpet_0386"
FT   CDS_pept        complement(392181..393161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0386"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro IPR000073;
FT                   KEGG: mbn:Mboo_0148 alpha/beta hydrolase fold; PFAM:
FT                   alpha/beta hydrolase fold; SPTR: Alpha/beta hydrolase fold;
FT                   PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35160"
FT                   /db_xref="GOA:E1RGE9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGE9"
FT                   /protein_id="ADN35160.1"
FT                   /translation="MRKKIEKIYLAAIIFALVLVIFSAGCTGETGFDNSLSENSDNLTL
FT                   SEKSYSVFDDAELHYANVNGINIGYKQAGEGYPLVMVMGYATTMDAWDPSLLNSLAENY
FT                   NVTIFDNRGTGYTDLGEITAENVTYETYANDTVALMDALGIKRSYLMGWSMGTAVSEEI
FT                   ILKYPEKVEKAVLYAPYYNVSSSDEEYLREYLRQVAYGEANKSIVIENMFPGDWLICHN
FT                   PDEYLPASSETLNESGIMAAYYASLNWNGSLERLNQIEIPVLLTGGTEDVLTPPEFLRT
FT                   MAGEIDGAWTAEFKGAGHGLMYQNPDGLAKTVNLFLDLDEDIRCC"
FT   sig_peptide     complement(393078..393161)
FT                   /locus_tag="Mpet_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            393594..395795
FT                   /locus_tag="Mpet_0387"
FT   CDS_pept        393594..395795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0387"
FT                   /product="putative cytoplasmic protein"
FT                   /note="KEGG: sat:SYN_00496 putative cytoplasmic protein;
FT                   SPTR: Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35161"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGF0"
FT                   /protein_id="ADN35161.1"
FT                   /translation="MGLEKLDINFKNCYGINNLEFEFDFSQKGTRRSNVHAIYASNGVM
FT                   KSSFAETFRDLSRGEKPSDRIFPERKTICRVKDQNGTSLKEEQIYVIAPYDDLFESDKV
FT                   SLLVAKRELKDRYDIIHQEIYEKREKLLEALKIFSKIRNPEDIEQIISSTFGGTDFLLS
FT                   LYNLEECISSFNSDDLSKYSYSDIFNNKIIDFLKIEENRRLLAEYIDKYNELIEKSDFL
FT                   RKGLFTHNNASNVSNSLKSNGFFLAEHSVVLKSRTGENQINSDKDFNKIIDTEKEKIFS
FT                   NKELMTKFNSLDKAITKNEDLRKFRKLLENNKELIPELMDLGKLNKKMWLSYLKKEEGI
FT                   YLELINKYKSGKREIEVIVSEAKKEISDWDHVIDKFNDRFFVPFKIEIVNKDDVILKGD
FT                   VETLEFIFEDSKGSKNTTKSEIKSILSTGEKKALYILDIIYEIEARKKTNQETVFIIDD
FT                   IADSFDYKNKYAILEYLMDISKEDFFYEIILTHNFDFFRTINSRLIPHYNCHIAERTES
FT                   AVQLKTVKSKSEIQRPFKDWIKNLSEVEHYSVAIIPFLRNIIEYTRDTNDPNYLNLTSM
FT                   LHHKDNTRNLKISDLELILIKEFNEPNLKLENGDEKILDSILEFSDEFSCLNQLSLDQK
FT                   IVLSMGIRLSAEHLMIQLINDPDFVKGIKGPQTGKLFEKYKKLPNSDNYTIKLLEKVNL
FT                   MTPENIHLNSFMYEPIIDLSSDHLCKLYKDLKILNQSIL"
FT   gene            complement(395808..395893)
FT                   /locus_tag="Mpet_R0007"
FT   tRNA            complement(395808..395893)
FT                   /locus_tag="Mpet_R0007"
FT                   /product="tRNA-Ser"
FT   gene            complement(396007..396411)
FT                   /locus_tag="Mpet_0388"
FT   CDS_pept        complement(396007..396411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0388"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="COGs: COG3576 flavin-nucleotide-binding protein
FT                   structurally related to pyridoxine 5'-phosphate oxidase;
FT                   InterPro IPR011576; KEGG: mhu:Mhun_0462 pyridoxamine
FT                   5'-phosphate oxidase-related, FMN-binding; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding;
FT                   SPTR: Pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; PFAM: Pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35162"
FT                   /db_xref="GOA:E1RGF1"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGF1"
FT                   /protein_id="ADN35162.1"
FT                   /translation="MVKLTDNILEAMGNLKTFYLATASKDGVPNVAPMGAVFVKDPETI
FT                   WIQDNFMMKTLANVEENPKAALSVYGAGAKGCFQIKADVTVMKSGPELAEMKALIEKMK
FT                   PGLPGKSLLVLKVTGVYQCMPGPEAGKKLL"
FT   gene            complement(396499..397416)
FT                   /locus_tag="Mpet_0389"
FT   CDS_pept        complement(396499..397416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0389"
FT                   /product="pseudouridylate synthase TruB domain protein"
FT                   /note="COGs: COG0130 Pseudouridine synthase; InterPro
FT                   IPR012960:IPR002501:IPR002478; KEGG: mpl:Mpal_2750
FT                   pseudouridylate synthase TruB domain protein; PFAM:
FT                   pseudouridylate synthase TruB domain protein; DKCLD domain
FT                   protein; PUA domain containing protein; SMART: PUA domain
FT                   containing protein; SPTR: Pseudouridylate synthase TruB
FT                   domain protein; PFAM: TruB family pseudouridylate synthase
FT                   (N terminal domain); PUA domain; DKCLD (NUC011) domain;
FT                   TIGRFAM: rRNA pseudouridine synthase, putative; tRNA
FT                   pseudouridine 55 synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35163"
FT                   /db_xref="GOA:E1RGF2"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR026326"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGF2"
FT                   /protein_id="ADN35163.1"
FT                   /translation="MTDFSDPGLNSALNCGVVVLDKPQGPSSHQAAAWAAEILGVNTGQ
FT                   GGTLDPMVSGVLVLMLGRAVRLAPVLLNHRKEYVALMRLHKDVPEERIRTVAKEFIGRQ
FT                   YQRPPKMSAVKRQLRIREIYDLEILDIEGRLVLMRVECEAGTYIRLLCRHIALAMGAGG
FT                   QMVELRRTKSGPFTENECVTLHDLKDAVEYAKEGNSGPLEKMILPVERLAGSLPKVVIR
FT                   DKAVDAVCHGAVLAAVGILEKDNYKKNARVAVMTQKDELVCVGKAIVSSEDYAKSDTGL
FT                   VIRPEIVIMEPGTYEKGWKTKKRD"
FT   gene            complement(397409..398104)
FT                   /locus_tag="Mpet_0390"
FT   CDS_pept        complement(397409..398104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0390"
FT                   /product="uroporphyrinogen III synthase HEM4"
FT                   /note="COGs: COG1587 Uroporphyrinogen-III synthase; KEGG:
FT                   mem:Memar_0539 uroporphyrinogen III synthase HEM4; SPTR:
FT                   Uroporphyrinogen III synthase HEM4; PFAM:
FT                   Uroporphyrinogen-III synthase HemD"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35164"
FT                   /db_xref="GOA:E1RGF3"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGF3"
FT                   /protein_id="ADN35164.1"
FT                   /translation="MRIAVTRLREKAGKDAETCKRYGHECYIVSPLNARIYEDAVMEFV
FT                   SAANRDEFDCIFFTSALPAQVIGPLLQVRPRMVAIGPQTAKTLTEMGFDCETLPDFYSR
FT                   DFAPYLGDWIRGKRIGIPRADVPNPQLIDSIEDKGGIAAETRIYGLEPTGEKLDLDGAD
FT                   AVLFTSAGSFRNAVWDKDQKILRVAIGDVTGKAMELSGCPPDVTGDGSLTGTLEALNKY
FT                   LESGDMQSD"
FT   gene            398208..399413
FT                   /locus_tag="Mpet_0391"
FT   CDS_pept        398208..399413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0391"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="COGs: COG1784 membrane protein; InterPro IPR002823;
FT                   KEGG: mpl:Mpal_2746 protein of unknown function DUF112
FT                   transmembrane; PFAM: protein of unknown function DUF112
FT                   transmembrane; SPTR: Putative uncharacterized protein;
FT                   PFAM: Tripartite tricarboxylate transporter TctA family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35165"
FT                   /db_xref="GOA:E1RGF4"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGF4"
FT                   /protein_id="ADN35165.1"
FT                   /translation="MYDIIAGVAIGVVLGTISGLIPGIHANTMAGILLSVQGALLVVAG
FT                   PAALAVSMFSALVTHTFLDAVPAAFLGVPDADTAISVLPSHRMCLEGRAGEAVRLSAIG
FT                   GAFGTAISLPLFAAFYFLLPSLQGYIDWWIGIILITFAGILILQSESPEWSFAVFMVSG
FT                   ILGLLTFRYSWLSWNTLGDSSFLMPLLTGLFGISVLLHTKHGKMPPQENKGVSLSLRDI
FT                   AKSGTAGTVAGAVVGWLPGLSNASANAVLASIFRIEKEGEGFITATGAANTANAFLALA
FT                   AFYAISRTRNGVMVALSQGDIPPVTTLLFAGALAAFAAYILTIVLSGSASLFSGIDARK
FT                   LGFAVIGFVTILCLVFTGPFGLVILVLATMTGLVPYYVNIRRIPCIGAVMLPVICWSFG
FT                   LL"
FT   gene            complement(399433..400359)
FT                   /locus_tag="Mpet_0392"
FT   CDS_pept        complement(399433..400359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0392"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="COGs: COG0530 Ca2+/Na+ antiporter; InterPro
FT                   IPR004837:IPR004481; KEGG: mem:Memar_0354 CaCA family
FT                   Na(+)/Ca(+) antiporter; PFAM: sodium/calcium exchanger
FT                   membrane region; SPTR: Na+/Ca+ antiporter, CaCA family;
FT                   TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   Sodium/calcium exchanger protein; TIGRFAM: K+-dependent
FT                   Na+/Ca+ exchanger related-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35166"
FT                   /db_xref="GOA:E1RGF5"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGF5"
FT                   /protein_id="ADN35166.1"
FT                   /translation="MIIDILLFIAGLAFLIKGADYFVSGGAGLAARFGVSPGTIGLTVI
FT                   AFGTSLPEFVVSLNALAEGSSGIALGNIIGSNIANIALVLAVCAIIAPAVLSCKGCLRK
FT                   DPIVSDYLMMIAATVIFLVFAFFSPLGIPAGVVFLAAFAVIIYHQWKKGKTDSEKIEAH
FT                   GNLDYIYIAGGIAGVVIGSRILLISATSIAQTFGISDYVIGISMVAVGTSLPELATSLV
FT                   AVVRGQHGISIGNILGSNIFNLLFVLGVGSLVTQVPVPDYSGVLIMAGFSAAAILLFTK
FT                   SKTATRAFGFVLLALYAVYIYLAFTAI"
FT   gene            400472..401347
FT                   /locus_tag="Mpet_0393"
FT   CDS_pept        400472..401347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0393"
FT                   /product="Pre-mRNA processing ribonucleoprotein, binding
FT                   domain protein"
FT                   /note="COGs: COG1498 Protein implicated in ribosomal
FT                   biogenesis Nop56p homolog; InterPro IPR002687; KEGG:
FT                   mem:Memar_0541 pre-mRNA processing ribonucleoprotein,
FT                   binding region; PFAM: Pre-mRNA processing
FT                   ribonucleoprotein, binding domain protein; SPTR: rRNA
FT                   biogenesis protein Nop56/Nop58; PFAM: Putative snoRNA
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35167"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR036070"
FT                   /db_xref="InterPro:IPR042239"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGF6"
FT                   /protein_id="ADN35167.1"
FT                   /translation="MQRYWFGDITDGGECIPFSRETNELIERCRSLEPEMDNFVPVEPE
FT                   TAVECGVFSSRQDYIAELRKITAALAREKISEYYSSGDIELIQMVRMLNELDHVINLLV
FT                   ERGMEWYIVKNPDFSRKYKNMNQKKVIGMMRRQKRSGLSSIAAEIDALSDKRTRLMKEI
FT                   SGKAVEVAPNCSEIVGGLVAARLISSVGGLKELAFLPASAIQVTGAESALFTHLKGGTP
FT                   SPKHGIIFQHRRVHNADRAVRGKVARVVAGKLGIAARIDYFRGEADVEFLKKAQERIDA
FT                   VFGGVGGDSE"
FT   gene            401344..401946
FT                   /locus_tag="Mpet_0394"
FT   CDS_pept        401344..401946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0394"
FT                   /product="fibrillarin"
FT                   /note="COGs: COG1889 Fibrillarin-like rRNA methylase;
FT                   InterPro IPR000692; KEGG: mbn:Mboo_0517 fibrillarin; PFAM:
FT                   fibrillarin; SPTR: Fibrillarin; PFAM: Fibrillarin"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35168"
FT                   /db_xref="GOA:E1RGF7"
FT                   /db_xref="InterPro:IPR000692"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGF7"
FT                   /protein_id="ADN35168.1"
FT                   /translation="MIRIGSVLVSEGKGGVYGEKMLKGYRVWDPYRSKFAALAKIYDGI
FT                   DLESERDVLYLGAANGTTVSHFADYVRTVYAVEFAPRPMQDLIEVSDRRKNIVPIMADA
FT                   TRPVEYAAFVSSVDMIYQDVAQPNQAEIAISNLPFLKKGGTLVLMLKTRSVDVCESPES
FT                   VFENSKTILESSGLEIEFSCWLKPYHKDHVCIVCRRV"
FT   gene            401962..402669
FT                   /locus_tag="Mpet_0395"
FT   CDS_pept        401962..402669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0395"
FT                   /product="protein of unknown function DUF1614"
FT                   /note="COGs: COG4089 membrane protein; InterPro IPR011672;
FT                   KEGG: mpl:Mpal_2743 protein of unknown function DUF1614;
FT                   PFAM: protein of unknown function DUF1614; SPTR: Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1614)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35169"
FT                   /db_xref="GOA:E1RGF8"
FT                   /db_xref="InterPro:IPR011672"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGF8"
FT                   /protein_id="ADN35169.1"
FT                   /translation="MKRLIYLSPFSLLLIAALVVILILMIPLLFLGLIGSAFSKLGFGL
FT                   AGIILILVATIAGSFFNIPVMRIKSAPEVVRVPHGRLMDYRYRPQFSGGITIVAVNIGG
FT                   AVVPVLVSAYLLTRVFIFQEGSGILLSSLAGILIVAAVSYLVAKPVQGVGVGIPILIPP
FT                   LSALICGLVLSFGISGAAPVIAYVSGTLGTLIGADLLNLRKMCSVGADMVSIGGAGTFD
FT                   GIFLTGIIAALLA"
FT   sig_peptide     401962..402078
FT                   /locus_tag="Mpet_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(402735..402807)
FT                   /locus_tag="Mpet_R0008"
FT   tRNA            complement(402735..402807)
FT                   /locus_tag="Mpet_R0008"
FT                   /product="tRNA-Gln"
FT   gene            403380..406019
FT                   /locus_tag="Mpet_0396"
FT   CDS_pept        403380..406019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2263 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35170"
FT                   /db_xref="GOA:E1RGF9"
FT                   /db_xref="InterPro:IPR024277"
FT                   /db_xref="InterPro:IPR026371"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGF9"
FT                   /protein_id="ADN35170.1"
FT                   /translation="MTKKFALALVSLMVLAFIVVGSASAAPAYATNITPGQTIFIGESG
FT                   LNIALALGADADGTTPISKIAWFSSGTAVASEQPAIVYSVGDNSSFYVQNAMFSAYEGS
FT                   WYGYNGSIGSATLAFYVYKPSLAVSIWDIGTDGSATDVTGKKVTTGDNVTLRVDSNLFS
FT                   LFERPSNVSSQALNGIDINVVTPSGATLVKLTNSSATNFTTNITGIRPTSSQYYLLTSS
FT                   AKPLNGTATPWQLNISQYSAGTYEVTAKCNINGMKDNLGSITGVTVSETATLELDKDTV
FT                   SITADKETVVRNNDFSVTIDGKPSTYYYVWMSGTNSYTYGNGSGDADTADIPPQFQINQ
FT                   DDVDFLSNNISSGDNTGLNYTYKSGTRIYQDVANNASYTAATSNLNPYAVEVKTGKDGM
FT                   ITVGITTGSNTKAATYTVRVESESDTQLYDTVKVTVEKGSVTITASGDGSYYLGEQITF
FT                   SGTDTDSDYVYLFITGPNLAENGANLETPSIALENGNASTFVTKAVNVDNTWEYKLETS
FT                   TIGLDAGTYTVYAVNEPADKAHLSGTKYDTVSIVVKKPFVTATVSASTVAKGDKLYIRG
FT                   TAEGNPTQGVAIWILGKNYWNGEATNSDAMVTETVNDDGSFEYEFGSGDTKNLASGQYF
FT                   VVVQHPMYNDEFNVFTGGVSPTFVIESPDRSAYATNNNEYNARFVIWGGDNKLQGSDAA
FT                   EALIEMIDSADIDDTYTKLTFLVEEPWIRINTVGDHYVGDQFTISGTTNLAVDDDLIVE
FT                   VTSSSFTATQKSQSGEFSGQSETVKVVAGTTYNEWSMDVDASTFKADEYIVNVESIETS
FT                   ATATTTFNILTPGPSTPTVTSTATSGPVTTTATTTQATPTETAAPGFGALVALIGLGAV
FT                   AALVLRKE"
FT   sig_peptide     403380..403454
FT                   /locus_tag="Mpet_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            406139..407557
FT                   /locus_tag="Mpet_0397"
FT   CDS_pept        406139..407557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_0552 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: PEGA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35171"
FT                   /db_xref="GOA:E1RGG0"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGG0"
FT                   /protein_id="ADN35171.1"
FT                   /translation="MDNKRIFAACFIFFILLFLIPPVSASTTTLTITVTDDYDGSVIED
FT                   ASIYIAGTYVGETDSDGEYEYTHSKSEKFRVTIKKDGYDYWTDMVSYTRTSLDVELERA
FT                   SGSLTINILDSDTLKPIEDAIVKVSGDDIDDSESTDDDGSAEFSVYTGSTYIVVVKKDN
FT                   YNSIEREVEMDESSMDVDYLLQRNDRVIFQVTESESGLPLDGVSVYIDGDLEGVTDSEG
FT                   RLNVYLDHEESYYIEIKVDEYQSYTDTHYFGIDDIIYSVSISKTLYPVSIAVYDSSKVP
FT                   IEEAEIYIDDSYFGKSDDYGQSDVTNLNAGEHTFEIRKTGYSDWEETVLIDGVGDNIVA
FT                   TMESIRADVTVVVEDSNHNAISGASVILDGKSIGSTNSQGTITTELLTDSDYTFSVTKD
FT                   GYKDLTQTEDVPLGSTEMTITLTMESSFNTALLGGVVVLIVIVVIVVYALKFVGKRDRR
FT                   GRGRYPGGRDGGSL"
FT   sig_peptide     406139..406213
FT                   /locus_tag="Mpet_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            407713..410781
FT                   /locus_tag="Mpet_0398"
FT   CDS_pept        407713..410781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0398"
FT                   /product="von Willebrand factor type A"
FT                   /note="InterPro IPR002035; KEGG: mem:Memar_0553 von
FT                   Willebrand factor, type A; PFAM: von Willebrand factor type
FT                   A; SMART: von Willebrand factor type A; SPTR: von
FT                   Willebrand factor, type A; PFAM: von Willebrand factor type
FT                   A domain; TIGRFAM: glutamate--cysteine
FT                   ligase/gamma-glutamylcysteine synthetase, Streptococcus
FT                   agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35172"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGG1"
FT                   /protein_id="ADN35172.1"
FT                   /translation="MGFRWGRWLSAVIIILFFFVSTVYALDSDEITIVSDKGWMTAGGD
FT                   PAVIEVSVSNTSVSVQSVEFEAYMVVDEEESGGNISLPSTTVSYPVSVGSLTPSVDTTS
FT                   PWKTEFYCEKSGIADIQVTVNYIADGYADSLTKEFPQKVDHASMYSFASVDYDYEATVN
FT                   SVIPITISALDKYGNRIDSKKEEDTGGTPESFELISSPDTSEFWDGSYFTGNIVDVYVN
FT                   STGYAEALFRISEIAGTNLVNIVPSSGIDSKILTITSLADAEPVDIVVTVSPASGDPPY
FT                   LPADGVSKFYITYQLIDQWGNPSGNRQLYIEPTDPDESGFFRASNSSGKIEISYGPQEI
FT                   KGIYSLIATSVDNSSIFRETDIEFVSTDPTDMLLTANPQVMPSHDVDTAFMSELRAKVI
FT                   DEKGNPVMGETVTFSIIDGEYPDSQLAEPYLESTSALSDQDGLAVVNFVPGTFETDWDA
FT                   TDYSKLANASCQVRAQWNTTVRQIDLEWKNYPYLSVKTNVTPETVAVNDTVTVTIQLIG
FT                   DGWALQPDPIDVMLTADRSGSMLRDYPDRMVSLMDALEDFGIEMKEGWDRLGLASFGTY
FT                   GNADIIDYGNRYWAGYDNSYYDDWEYISEHYAGNDKNYNDYATIDLNLTEDFSDYNTEV
FT                   KALVPDGGTPMRKGLYYSIKHLRDNGRDDAVKAVVVLSDGDYNYYGDPLARGSGGTKWD
FT                   WSDMQEKYYTFSDLNSSEQDMRIFAKDNDIKIFSIAYADGISSEGKAVLQALAEGTGGK
FT                   YYYAPSGEDLEEIYEDIAGELKEAAGVDTAMELMFQDVEINNQTVPNTGSDTILEYVYD
FT                   PEISTLIENRYGNGTYISEVVDQSAWWTENKSLHFDVGTVYLNQTWQATYVLKVEKAGN
FT                   INLFNDSSYITFNNGTDTLKLPDTYFTAVADLNSTGVNFTSMDVSNFEILSSDTDLIYL
FT                   RWILDYTGTYSVSQELSYHRQGDESGWIHFNTMDDVSGPVSSLSQESSFAIRDLPPGNY
FT                   NIRLTASSPDTADDVEELSTIVGSSVDAYIKLE"
FT   sig_peptide     407713..407787
FT                   /locus_tag="Mpet_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            411041..412834
FT                   /locus_tag="Mpet_0399"
FT   CDS_pept        411041..412834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0399"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR001789:IPR013655:IPR003594:IPR000014:IPR
FT                   001610:IPR005467:IPR000700; KEGG: mpl:Mpal_0170
FT                   multi-sensor signal transduction histidine kinase; PFAM:
FT                   PAS fold-3 domain protein; response regulator receiver;
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; PAS domain
FT                   containing protein; PAC repeat-containing protein; SPTR:
FT                   Multi-sensor signal transduction histidine kinase; TIGRFAM:
FT                   PAS sensor protein; PFAM: Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase; Response regulator receiver domain;
FT                   PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35173"
FT                   /db_xref="GOA:E1RGG2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGG2"
FT                   /protein_id="ADN35173.1"
FT                   /translation="MAPLSIIYIDDDPHLLEIGKSFLEQSWEFSVKTFTCASEAAGDML
FT                   SGEHADVIISGSLDGISIFHTLRQHGITTPFILFTGDGRENTTINALTGENVFNVRKVG
FT                   SPEQQFADLCKVILCAVGKGTKDAQEKNVELYRWLSENAPPEILENLNEVFYVLNVDAT
FT                   VIYVSRNIKPISGYSASDVIGRSYVELVHPEDIDGRLSQFLSNLSGSNEATEYRFLKAD
FT                   GSAAWVKTAARPIFIEGRVIGIQGILTDITSLKTMEEALRESEEQYRDLATNAPIGILT
FT                   CDTEGNLTYINQRGLDLIGSPGEEETRTVNLLEYPSLINIGFSEMLQKSIDSGFSIPPF
FT                   EGEYCSRWGKKAYYRVHISPIINQEIVTGARIILDDISEQKLSEIALDKANRKLKLLSE
FT                   ITRHDILNQIMVVQGYTEFAEELSVDTVQTDYLRKVKDAAAAIRRHTDFAREYERLDVE
FT                   KPVWLSLDDIIGKMDDSPIPIIYDCSDISIHADPMVERVFLNLMDNTIRHADGATCVRI
FT                   GCSMAGSGLLILWEDDGYGVPEDLKERIFDRGYGNNTGFGLFLAREILGITGIEITEKG
FT                   VAGEGARFEILVPEGGYRLTG"
FT   gene            complement(412874..412945)
FT                   /locus_tag="Mpet_R0009"
FT   tRNA            complement(412874..412945)
FT                   /locus_tag="Mpet_R0009"
FT                   /product="tRNA-Arg"
FT   gene            complement(412998..413432)
FT                   /locus_tag="Mpet_0400"
FT   CDS_pept        complement(412998..413432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0400"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="COGs: COG4747 ACT domain-containing protein;
FT                   InterPro IPR002912; KEGG: mbn:Mboo_0708 amino acid-binding
FT                   ACT domain-containing protein; PFAM: amino acid-binding ACT
FT                   domain protein; SPTR: Amino acid-binding ACT domain
FT                   protein; PFAM: ACT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35174"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGG3"
FT                   /protein_id="ADN35174.1"
FT                   /translation="MKKNDHIIKQISVFSENKPGRLAAIARALQDEKINIFAFSIAEAK
FT                   GFGVVRLLVDKPEAALKKLAEIGFMVSFTDVIAVRMKDEPGGLFDIARILGESEINIEY
FT                   SYAYSGKEAAVLILRVDRIDEAIEKLIKCGADLLKAEMFR"
FT   gene            complement(413432..414730)
FT                   /locus_tag="Mpet_0401"
FT   CDS_pept        complement(413432..414730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0401"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="COGs: COG1541 Coenzyme F390 synthetase; InterPro
FT                   IPR000873; KEGG: mbn:Mboo_0709 phenylacetate--CoA ligase;
FT                   PFAM: AMP-dependent synthetase and ligase; PRIAM:
FT                   Phenylacetate--CoA ligase; SPTR: Phenylacetate--CoA ligase;
FT                   PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35175"
FT                   /db_xref="GOA:E1RGG4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGG4"
FT                   /protein_id="ADN35175.1"
FT                   /translation="MKWDPRIEEMPVEQLAELQYKRMKTLVYRLYSFSDFYHKRMKEHN
FT                   VHPDDIRSLDDVKKLPFMYKSDLRDNYPDKIFTASQDELVRYHVSSGTTGKPTVVGYTQ
FT                   NDLEIWTTSLARALTGCGIGRGDVMQVSYGYGLFTGGLGLHYGAERVGATVVPTSVGNT
FT                   ERQIELMQDLRVTAIASTPSYLVHIGEVADKMGVSIDKDTDLRTAVLGAEPWSVQMKKY
FT                   IQDKMGITAHNIFGTSEMSGPMFCDCAEQNGIHIWGDIAYTEVIDPETGENLPEGEKGE
FT                   LVMTILQKEALPMIRYRVGDITSMNTEVCACGRTHPRIDRLQGRVDDMLIIRGINVFPS
FT                   QVEHALLGIPEVSGHFMIIVDRKGALDEMLVQVEMNPEAFSDKVEDINEIRRNVSHVLR
FT                   NSLNVSVGVELAAPGSLPRFEGKAKRVIDRRMN"
FT   gene            complement(414727..416019)
FT                   /locus_tag="Mpet_0402"
FT   CDS_pept        complement(414727..416019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0402"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="COGs: COG1541 Coenzyme F390 synthetase; InterPro
FT                   IPR000873; KEGG: mem:Memar_0750 phenylacetate--CoA ligase;
FT                   PFAM: AMP-dependent synthetase and ligase; PRIAM:
FT                   Phenylacetate--CoA ligase; SPTR: Phenylacetate-CoA ligase;
FT                   PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35176"
FT                   /db_xref="GOA:E1RGG5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGG5"
FT                   /protein_id="ADN35176.1"
FT                   /translation="MFWNKEMETLRGKALEDLQVKRLRWTIRQAEKVPFFKTILKEKNV
FT                   SADDINKITDVSKLPFTTKKDLQGGYPFGFMAVPKKEIVRIHTTSGTTGKPTVVGYTRK
FT                   DLDNWSGLIARNMTMVGLTDEDTFQNAVNYGLFTGGLGFHYGAEKIGMTVIPSGTGNTK
FT                   RQIEMIDDFGVTAVHCTPSYAMHLAEVAEAMGNTLETFKTGLFGAEPWSENTRKTLEQK
FT                   LGVTAYDSYGMSEMYGPGAAFECPERNGLHFWHDCYLIEIIDPETEEVLGPGERGELVV
FT                   TPLVKEAMPLLRYRTGDITCILDDECPCGRGARIARLTGRSDDMLVIRGINVFPSQIEH
FT                   VLRSLPEVGDQFMVYVDRINHLDEMTIDVEIKKEYFSGELKDLETIQKKIIHALKETLN
FT                   LRTKVNLVEHDSLPRFEGKAKRVIDRRGDSI"
FT   gene            complement(416529..417197)
FT                   /locus_tag="Mpet_0403"
FT   CDS_pept        complement(416529..417197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0403"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="COGs: COG0765 ABC-type amino acid transport system
FT                   permease component; InterPro IPR000515:IPR010065; KEGG:
FT                   mem:Memar_1364 polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Polar amino acid
FT                   ABC transporter, inner membrane subunit; TIGRFAM: polar
FT                   amino acid ABC transporter, inner membrane subunit; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component; TIGRFAM: amine acid ABC transporter, permease
FT                   protein, 3-TM region, His/Glu/Gln/Arg/opine family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35177"
FT                   /db_xref="GOA:E1RGG6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGG6"
FT                   /protein_id="ADN35177.1"
FT                   /translation="MENLTFITEILLPALLTGLVVTVQLIVVSAPFGLLAGIGVAIGRT
FT                   YGGRCTSFLCKAFAMFVKGCPLLLLLFILYFTLPSIGITFTAFEASVIGFIMCNAAYNS
FT                   EYIRGAIKSVKEGQIIAARSLGMTKYQSIFYIVLPQALRRAIPGLSNEFIYLIKYSSLA
FT                   FMLTLVELTGAGKLIATKYFTYTETFIFVGAIYLILVTITTVGAGMLEKKFAVPGTQGH
FT                   "
FT   gene            complement(417205..417954)
FT                   /locus_tag="Mpet_0404"
FT   CDS_pept        complement(417205..417954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0404"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1126 ABC-type polar amino acid transport
FT                   system ATPase component; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: mhu:Mhun_0029 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35178"
FT                   /db_xref="GOA:E1RGG7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGG7"
FT                   /protein_id="ADN35178.1"
FT                   /translation="MSEEYILRVEDIHKKYGNSEVLKGVSFNVKKGETLVFIGPSGTGK
FT                   STLLRCINQLTVPEKGQVFLRDEEVTNSGSKINYFRQKIGMVFQNFCLFDHLTAVRNVE
FT                   IALIKVKGMKPEVAREKALYELRQVGMEDWADHYPAELSGGQAQRVSIARALAMDPDVI
FT                   LFDEPTSALDPELTREVLEVMKKLAQEGMTMLVVTHEMGFACNVANRIIFMENGNIVEE
FT                   GSPGELLEGEDTSRTKQFIGGLGMKAD"
FT   gene            complement(417951..418661)
FT                   /locus_tag="Mpet_0405"
FT   CDS_pept        complement(417951..418661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0405"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="COGs: COG0765 ABC-type amino acid transport system
FT                   permease component; InterPro IPR000515:IPR010065; KEGG:
FT                   mhu:Mhun_0030 amino acid ABC transporter permease; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Amino acid ABC transporter, permease
FT                   protein, 3-TM region, His/Glu/Gln/Arg/opine; TIGRFAM: polar
FT                   amino acid ABC transporter, inner membrane subunit; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component; TIGRFAM: amine acid ABC transporter, permease
FT                   protein, 3-TM region, His/Glu/Gln/Arg/opine family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35179"
FT                   /db_xref="GOA:E1RGG8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGG8"
FT                   /protein_id="ADN35179.1"
FT                   /translation="MDLISILIDWAPYLLTGIFVTLGLTAAGLGLGVIIGLPMAIGQVY
FT                   STGIRWVDKIMKAFIAVFVWFFRGLPILVLLFLFYFGIFPLMGMGDLAPFFVGAIVLGL
FT                   RGAAYQSQIFRGAIQSISEGQMTAARSLGMTKLSAIKNVILPQSFRIALPGWSNEYPNI
FT                   LTDSAVCYAIGVAELLTRSSQIASQTYEYTIYLVCAVLFIILNYAGTKGLLILENRIAI
FT                   PGFSGSGDEKQVFL"
FT   gene            complement(418811..419620)
FT                   /locus_tag="Mpet_0406"
FT   CDS_pept        complement(418811..419620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0406"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="COGs: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain; InterPro
FT                   IPR001638; KEGG: mhu:Mhun_0031 extracellular solute-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   3; SMART: extracellular solute-binding protein family 3;
FT                   SPTR: Extracellular solute-binding protein, family 3; PFAM:
FT                   Bacterial extracellular solute-binding proteins, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35180"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGG9"
FT                   /protein_id="ADN35180.1"
FT                   /translation="MTVKVYGAILVLILALAMVFSGCTDTSGENQTSTDGVNVEETTTY
FT                   IVGIDGEYKPYSYVDTDGNPVGFDVDSIKWIAEKEGFEVEIIPVAWDGIIPALMAGKID
FT                   MVYSGMTITDKRLEQVNFSIPYWKVNQSVAINDVNNYTMDDFMSGKYIIGAQSGTSGAQ
FT                   WVEENLIDTGIMPAENFKNTYSTFPLVSEDLKNQRIDFAIYDKPPMLEAIEGKPLSIIG
FT                   EIDTNEEYGVAIRKSDVELLETINDGLTQLMADPYWEELKTEYGMVE"
FT   sig_peptide     complement(419537..419620)
FT                   /locus_tag="Mpet_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            419863..420798
FT                   /locus_tag="Mpet_0407"
FT   CDS_pept        419863..420798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0407"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="COGs: COG1518 Uncharacterized protein predicted to
FT                   be involved in DNA repair; InterPro IPR002729; KEGG:
FT                   mem:Memar_0751 CRISPR-associated Cas1 family protein; PFAM:
FT                   protein of unknown function DUF48; SPTR: CRISPR-associated
FT                   protein Cas1; TIGRFAM: CRISPR-associated protein Cas1;
FT                   PFAM: CRISPR associated protein Cas1; TIGRFAM:
FT                   CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35181"
FT                   /db_xref="GOA:E1RGH0"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGH0"
FT                   /protein_id="ADN35181.1"
FT                   /translation="MFSPDIPWHVVWGFGGHIKSTATTLIILNKSDVEEIPIKSVDHLL
FT                   VVGGHNIHTSAIIHLLRQNSSVSFFDADGTPVGVLRPFGRKPDEEMAELQSEVSSYNSA
FT                   AEIVRSSIKARIMMIEKAGGEIDRELYYKGEDEILFTSLEEIDYLIKMEELRRIQKFTS
FT                   DMYYEIMGRCLTPSHGFKRRTSRPHVDPVNSLLSLGYSILFGNCCVPLVGAYLDVDKGI
FT                   LREGTNSLILDLIDPLKPFMVDSVVFSIAREYLTDDMYETNTKRCHLDQGTLRLLSNAL
FT                   KSSIDQRKIEENVMSYRDSLINRRPLRFSY"
FT   gene            complement(420998..421327)
FT                   /locus_tag="Mpet_0408"
FT   CDS_pept        complement(420998..421327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0408"
FT                   /product="acylphosphatase"
FT                   /note="COGs: COG1254 Acylphosphatase; InterPro
FT                   IPR001792:IPR017968; KEGG: mpl:Mpal_2166 acylphosphatase;
FT                   PFAM: acylphosphatase; SPTR: Acylphosphatase; PFAM:
FT                   Acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35182"
FT                   /db_xref="GOA:E1RGH1"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGH1"
FT                   /protein_id="ADN35182.1"
FT                   /translation="MAMAQDTDASGITEEQTPRLKTIEAYVTGKVQGVGFRACVRRIAS
FT                   QLSITGEVMNLEDGRVCIRASGDDIIIDKFLSSLQECPRAHIRDIDIYEKEPMDYEDFE
FT                   IVRVY"
FT   gene            complement(421423..421617)
FT                   /locus_tag="Mpet_0409"
FT   CDS_pept        complement(421423..421617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0409"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dev:DhcVS_71 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35183"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGH2"
FT                   /protein_id="ADN35183.1"
FT                   /translation="MNRYATLSKEQMRDLRQCEEYLGLILVAYSEFESSGRYSSLSKCE
FT                   LEKIHKLETEFCATLVAFE"
FT   gene            complement(421686..422675)
FT                   /locus_tag="Mpet_0410"
FT   CDS_pept        complement(421686..422675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0410"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="COGs: COG0059 Ketol-acid reductoisomerase; InterPro
FT                   IPR013116:IPR000506:IPR013023; KEGG: mla:Mlab_0602
FT                   ketol-acid reductoisomerase; PFAM: Acetohydroxy acid
FT                   isomeroreductase catalytic domain protein; acetohydroxy
FT                   acid isomeroreductase; PRIAM: Ketol-acid reductoisomerase;
FT                   SPTR: Ketol-acid reductoisomerase; TIGRFAM: ketol-acid
FT                   reductoisomerase; PFAM: Acetohydroxy acid isomeroreductase,
FT                   catalytic domain; TIGRFAM: ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35184"
FT                   /db_xref="GOA:E1RGH3"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGH3"
FT                   /protein_id="ADN35184.1"
FT                   /translation="MINKYYESDADLGNLSGKTIAVMGYGSQGRGQALNLRDSGLDVII
FT                   GIRPGKSRDQAVADGLEALDVSKAAERADIIMILLPDEIQGIVYKNEIAPYLTENKCLM
FT                   FSHGFNIHFGQIVPPANVDVIMVAPKGPGHMVRRTYEEGKGVPALIAIHQEYTGKAKEI
FT                   ALAYAKGIGATRAVVLETSFREETETDLFGEQAVLCGGTTSLIKAGFETLVKAGYAPEM
FT                   AYLEVLHEMKLIVDLIYEGGFTKMRDSISNTAQYGDITRGPRVIGAESKAAMEQILKEI
FT                   QSGAFTKEWMLENAVNRPMFNALTRADEEHLIEKVGAEIRGMMPQFRK"
FT   gene            423013..424503
FT                   /locus_tag="Mpet_0411"
FT   CDS_pept        423013..424503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0411"
FT                   /product="isopropylmalate/citramalate/homocitratesynthase"
FT                   /EC_number="2.3.1.182"
FT                   /note="COGs: COG0119
FT                   Isopropylmalate/homocitrate/citramalate synthase; InterPro
FT                   IPR000891:IPR013709:IPR002034:IPR011830; KEGG:
FT                   mhu:Mhun_1243 isopropylmalate/citramalate/homocitrate
FT                   synthase; PFAM: pyruvate carboxyltransferase; LeuA
FT                   allosteric (dimerisation) domain; PRIAM: (R)-citramalate
FT                   synthase; SPTR: (R)-citramalate synthase; TIGRFAM:
FT                   isopropylmalate/citramalate/homocitrate synthase; PFAM:
FT                   LeuA allosteric (dimerisation) domain; HMGL-like; TIGRFAM:
FT                   homocitrate synthase NifV;
FT                   isopropylmalate/citramalate/homocitrate synthases"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35185"
FT                   /db_xref="GOA:E1RGH4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011830"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024890"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGH4"
FT                   /protein_id="ADN35185.1"
FT                   /translation="MFRFLDTTLRDGEQTPGVSLTPEQKLEIATALSDIGIDVIEAGTA
FT                   VASEGEKEAIRLISDAGLAAECCTYVRARRDDIDSAADCGVDSVHLVVPVSDLHITKKL
FT                   GKDREAVYDMAMDAVSYAKERGLIVELSGEDASRADIDYLSNLFRDGVSAGADRLCFCD
FT                   TVGLLTPERTAEIIPRVCHAPLSIHCHNDLGLALANTLTALNSGATCAHVTVNGLGERA
FT                   GNTPFEEVVMALERLYNYDTGIKKEKIYPLSTLVSRYTRVPLATNKPIVGAMAFTHESG
FT                   IHAHGLMKDSSTYEPLSPELVGRKRRIVLGKHSGSASVKSALNELGYKPNDKQLNEIVR
FT                   RIKEIGDRGVRVTDADVMAVADAVMLLECRPVIEMKQFTIVSGNKIIPTASVTMKVNGQ
FT                   EITGAATGAGPVDAALRILQESVSVVGDIRLEEYHVDAITGGTDAVVDVTVKLNRDGRV
FT                   ITSRGARSDIIEASVEAVVSGMNRLLRSENENRSTDSD"
FT   gene            424475..426169
FT                   /locus_tag="Mpet_0412"
FT   CDS_pept        424475..426169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0412"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /note="COGs: COG0028 Thiamine pyrophosphate-requiring
FT                   protein;
FT                   InterProIPR012001:IPR012000:IPR011766:IPR000399:IPR 012846;
FT                   KEGG: mla:Mlab_0605 acetolactate synthase, large subunit;
FT                   PFAM: thiamine pyrophosphate protein TPP binding domain
FT                   protein; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein domain protein TPP-binding;
FT                   SPTR: Acetolactate synthase; TIGRFAM: acetolactate
FT                   synthase, large subunit, biosynthetic type; PFAM: Thiamine
FT                   pyrophosphate enzyme, central domain; Thiamine
FT                   pyrophosphate enzyme, N-terminal TPP binding domain;
FT                   Thiamine pyrophosphate enzyme, C-terminal TPP binding
FT                   domain; TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35186"
FT                   /db_xref="GOA:E1RGH5"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGH5"
FT                   /protein_id="ADN35186.1"
FT                   /translation="MKTGARILIDSLKEQGVDIIFGYPGGSVLPIYDELYDADIRHILV
FT                   RHEQAAVHAADGYARASGRVGVCLSTSGPGACNLVSGIATANMDSVPIVALTGQVPTAM
FT                   LGNDAFQESDITGITMPVTKHNFLVNDTVRIPQVIAEAFYIAGTGRQGPVLVDLPKDVL
FT                   MKSVSPEEILPGIPDLKGYKPTYHGHPRQIKKALDLLRESKKPVIYAGGGIVASGASEA
FT                   LCRFAEEMEIPVTTTMMGLGAIPSDHPLNLGMLGMHGTKYANYAVTGCDLLFTIGARFD
FT                   DRVTGKIDEFAPGAKIIHIDIDPAEIGKNKAVDVPIVGDAKVVLDDIIERLTPEDRVIR
FT                   TAWLEETGKWKKDHPLTCGNGGGLHPQQIIREISTLLDGGGIIVSEVGQNQMWAAQHYG
FT                   FKKPRHWISSGGLGTMGYGFPAAIGAWFARPEEKIVLIAGDGSFQMNIQELGTVAQYKV
FT                   PVKMMILNNMYLGMVRQWQELFYDKRYSYTELPSVDFVGIAKAYGVPGRIVESETDIVP
FT                   ALKESFESDGPFLIDFRIEREENVFPMVPAGAAIKDMIGEHVEQEDD"
FT   gene            426170..426673
FT                   /locus_tag="Mpet_0413"
FT   CDS_pept        426170..426673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0413"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="COGs: COG0440 Acetolactate synthase small
FT                   (regulatory) subunit; InterPro
FT                   IPR002912:IPR019455:IPR004789; KEGG: mla:Mlab_0606
FT                   acetolactate synthase 3 regulatory subunit; PFAM:
FT                   Acetolactate synthase, small subunit-like; amino
FT                   acid-binding ACT domain protein; SPTR: Acetolactate
FT                   synthase, small subunit; TIGRFAM: acetolactate synthase,
FT                   small subunit; PFAM: Small subunit of acetolactate
FT                   synthase; ACT domain; TIGRFAM: acetolactate synthase, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35187"
FT                   /db_xref="GOA:E1RGH6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGH6"
FT                   /protein_id="ADN35187.1"
FT                   /translation="MKQHIISVLVEDRSGVLTRVSGLFSRRGFNIESLAVGTCEAPGMS
FT                   RITIVACGDDAHIEQVKKQLNKLIEVIKVIDITERSHVERELVLIKVNAEPGKTRSEVM
FT                   QIADIFRAKIIDVGQETVVLEITGDSEKIRALEELLVPYGILELVRTGKVALQRGAATI
FT                   SPGK"
FT   gene            426813..427484
FT                   /locus_tag="Mpet_0414"
FT   CDS_pept        426813..427484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0414"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nml:Namu_4912 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35188"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGH7"
FT                   /protein_id="ADN35188.1"
FT                   /translation="MKETLNRKYLLVVVIVVSLIIVAAAVSVSIEEQQSPADSGSVLHA
FT                   VDVLPESGDFGEGVELSYGHIEDWESVINSMNSPLLQGTMIGYNPEDRQMIEESNRKWI
FT                   SDTSELLDHGVIDLAKVSYVLYDNSGEVSDLTSADIYAFNETEGAEWYLDKIVSGKSEE
FT                   GSYMESVEGPWAEAFSPNSPWGGSDIYYVRCSNIVFSTFSTDGDLSRDMAEKIAGRVAL
FT                   A"
FT   sig_peptide     426813..426887
FT                   /locus_tag="Mpet_0414"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            427736..428818
FT                   /locus_tag="Mpet_0415"
FT   CDS_pept        427736..428818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG5643 Protein containing a metal-binding
FT                   domain shared with formylmethanofuran dehydrogenase subunit
FT                   E; KEGG: mem:Memar_0775 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: FmdE, Molybdenum
FT                   formylmethanofuran dehydrogenase operon"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35189"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGH8"
FT                   /protein_id="ADN35189.1"
FT                   /translation="MNYNRLRWLFCICLALVLCAPAVSASTNAYHMEALGEFAATIAMD
FT                   EIDFDYGDSDVVVLTDAGRVVVDGQTTEKVISGITKVSGLQNGDSTLFQINRADWKDLW
FT                   FYFYNRDTGKGLYLVPKEGYFRLTDAAVESLPPENAFSTIEVVSGDIYQMLEDTNAGNK
FT                   TQEVLGADAFSLLSLANAWAYGAPYDLMNAASLHNHFCPGVSSGYILAKYVEENMPLTD
FT                   ETSYVVVSCPTWCKEDIYNVLWDMTPGKGGVDTSAVFTNEDQTYLTEKYGIRPAGIFVL
FT                   WNSQENSGKGIALGFRFDDSEWTGPSWGSKIYQTVDMVQNLNNPGDYVEVMEEFTVDAD
FT                   LLAELENPLNNPYEVVGMMD"
FT   sig_peptide     427736..427810
FT                   /locus_tag="Mpet_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(428918..430417)
FT                   /locus_tag="Mpet_0416"
FT   CDS_pept        complement(428918..430417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0416"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR011701:IPR001411:IPR004638; KEGG: mpl:Mpal_1052 drug
FT                   resistance transporter, EmrB/QacA subfamily; PFAM: major
FT                   facilitator superfamily MFS_1; SPTR: Drug resistance
FT                   transporter, EmrB/QacA subfamily; TIGRFAM: drug resistance
FT                   transporter, EmrB/QacA subfamily; PFAM: Major Facilitator
FT                   Superfamily; TIGRFAM: drug resistance transporter,
FT                   EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35190"
FT                   /db_xref="GOA:E1RGH9"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGH9"
FT                   /protein_id="ADN35190.1"
FT                   /translation="MKDSPERSSGKSYSLLIIAISLAIFMSSIDGTIVNIALPTISESF
FT                   DISSSTVSWVATAYLLVMAGCVLIFGKISDIIGFKKIFLTGFIVFTVGSFACGFLPDLL
FT                   DSFGSLVGSRIFQAVGGAMITAIAPAMVTAFIPMSMKGKAMGIIMTVAALGMAIGPTVG
FT                   GILTQYLSWHWIFFINVPIGIIAVLLGAKVIPSTVTGKDRDLSGFDKKGGLLIFFGLAS
FT                   LLFAISEGQELGWTSPAIIATMIIAVVSLAGFVWNELKVTEPLLELRLFRKKNFFLSNL
FT                   LFVLLFLSFSGINYLLPFYLEYVQGFDSSTAGLILTSLSFAMMISGLLAGALFNRTGGR
FT                   PLCIAAGFVILLGYYFITHLHADTTTAFVVGCLMLIGFGLGLMVTPISNMIMNSVGKQY
FT                   QGMVSSLTSLERFAPLTIGIAIFNLIFLQGVSLIAEHRGVTTEAPVNMKLEVLSSGFDL
FT                   AFLGAFILSIAVLILSLIVKQEIHPDYLEEGPETEIIGGMI"
FT   gene            complement(430649..430816)
FT                   /locus_tag="Mpet_0417"
FT   CDS_pept        complement(430649..430816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0417"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_3993 tetratricopeptide domain
FT                   protein; SPTR: Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35191"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGI0"
FT                   /protein_id="ADN35191.1"
FT                   /translation="MEKKINACPLTAIDGENFLWLWIENYLSLLRYWNIWDILLYSSSE
FT                   SFSAFIPEIT"
FT   gene            430904..431425
FT                   /locus_tag="Mpet_0418"
FT   CDS_pept        430904..431425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_1222 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35192"
FT                   /db_xref="InterPro:IPR025868"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGI1"
FT                   /protein_id="ADN35192.1"
FT                   /translation="MKNNAKTCQSCGMPMTKPEDFGTEADGSPSVEYCMYCYQNGSFTE
FT                   PDITMEEMAEKGGAIMSQMFEIPAEKAVGFAKEQLSCLKRWAGREIKTCESCGMPLARD
FT                   EDYGTEENGSKSSKYCIYCYKDGKFIEPDLTKEEAVEKYAPMMAEHLGMPLEKAKMMVN
FT                   SYLSSLPRWQ"
FT   gene            431475..431798
FT                   /locus_tag="Mpet_0419"
FT   CDS_pept        431475..431798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0419"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ele:Elen_1445 transcriptional regulator, XRE
FT                   family; SPTR: Transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35193"
FT                   /db_xref="InterPro:IPR025868"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGI2"
FT                   /protein_id="ADN35193.1"
FT                   /translation="MEIPEDYIGYTCSVIKKHFEGPFCQSCGLPMKCEGDFGTEEDGSP
FT                   SADYCRSCYWKGEFVMPTLTFEEMKVRCAERMAESGFVTYEDALDMMSRLLPTLKRWRV
FT                   NEI"
FT   gene            complement(431801..432070)
FT                   /locus_tag="Mpet_0420"
FT   CDS_pept        complement(431801..432070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0420"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcu:pc1944 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35194"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGI3"
FT                   /protein_id="ADN35194.1"
FT                   /translation="MKEYLGRDTVRKKTENLFEKCSTEDFQELQKRLINLGYVQRGSDP
FT                   VSAEFHHTGAGLLLDVEFDKDNGIHSYELLTTEEMEEKHRKFRW"
FT   gene            432167..432598
FT                   /locus_tag="Mpet_0421"
FT   CDS_pept        432167..432598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0421"
FT                   /product="C_GCAxxG_C_C family protein"
FT                   /note="InterPro IPR010181; KEGG: dth:DICTH_1787 redox
FT                   family protein; PFAM: C_GCAxxG_C_C family protein; SPTR:
FT                   C_GCAxxG_C_C family protein; TIGRFAM: C_GCAxxG_C_C family
FT                   protein; PFAM: Putative redox-active protein
FT                   (C_GCAxxG_C_C); TIGRFAM: C_GCAxxG_C_C family probable redox
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35195"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGI4"
FT                   /protein_id="ADN35195.1"
FT                   /translation="MNRADIAEENFKSGLNCAQSVLMAFAGDFGAEPGTARRIARGFGS
FT                   GMGTGDTCGAVSGGVMAISLSVSDEGDAALAKKRTYELVREFKKRFSKETGSLMCRNLL
FT                   GYDINNHEIMKSIPAEKLPKSVCIEYVRLAAGILDDMLK"
FT   sig_peptide     432167..432244
FT                   /locus_tag="Mpet_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(432933..434576)
FT                   /locus_tag="Mpet_0422"
FT   CDS_pept        complement(432933..434576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0422"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="COGs: COG0129 Dihydroxyacid
FT                   dehydratase/phosphogluconate dehydratase; InterPro
FT                   IPR000581:IPR004404:IPR020558; KEGG: mla:Mlab_0613
FT                   dihydroxy-acid dehydratase; PFAM: dihydroxy-acid and
FT                   6-phosphogluconate dehydratase; PRIAM: Dihydroxy-acid
FT                   dehydratase; SPTR: Dihydroxyacid dehydratase; TIGRFAM:
FT                   dihydroxy-acid dehydratase; PFAM: Dehydratase family;
FT                   TIGRFAM: dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35196"
FT                   /db_xref="GOA:E1RGI5"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGI5"
FT                   /protein_id="ADN35196.1"
FT                   /translation="MRSDEAKSGYERAANRSLIRALGISDREMEKPFIGIANSWNSIVP
FT                   GHTHLRMIGERVREGVAAGGGTPFEFNTIGICDGIAMGHEGMTYSLPSRENVADAVELM
FT                   IQAHRFDGLVCICTCDKIVPGMLMAAVRCNIPAIVITGGNMLPGYHHGCELSLTDIFEG
FT                   VGKVAAGKMSDEELTELEKAAMPGCGSCQGLYTANTMACMTEAMGMSLPGCAAVPAVDA
FT                   EKMRLAYETGERVVDLVRENILPRNIVTAESMRNAIRVDMALGGSTNTVLHLMAVAEEA
FT                   DIPFGLDEFTAIGEQVPHICSMQPGGPHSMQTLHRAGGIPAVFNRLLPLLSNVRTVSGK
FT                   TVGEIAGSVRYIDENVIKTIETPVHEAGGLRILKGTLAPDGAVIKCSAVNDDMWVHSGP
FT                   ARVFGNEKESMDAILGRKINEGDVLVIRNEGPIGGPGMPEMLSPTSALMGMGYTKVALV
FT                   TDGRFSGGTRGPCIGHVAPEAMAGGPIGLVKEGDIIEINLHERRLDLAVSPEEIEKRRQ
FT                   AYVPPKRELRGVLERYAKMVGQANRGAVLK"
FT   gene            434712..435224
FT                   /locus_tag="Mpet_0423"
FT   CDS_pept        434712..435224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0423"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="InterPro IPR004155; KEGG: mbn:Mboo_0125 heat
FT                   repeat-containing PBS lyase; PFAM: PBS lyase HEAT domain
FT                   protein repeat-containing protein; SPTR: PBS lyase HEAT
FT                   domain protein repeat-containing protein; PFAM: PBS lyase
FT                   HEAT-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35197"
FT                   /db_xref="GOA:E1RGI6"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGI6"
FT                   /protein_id="ADN35197.1"
FT                   /translation="MCGEEEIRGYIDQIKNGNLQEKRGAVDSLAGCGEPAAVLLCEFIE
FT                   ESGDNDSMWYAASALAKIGVAAIGPLSDLLKRTPSRDAKKYAAAALGAIGEPSIDILLE
FT                   MLSGDDKVVRGYASQALIRVGEPAVQPLKDLIDNSDGVVERCAVLTLHRMGTVEPEAVE
FT                   NVLRKDF"
FT   gene            complement(435268..435990)
FT                   /locus_tag="Mpet_0424"
FT   CDS_pept        complement(435268..435990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0424"
FT                   /product="thymidylate synthase, methanogen type"
FT                   /note="COGs: COG0207 Thymidylate synthase; InterPro
FT                   IPR000398:IPR014620; KEGG: mbn:Mboo_0521 thymidylate
FT                   synthase; PFAM: thymidylate synthase; SPTR: Thymidylate
FT                   synthase; TIGRFAM: thymidylate synthase, methanogen type;
FT                   PFAM: Thymidylate synthase; TIGRFAM: thymidylate synthase,
FT                   methanogen type"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35198"
FT                   /db_xref="GOA:E1RGI7"
FT                   /db_xref="InterPro:IPR014620"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGI7"
FT                   /protein_id="ADN35198.1"
FT                   /translation="MFNVRAFSLGKAHEEVIKTILKHGKYLVTEDGEKTIELPEPLNIH
FT                   VKNPFEDYMISPFNMFGEGAMRQYVNDLLNGTENEFVYTYHDRLFDYPVGDSEFRGDGD
FT                   GKGIDQVEYLIEKLKAEPNSRRAEAITWFPPKDDQSDNPPCLQRIQCFVRDGRLNMHVD
FT                   FRSNDMLSALGANMYALVHLQKMIADRLKADVGWYSHTSVSAHMYHERDHDELMKYVKG
FT                   LGLEADLKHYESSKLIKD"
FT   gene            complement(436031..436753)
FT                   /locus_tag="Mpet_0425"
FT   CDS_pept        complement(436031..436753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0425"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="KEGG: ppd:Ppro_1930 SAM-dependent
FT                   methyltransferases; SPTR: SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35199"
FT                   /db_xref="GOA:E1RGI8"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGI8"
FT                   /protein_id="ADN35199.1"
FT                   /translation="MTDEKTGCLICGGELVYSDTEKEMECSFCGKKFRTNVACENGHFI
FT                   CDECHGREAEAMITAFCLNTDLKDPIKIAITLMRHPSMHMHGPEHHYLVPAVLITAYYN
FT                   EINEQEKKEKALKKALSRSEHIKGGFCGTHGTCGAAIGTGIFISVITGSTPLSGESWSL
FT                   SNRMTATALMAIANAGGPRCCKRDTYLAIIGAVKFLEENFKVALPVTEEFCCEFSGLNR
FT                   ECRKKECPFWCGQSDNLK"
FT   gene            436849..440724
FT                   /locus_tag="Mpet_0426"
FT   CDS_pept        436849..440724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0426"
FT                   /product="DNA polymerase II, large subunit DP2"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG1933 DNA polymerase II large subunit;
FT                   InterPro IPR016033:IPR004475:IPR003587:IPR006141; KEGG:
FT                   mem:Memar_2124 DNA polymerase II large subunit; PFAM: DNA
FT                   polymerase II large subunit DP2-like; PRIAM: DNA-directed
FT                   DNA polymerase; SMART: Hedgehog/intein hint domain protein;
FT                   SPTR: DNA polymerase II large subunit; TIGRFAM: DNA
FT                   polymerase II, large subunit DP2; PFAM: DNA polymerase II
FT                   large subunit DP2; TIGRFAM: intein N-terminal splicing
FT                   region; intein C-terminal splicing region; DNA polymerase,
FT                   archaeal type II, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35200"
FT                   /db_xref="GOA:E1RGI9"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004475"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR016033"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGI9"
FT                   /protein_id="ADN35200.1"
FT                   /translation="MQTSPEMNAYFKSLQTGLETAIKVAKQARLKGIDPRTSVEIPIAN
FT                   DLADRVEALLDIKGVAARLRELGETMSREEVALKIGDDFIAKKFGEQTREDILDHAIRT
FT                   SMALLTEGVVAAPTEGIGKIGVGRNDDGTEYLKIYYAGPIRSAGGTAQALSVLVGDYVR
FT                   KGLGMSAFIPRDEEVERYVEEIKKYNNIMSLQYLPPDDDLRYIVRNCPVCVDGEPTEKV
FT                   EVSGFRNLERIETNVVRGGMALVVAEGMGLKAPKIQKVVRKVRMEGWEWLDKLVSGGTS
FT                   SAGKEGAKEEKDEGFHLKPKDKYIKDLIGGRPVFSYPMKAGGFRLRYGRSRNTGFAAAG
FT                   FNPSTLHILGDFLAVGTQMKVERPGKAAGVVPVDTVEGPTVRLTNGDVMRIDTIEDALK
FT                   YGPQVERIIDVGEMLVSYGEFLENNHNLVPSAYCHEWWMLEGGERRPENMMEAVEMAVS
FT                   GAYLHPDYTYIWDDISVEDVIALADAVSAEGEIKEGVLYLPGDFSLKSTLEILLLPHKV
FT                   REGKIVIESPIVFLACLGLTMNLEKRETREHLPECKNGLEAASCLSGFKMRSKAGTRIG
FT                   GRMGRPGKSKPRKMNPPPNGLFPVGDEGGSRRSFQEASKSKENRQGGLITAEMGLRRCP
FT                   SCKKITYKNICECGTHTEPEYVCPKCGRNVVGGKCPVCGMEGVCSQQVQIDVKAEYDSA
FT                   LKNVGMIRDMEPKLVKGVKGMMSKERCAEPLEKAVLRAANELYVFKDGTLRYDMIDLPL
FT                   THFKPKEIGTSVERLIELGYPKDVYGKPLESEDQVLELKCQDILVSEDCGEWLLKVAMF
FT                   IDEMLGKLYDLPPYYNAEKKEDIVGRLLMGLAPHTSAGVLVRLLGFSKAFVGYGHPYFH
FT                   AAKRRNCFQGETEITVYDNEKWQTLPIRKFVLENFDISKTNFDLVGTYYSDPSKTFWVH
FT                   SLDISGAVRMRRVTSVSVHRSPKTLIRFETSRGRSVTVTPEHTMLVCDLAYQRRVKALE
FT                   LKEGDFVPIFEGTCMINDRIVGRDILESAEDYVFCMTVDQDHNLPANGIFTGQCDGDED
FT                   CVMLLLDGLINFSKCFLPETRGGSMDAPLVLTSRIDPSEVDGECHNVDACPSYPLELYL
FT                   EALKYTHPKDLEKKIDHVALRLGTPGQYEGIMFTHDTTDISAGPLISSYNTLKTMTDKL
FT                   EAELELGKIIRAVDADDVAERVLNTHFIRDIMGNLNSFSKQSMRCTKCNAKYRRMPLSG
FT                   KCRCGNKVIPTVHEGSVKKYLEMSQKMCDEYNVSEYTRQRVEVLSMAVLSTFGEPPEKQ
FT                   MGLADFM"
FT   gene            440994..441638
FT                   /locus_tag="Mpet_0427"
FT   CDS_pept        440994..441638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0427"
FT                   /product="Methyltransferase type 12"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013217;
FT                   KEGG: mmz:MmarC7_1197 methyltransferase type 12; PFAM:
FT                   Methyltransferase type 12; SPTR: Methyltransferase type 12;
FT                   manually curated; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35201"
FT                   /db_xref="GOA:E1RGJ0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGJ0"
FT                   /protein_id="ADN35201.1"
FT                   /translation="MFMAGAKDYDEIALKCVPYHDAFFGTVLDFIFPEDKKILELACGT
FT                   GILTEMIAGKCPGADISCVDSDGSMIEKAGEKPALSGVRFIEGDMRDCSGSGYDAVVIT
FT                   QAIFFIDDSDRKILVAKIRDMLKEGGRFISGDMFVPGTEFEKELYKKNWIDLMLSNGLS
FT                   LSEAENMIAPLDDFCGKNTIESFSSELKKAGFSRVIVPYRSGYYGVVVGYK"
FT   gene            441730..443025
FT                   /locus_tag="Mpet_0428"
FT   CDS_pept        441730..443025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0428"
FT                   /product="aminoglycoside phosphotransferase-like protein"
FT                   /note="COGs: COG0348 Polyferredoxin; InterPro
FT                   IPR017896:IPR017900; KEGG: mla:Mlab_0601 aminoglycoside
FT                   phosphotransferase-like protein; SPTR: 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35202"
FT                   /db_xref="GOA:E1RGJ1"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGJ1"
FT                   /protein_id="ADN35202.1"
FT                   /translation="MAGKRIRRIIPAAAGAAGLAVPACAAVCPKGIGDCPYPGRCFLYV
FT                   DSNGDSICDYTPGDTSQVATDADPVTVTNSSATDSGNRHRGGSAADTVQSTVSPSGGPE
FT                   SSPESGLNPLLLTAAGLFVAGVLILSAYFILRYLKRENPLLYSRLFLYAGMVPLLLAIL
FT                   IVLNDPESFGISGTFADMAERYSGIVYMFGGALVMAGLWLKNGVSREMTISVLILTIAA
FT                   GFLLVLPIAPDGFYSVVSGLTTLQFAGIGFVGLVLLVCISLIFGRVFCAHMCPAGAVQE
FT                   LLSRLPLPKLEIRDRRIPNAVRLIVFIVLIAGALFSINTFEYIGVSHFFAMIFSAAAVV
FT                   FAVILVLSLFVYRPFCTFLCPYGLVFSMASRFGRFGLKRTEDCIDCGKCERVCPTVEAG
FT                   RDGRKAECYLCGRCIEVCPKDSAIVFGKRSEP"
FT   sig_peptide     441730..441804
FT                   /locus_tag="Mpet_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            443062..443143
FT                   /locus_tag="Mpet_R0010"
FT   tRNA            443062..443143
FT                   /locus_tag="Mpet_R0010"
FT                   /product="tRNA-Leu"
FT   gene            complement(443204..443617)
FT                   /locus_tag="Mpet_0429"
FT   CDS_pept        complement(443204..443617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0429"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="COGs: COG1733 transcriptional regulator protein;
FT                   InterPro IPR002577; KEGG: mba:Mbar_A1884 hypothetical
FT                   protein; PFAM: helix-turn-helix HxlR type; SPTR: Putative
FT                   uncharacterized protein; PFAM: HxlR-like helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35203"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGJ2"
FT                   /protein_id="ADN35203.1"
FT                   /translation="MHHDSNRICLCPLEGIITTISKKWAILLITILGHHEKLRFNDLMN
FT                   ILDGISPKTLTDLLKELQRTGLVERESFPEIPPRVEYSLTDDGKELCEVIIPLVKWAEK
FT                   RDNLHEKKCTLKCRSSCCPSRHSSGEGEKSGNE"
FT   gene            443705..443908
FT                   /locus_tag="Mpet_0430"
FT   CDS_pept        443705..443908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ptm:GSPATT00014848001 hypothetical protein;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35204"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGJ3"
FT                   /protein_id="ADN35204.1"
FT                   /translation="MCMPIQNSQCHGHGHCMGPDRGHGHRSCDCMQMLSVEDEIKSLEN
FT                   AKQRTQARLDMIEKKIGELRKI"
FT   gene            444045..444974
FT                   /locus_tag="Mpet_0431"
FT   CDS_pept        444045..444974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0431"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro
FT                   IPR003439:IPR003593:IPR017871:IPR005894; KEGG:
FT                   mem:Memar_0021 daunorubicin resistance ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: Daunorubicin resistance ABC transporter
FT                   ATPase subunit; TIGRFAM: daunorubicin resistance ABC
FT                   transporter ATPase subunit; PFAM: ABC transporter; TIGRFAM:
FT                   daunorubicin resistance ABC transporter ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35205"
FT                   /db_xref="GOA:E1RGJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGJ4"
FT                   /protein_id="ADN35205.1"
FT                   /translation="MSGVIEVRDLTKTFGSTVAVDHISFSVKEGEILGFLGPNGAGKTT
FT                   TTRMLTGVIPPVSGTVTILGHDIWREPVLAKQGFGVVPEISNAYTDLTAWRNLQLMGDL
FT                   YGLSRDLADRRATELLGTLGLLDRKDQKVQAYSKGMKQRLVLAMALPHEPRLLFLDEPT
FT                   SGLDVQSTRLILTLLRKLNRDGTTIFLTTHNMEEANLLCDRIAIIRAGKLVAVDAPEKL
FT                   KTEIDRVHRVEVSFDREVPDDEICGLLGVTGAERTGDKWQIVTENPDAAIRSLVAFSRQ
FT                   HGAAIVTLVTHAPTLDEAFLRLTGEMES"
FT   gene            444971..445726
FT                   /locus_tag="Mpet_0432"
FT   CDS_pept        444971..445726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0432"
FT                   /product="ABC-2 type transporter"
FT                   /note="InterPro IPR013525:IPR013526:IPR000412; KEGG:
FT                   mem:Memar_0022 ABC-2 type transporter; PFAM: ABC-2 type
FT                   transporter; SPTR: ABC-2 type transporter; PFAM: ABC-2 type
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35206"
FT                   /db_xref="GOA:E1RGJ5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGJ5"
FT                   /protein_id="ADN35206.1"
FT                   /translation="MNPAGVPEQLRRAWAIAKKDILIYYFKGPVLIFGVFMPVFLFLAF
FT                   LMGGRQLPLEFLVSGLIGMTLFFTATAVSPAIFPWEGQAKTLERLASCPVSTGTIVFGD
FT                   MLASLIFGIGITAVTVIIGIALGLPLLHGIVLVAGIVISAFCFSAIGMLLAVPPTNVPS
FT                   NIMMLTSLIKFPLIFVSGIFVPLEQLPYWGVALAACSPLTYFTDLVRYSFTDAHFFPVL
FT                   TDLAVLTVFTFFFTIMAMALHKMTMPRRM"
FT   gene            complement(445830..446159)
FT                   /locus_tag="Mpet_0433"
FT   CDS_pept        complement(445830..446159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mth:MTH1416 hypothetical protein; SPTR:
FT                   Conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35207"
FT                   /db_xref="GOA:E1RGJ6"
FT                   /db_xref="InterPro:IPR035350"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGJ6"
FT                   /protein_id="ADN35207.1"
FT                   /translation="MEYTYLVITLAILLSSITTGFITFRMIGMRLAVHFGFLMLAFIAT
FT                   IAAIATGLTTTVLAAAVLQILATITAYTQIWPTLKYSIQTSPGYAPHLALMTMLPVLAL
FT                   AAVLM"
FT   sig_peptide     complement(445983..446159)
FT                   /locus_tag="Mpet_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(446170..447015)
FT                   /locus_tag="Mpet_0434"
FT   CDS_pept        complement(446170..447015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0434"
FT                   /product="DsrE family protein"
FT                   /note="COGs: COG2044 peroxiredoxins; InterPro
FT                   IPR003787:IPR001412:IPR001455; KEGG: mth:MTH1417
FT                   hypothetical protein; PFAM: DsrE family protein; SPTR:
FT                   Conserved protein; PFAM: DsrE/DsrF-like family; SirA-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35208"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGJ7"
FT                   /protein_id="ADN35208.1"
FT                   /translation="MVKTIPARGIKSPNASILAANVIRHSAEPDEEIRFLLSPGAEKGM
FT                   DAVAEKFGYNLETGKNGGDVEVRMTPHGTKMQEVDVTGDTCPGPAITVGNILESLGIGE
FT                   RLKVKCANGSTLEDIARAVTSGGSRVIEEGGEGDRHYLIAEKAERPAAGEASALAANLD
FT                   SVVIIQSNGISNAERAYATFLFSKVALSMGKTVTIFLLMDGASMAKKGAATGVKHPSFD
FT                   RLDSLMNEVIEGGTKVYVCELSAQFRGINEGNLVEGMKIAGAATYIDLISNPANAVVNF
FT                   "
FT   gene            complement(447019..447699)
FT                   /locus_tag="Mpet_0435"
FT   CDS_pept        complement(447019..447699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0435"
FT                   /product="protein of unknown function DUF169"
FT                   /note="COGs: COG2043 conserved hypothetical protein;
FT                   InterPro IPR003748; KEGG: mth:MTH1418 hypothetical protein;
FT                   PFAM: protein of unknown function DUF169; SPTR: Conserved
FT                   protein; PFAM: Uncharacterised ArCR, COG2043"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35209"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGJ8"
FT                   /protein_id="ADN35209.1"
FT                   /translation="MSYETTGKELIELLGLKGSPVAVKIAETQADVPAGYQKIREKSRH
FT                   CQFVQDARLQGMKGYATRDEHLCKGGAGVMGIEPLPEAVSTGKMYHTLGNFKTAEGALD
FT                   TVSAIPKCTTESYASVYSPFESAEFEPDVVVIVATPRQALRLSQAYLYATGGRISSDYS
FT                   GIQSICADAVVAVKQRGVPNMTLGCNGSRKNSGIAEDEVILGIPPKDLPDIIEALKLFA
FT                   EKWG"
FT   gene            447889..449511
FT                   /locus_tag="Mpet_0436"
FT   CDS_pept        447889..449511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0436"
FT                   /product="putative GAF sensor protein"
FT                   /note="InterPro IPR003018; KEGG: mth:MTH1419 hypothetical
FT                   protein; PFAM: GAF domain protein; SMART: GAF domain
FT                   protein; SPTR: Putative uncharacterized protein; PFAM: GAF
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35210"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGJ9"
FT                   /protein_id="ADN35210.1"
FT                   /translation="MASTRIENLAGTEHLIVTYLRSHLPEECMLDKISMGIGKSRATVL
FT                   KYLWTLHAKGIIDYREIGRNKLWMMKQPQEAGTETIIREEPESRPPGVRTTAQAAFELH
FT                   NLLLREAELRDSLDLPETAVLTIGEDLFIIARNRLFESLFPAAEKFSDLVHQSQAAKLE
FT                   NLCRSANAGTPASIELDLLERAGIYRSYRFTLVPAGPADSAGARVLIGEDLSGGRRTRR
FT                   HLESLLYIIRTAATAQNEEDLLRETLRGVRENLVPFVHGSIVMADMHVAFTTASLSGEL
FT                   LQDLSPLLEHCMTSLETVSEERGDGTFRYAVAVPIIDEEQATGAMLLLTESSISATEVE
FT                   NIEIVADEIASALRMQRLDRERAEFVNTLLAMNSISTILNTATDEEAILEKSIEAVINT
FT                   LGFDMGCIYLKDDAEGMVPRVQRNMPEHLRKMCIAGIYDGLFDRVFRDQTLVYVVPGMP
FT                   EYEDLVPRAIRENGVRTLLILPIKVGDQIVGLVNMGSRAEKHYTQTSLDNLLSIGLQLG
FT                   IALERSRLASALGEAGGESKKGE"
FT   gene            complement(449595..450278)
FT                   /locus_tag="Mpet_0437"
FT   CDS_pept        complement(449595..450278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mla:Mlab_1194 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35211"
FT                   /db_xref="GOA:E1RGK0"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGK0"
FT                   /protein_id="ADN35211.1"
FT                   /translation="MKNTHIMAGVIFILLFLLCLLAGIIVIGDGDSGNEMPSSNESVKN
FT                   TLDLSDPTITEWNNIQRVSNNTDFQDFQGYIDSYNTTYELRNYENGIISLDDFLGPIVS
FT                   FIDDNPTGAGEISVYKEYYKLYFDFVNDSGEITGETEYKCYSPGECYNVTLFMAGNPEL
FT                   EQIFGGDCIPVYDEFEYFCYLNCSYDSGEEAYFVFHNHQVVFYYQDEEIMESFDQWFDG
FT                   IPEYH"
FT   sig_peptide     complement(450213..450278)
FT                   /locus_tag="Mpet_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            450348..450779
FT                   /locus_tag="Mpet_0438"
FT   CDS_pept        450348..450779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA3533 hypothetical protein; SPTR:
FT                   Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35212"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGK1"
FT                   /protein_id="ADN35212.1"
FT                   /translation="MRSGGRVNRLIVILTVMNAGCEDPARYIGCCGAYCKTCRALAEGT
FT                   CRGCKPGYDKGERDIRKARCRIKVCCFGEKKFETCADCPDYDACDVISVFHNKKGYKYI
FT                   KYHESLEFIRKNGYDEFIEAAGKWKGAYGRLPRTLSPED"
FT   gene            complement(450776..451228)
FT                   /locus_tag="Mpet_0439"
FT   CDS_pept        complement(450776..451228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0439"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="COGs: COG3467 flavin-nucleotide-binding protein;
FT                   InterPro IPR011576; KEGG: mbu:Mbur_1135 pyridoxamine
FT                   5'-phosphate oxidase-related, FMN-binding; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding;
FT                   SPTR: Pyridoxamine 5'-phosphate oxidase domain protein;
FT                   PFAM: Pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35213"
FT                   /db_xref="GOA:E1RGK2"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGK2"
FT                   /protein_id="ADN35213.1"
FT                   /translation="MGEVITDKKEIEEILLNSPYLRLGVCRDKDPYIVPMAFGYKDGAI
FT                   YLHSSKKGKKIEILKVNPNVCFEADAYYGLVPSDRPCSYDMKYESVTGSGTATILEDEE
FT                   EIREGLAVIAGRYHGGNYDPRSLNTGGLAVIRIAVKEMTGRKNLID"
FT   gene            complement(451242..451862)
FT                   /locus_tag="Mpet_0440"
FT   CDS_pept        complement(451242..451862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0440"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: mac:MA4347 menaquinone biosynthesis methyltransferase
FT                   (2-heptaprenyl-1,4-naphthoquinone methyltransferase); PFAM:
FT                   Methyltransferase type 11; SPTR: Menaquinone biosynthesis
FT                   methyltransferase (2-heptaprenyl-1, 4-naphthoquinone
FT                   methyltransferase); PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35214"
FT                   /db_xref="GOA:E1RGK3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGK3"
FT                   /protein_id="ADN35214.1"
FT                   /translation="MMSVTEIFFWIIVIILIWQIVIRIGRKVWHFPAPSFIGGFLDSDF
FT                   RRWIQPPDLLLSRSGIERGMTVLEVGCGSCCFTPFAVKMAGPEGKVIGFDIQKEMLDQC
FT                   SEKETELPELVQADAYNLPFCENTFDAVYMVTVLQEIPDPHTALMECRRVLKKGGVLGV
FT                   SEFLVDPDYPLKRTTIAMGENAGFVVDGVEGGFWNYTVRFRKP"
FT   gene            complement(451859..452440)
FT                   /locus_tag="Mpet_0441"
FT   CDS_pept        complement(451859..452440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0441"
FT                   /product="aspartate racemase"
FT                   /note="COGs: COG1794 Aspartate racemase; InterPro
FT                   IPR015942:IPR004380; KEGG: mbn:Mboo_2031 aspartate
FT                   racemase; PFAM: Asp/Glu/hydantoin racemase; SPTR: Aspartate
FT                   racemase; TIGRFAM: aspartate racemase; PFAM:
FT                   Asp/Glu/Hydantoin racemase; TIGRFAM: aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35215"
FT                   /db_xref="GOA:E1RGK4"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGK4"
FT                   /protein_id="ADN35215.1"
FT                   /translation="MKMIGVIGGMSRVSSAEYYKLMNEMVEERPGGLHSAKILMYSIEF
FT                   AEFTDIPRRFRKVQSSFDWKPLRNTMIDSAERLKRGGAYFIIRCSNTLHSSADDIEKKV
FT                   KIPVLHIAGATGEKIRERALKIVGLPGTEYTMEEDFYRKRLEEKFGIKVIILVCTEIPL
FT                   LVKQKDVEIPLFDMMTIHAEAAVKYALGDE"
FT   gene            452692..454389
FT                   /locus_tag="Mpet_0442"
FT   CDS_pept        452692..454389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0442"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR013767:IPR003661:IPR003594:IPR004358:IPR
FT                   000014:IPR005467:IPR000700; KEGG: mbn:Mboo_1140
FT                   multi-sensor signal transduction histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; PAS fold domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; PAS domain
FT                   containing protein; SPTR: Multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35216"
FT                   /db_xref="GOA:E1RGK5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGK5"
FT                   /protein_id="ADN35216.1"
FT                   /translation="MDIDIRTLSLVVVIANVFQAFAIAFLYVINKKYRGISWWVLGSAS
FT                   TALGFILLLLRDASDIVLVTIILANALIVAGSVFTYTGIMRFLDKHENFRIVLPVFVVF
FT                   IGLYFYFTYVSDDITVRTAILSLFLAFYMFLTSSALLGKVPYAITCSARFVAGVETTLA
FT                   CFLVFRGWYVLFVTPIETLFTSAIIQYVSFLFFFGGGFLLTVGLIIMVNQRLNADVVEA
FT                   KEEFELFFRTSPDGIVISRLDGGVIIDINEGFTNLTGFDRDDTIGSSTLEINMWKDPGD
FT                   LKEIFGEVRKKGFCENYETILRRKDCSEITSIVSAKSITLQGVPCIISVTRDITDRKRA
FT                   EEALRQANRKLNLLSSITRHDILNSITVIAGYLGLAREEPAGPKLKGYLDHLDASAKTI
FT                   QHQIEFTREYQEIGVNAATWQNVEENVRNAASEFKIGDVILTIECSDVEIFADPLLRKV
FT                   FYNFFDNSFRYAPPFTTITVSCKEKGDGLSVIFADDGVGITKEVRKHLFERGFGNHTGL
FT                   GLFLSREILAITGITITENGGAGKGASFEMTVPKGAYRVSDDEANQMQ"
FT   sig_peptide     452692..452757
FT                   /locus_tag="Mpet_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(454438..454698)
FT                   /locus_tag="Mpet_0443"
FT   CDS_pept        complement(454438..454698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mae:Maeo_0424 methyltransferase type 11; SPTR:
FT                   Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35217"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGK6"
FT                   /protein_id="ADN35217.1"
FT                   /translation="MSSLISTKGGGYGRGIKIEEDTFVSEGGPEAGVPHHYFDYAGIKE
FT                   LFGRWEIFGLVEHVSTYMQARENFHDFNPFPYTKWNIVVKK"
FT   gene            complement(454749..454928)
FT                   /locus_tag="Mpet_0444"
FT   CDS_pept        complement(454749..454928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0444"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Glycoside hydrolase family 38"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35218"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGK7"
FT                   /protein_id="ADN35218.1"
FT                   /translation="MATWNELFLDDKYIETLPQPEVYKFIKMLEGAFPDETLSIWDFTA
FT                   LFHGTPCITTPLKI"
FT   gene            455025..455318
FT                   /locus_tag="Mpet_0445"
FT   CDS_pept        455025..455318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0445"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="COGs: COG1669 nucleotidyltransferase; InterPro
FT                   IPR002934; KEGG: mac:MA0102 nucleotidyltransferase; PFAM:
FT                   DNA polymerase beta domain protein region; SPTR:
FT                   Nucleotidyltransferase; PFAM: Nucleotidyltransferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35219"
FT                   /db_xref="GOA:E1RGK8"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGK8"
FT                   /protein_id="ADN35219.1"
FT                   /translation="MNSSPLELLKEHEDEITRSFGVRRIGIFGSFARGEESPESDVDIF
FT                   VEFQAGKKTFDNYMGLKNFLESLFERKIDLATYEGLNPHIRESVVNGVIYAS"
FT   gene            455320..455640
FT                   /locus_tag="Mpet_0446"
FT   CDS_pept        455320..455640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0446"
FT                   /product="protein of unknown function DUF86"
FT                   /note="COGs: COG2361 conserved hypothetical protein;
FT                   InterPro IPR008201; KEGG: mrb:Mrub_2705 hypothetical
FT                   protein; PFAM: protein of unknown function DUF86; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35220"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGK9"
FT                   /protein_id="ADN35220.1"
FT                   /translation="MDLYFSDIVDAANNILDYTKGIDYDDFISNQMCIDAVIKNFLVIG
FT                   EAVKKIPEEIKSQHSSIDWKNIAGLRDVLVHAYFRIDDEILWDIVQNKLEDLRDEVLKM
FT                   SE"
FT   gene            complement(455655..456215)
FT                   /locus_tag="Mpet_0447"
FT   CDS_pept        complement(455655..456215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0447"
FT                   /product="Protein of unknown function DUF2143"
FT                   /note="InterPro IPR019222; KEGG: mbn:Mboo_1298 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2143; SPTR:
FT                   Hypothetical membrane protein; PFAM: Yip1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35221"
FT                   /db_xref="GOA:E1RGL0"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGL0"
FT                   /protein_id="ADN35221.1"
FT                   /translation="MIDKIIVRITEVLLDPVESFHQSENDEPKEVLTYFAVLFIINSVL
FT                   FTIVKYAGIDAETIALIPGSENIFFIFAFAVISSLVQTVIFVMLLHFWVYILCGKGGGM
FT                   QTIKAFVYASTPMLLFDWIPVIGFIFIIWSAVLNVLGIRELHKMSTGEAAGAFVAAIII
FT                   TVGLFIFLIGALVIPLIGKATVT"
FT   gene            complement(456313..456891)
FT                   /locus_tag="Mpet_0448"
FT   CDS_pept        complement(456313..456891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0448"
FT                   /product="Protein of unknown function DUF2143"
FT                   /note="InterPro IPR019222:IPR018130; KEGG: mbn:Mboo_1298
FT                   hypothetical protein; PFAM: Protein of unknown function
FT                   DUF2143; SPTR: Hypothetical membrane protein; PFAM: Yip1
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35222"
FT                   /db_xref="GOA:E1RGZ8"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGZ8"
FT                   /protein_id="ADN35222.1"
FT                   /translation="MTDVEDIVAKIKGIFLNPVETFQESRDDPQGMIITYFAVILLVNS
FT                   LLHTIVIYLQAGSYMGGLSPTGPGGVFFIFVFAVLSSLVMSALFVLWLHLWVYILGGRK
FT                   GLIQTAKAFVYGVTPEFLLGWIPYIGIIFLIWSFLLGVLGVRELHEISTARAAVALVIA
FT                   IVIPLLLLLFVSLYLISHLNTIPAAAYTP"
FT   gene            complement(457122..457679)
FT                   /locus_tag="Mpet_0449"
FT   CDS_pept        complement(457122..457679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbn:Mboo_1298 hypothetical protein; SPTR:
FT                   Hypothetical membrane protein; PFAM: Yip1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35223"
FT                   /db_xref="GOA:E1RGZ9"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:E1RGZ9"
FT                   /protein_id="ADN35223.1"
FT                   /translation="MIDSIIAKIKGILLDPVETFLQSKDEEPKAVLTYYAVLVIINSLF
FT                   YTIMSIVGLNPPSDTIPGSGNIFFIFGFAVFSSLILAVLFVAWLHVWVYILGGRKGIFQ
FT                   TAKTFVYAGTPYFLLGWLPYIGFIFLIWSFILSVLGIRDLHEISIARAGVALAIAIVVP
FT                   IVLLVILAIVLFASYMALVNIA"
FT   gene            complement(457842..459593)
FT                   /locus_tag="Mpet_0450"
FT   CDS_pept        complement(457842..459593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0450"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components;
FT                   InterProIPR001140:IPR003439:IPR003593:IPR017940:IPR 017871;
FT                   KEGG: pgn:PGN_1916 putative ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; SPTR: Putative
FT                   uncharacterized protein; PFAM: ABC transporter
FT                   transmembrane region; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35224"
FT                   /db_xref="GOA:E1RH00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH00"
FT                   /protein_id="ADN35224.1"
FT                   /translation="MLKFLMDRLALSRKGAGDFVKGTFFTLLLDFALMLPAVYVFLFLD
FT                   EYLRPLTGEAGVPGNDIRYYIAIAVLFIIVTWVIARLQYRSTYTTIYEESANRRLALAE
FT                   KLRKLPLSFFAEKNLSDLSSTIMQDNTELEHTFSHAVPQLFASVIFLTIMGIMVFVYNW
FT                   MLALALLWPAPLALVVILLSKKMQRKNQKNVYDQSRNVSEHIQEGLDTIQEIKAYSNEE
FT                   KYLRDLDRKLDNYERSLISGELVIGLLVNSSKGLLKLGLVSVILVGAGLLVAGSVDLFT
FT                   YLVFLILATLIFEPINEVFNNLAVLFYLDVRINRMREMEALPVYTGRTEFSPENFDIGF
FT                   DHVDFSYETGKQVLRDVSFIAKQGEITALVGPSGGGKSTSAKLAARFWDVNSGRILLGN
FT                   QDIKEIDPETLLKYYSVVFQDVVLFNTSVMENIRIGRHGASDEEVLRVAGLAQCDEFVN
FT                   KLPDGYQTVIGENGEKLSGGERQRISIARALLKDAPIVLLDEATASLDVENETRIQAGI
FT                   SELVRNKTVLVIAHRMRTVATADKIVVLENGMVKESGRPEELKSMNGIFAGMVRRQMEM
FT                   TGGKAAG"
FT   gene            complement(459586..461328)
FT                   /locus_tag="Mpet_0451"
FT   CDS_pept        complement(459586..461328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0451"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components;
FT                   InterProIPR001140:IPR003439:IPR003593:IPR017940:IPR 017871;
FT                   KEGG: pgi:PG1176 ABC transporter, ATP-binding protein,
FT                   putative; PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; SPTR: Lipid A
FT                   export permease/ATP-binding protein MsbA; PFAM: ABC
FT                   transporter transmembrane region; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35225"
FT                   /db_xref="GOA:E1RH01"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH01"
FT                   /protein_id="ADN35225.1"
FT                   /translation="MVGRKYMLPASLLISALSSLLGILPLIFIWLIIREFLSPATVTSQ
FT                   ALIGTYAWWAAGTAIAGIGIYFLALTISHLAAFRVEVEMRRQAMKKIVSFPLGFFDNNT
FT                   CGRIRKIIDDNASTTHSFLAHQMPDLAASIVVPVVSLVLIFIFDWRLGLACLVPLVISF
FT                   GIMSFAMGTKGKYFLKTYMDSLEEMNTEAVEYVRGIPVVKVFQQTVYSFKSFQKSIIRY
FT                   KEMVFNYTISWETPMTAYTVGIHSFAYILVPVAILMIGNSANYAGIVVDLLFYILITPV
FT                   FANSIMKSMYIRQAMGQAEEAINRIDELTDVKPLPVSSDPKPIHGNEIRFEDVSFTYPG
FT                   TSRKAVDDISFTVPKGKTFALVGPSGSGKTTIARLVPRFWDTDEGKVFIGGSNVREIDP
FT                   EELMQNVSFVFQNTSLFRASLYDNICYGNPGATPEEVESALEKAQCREIIDRLPKGLDT
FT                   KIGAEGTYLSGGEQQRIALARAILKDAPIVVMDEATAFTDPENEHLILEALGKLTEGKT
FT                   VLMIAHRLTSVVDVDTILVIENGKIAEQGSHQELLDKDGLYAKMWNEYQRSVQWTIGKE
FT                   ALHA"
FT   sig_peptide     complement(461266..461328)
FT                   /locus_tag="Mpet_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(461986..462858)
FT                   /locus_tag="Mpet_0452"
FT   CDS_pept        complement(461986..462858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF_A0124 putative tripeptide transporter
FT                   permease; SPTR: Probable nodulation ABC transporter
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35226"
FT                   /db_xref="GOA:E1RH02"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH02"
FT                   /protein_id="ADN35226.1"
FT                   /translation="MDIITGVFGGILDYLVNSLILTSIIFAAFSVLVYLILTRIKNEKF
FT                   QLITGITLGFFLIALSAFAAGGFAGSALLVMGTALVMVSPAVAFREYLDKKYLFPVIFL
FT                   VTLTYPMYFLTTQYMCDYYYPYLWIFGNFSGTLILSVSAIALLIFIQRYYENFKFDKRL
FT                   LVLLLLLIPGIIWFGVSVAAASLSALILILLNELQKESYKISDLRILEAVIFAAFLVLL
FT                   PWPFLTTLPCVRTIFPLRIIPVIATSLVSATIIYCLRSKISGKWIESSAFVLGFVISTI
FT                   VVYFTEFFL"
FT   gene            complement(462879..463160)
FT                   /locus_tag="Mpet_0453"
FT   CDS_pept        complement(462879..463160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vei:Veis_2421 type I restriction-modification
FT                   system, M subunit; SPTR: Endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35227"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH03"
FT                   /protein_id="ADN35227.1"
FT                   /translation="MKVKKGMQALSLLIVLALAGAVFVPAASAYDNSGSENLVTYEYGE
FT                   KVAEAHLTQMSTDISEYSVWNGVDLTQNITTASNIAFGNNAIAVYTQP"
FT   sig_peptide     complement(463074..463160)
FT                   /locus_tag="Mpet_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(463573..464097)
FT                   /locus_tag="Mpet_0454"
FT   CDS_pept        complement(463573..464097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA4221 hypothetical protein; SPTR:
FT                   Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35228"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH04"
FT                   /protein_id="ADN35228.1"
FT                   /translation="MKISFFILLLMLLLIGHAACCIDQEIKGPDQPVINNTTKCNLSEE
FT                   WISGVNVSTVPYLGSESIRTNASFVARTALCDKNVAEMLSHGSGIKGVIDFMPSRPKGW
FT                   NLSCGPTLWVVYRGINVYFYVNETQEIVERFEVVIPGDLYGKERLENYTRLIDGNGTAV
FT                   FAFNSSDIWFP"
FT   sig_peptide     complement(464044..464097)
FT                   /locus_tag="Mpet_0454"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(464416..465051)
FT                   /locus_tag="Mpet_0455"
FT   CDS_pept        complement(464416..465051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_2337 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35229"
FT                   /db_xref="GOA:E1RH05"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH05"
FT                   /protein_id="ADN35229.1"
FT                   /translation="MKKTQLIGILGGLGVLLIVMAICLYFAGPVPDNPDNFQANERGSV
FT                   TFYYNNGGSQISLDLSALKVDDPETISTNLSTILGVALNDLRSGILLENGWIIASVSEY
FT                   DNEDSNDGKSVELEFRKDALSFYIVVNEQSRTATKGYCDAITWISEPISGPLPEGYHKA
FT                   KDKLTGWWYVFDIQNNSSNSTVVMIYNDTAILYLYPSYSVINTEGLYD"
FT   sig_peptide     complement(464971..465051)
FT                   /locus_tag="Mpet_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(465127..466080)
FT                   /locus_tag="Mpet_0456"
FT   CDS_pept        complement(465127..466080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0039 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35230"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH06"
FT                   /protein_id="ADN35230.1"
FT                   /translation="MTGIVDNNSGALNPESVAYQPGAVGESFGIGLYDAPVHTPDHSLH
FT                   YSKELSENEPFNGYLFISNQLAENNSFLIFCLVDYNQTSFSCDGSEKGVLHKVSLNPFE
FT                   ERFVKFSIDPLEKGVHDFEIFILLKTDQHSLNKSFRLSTDFSYLGSKRMNLFVFDDKLP
FT                   EVQYTDFSLLSASNCGSDYPINDGIILTKEPCSSKGWFTEDVRSGEVLHYWINLAADKE
FT                   YPVSFAVITLLDYIQVPLRTDMKEKCWFGSLSAGEKISVPASIVVPSEEGVHELMSVYI
FT                   PLPYQRFETSPGVPTQFNQWTWSEPSIRIGLNVSAV"
FT   gene            complement(466190..466627)
FT                   /locus_tag="Mpet_0457"
FT   CDS_pept        complement(466190..466627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mma:MM_2160 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35231"
FT                   /db_xref="GOA:E1RH07"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH07"
FT                   /protein_id="ADN35231.1"
FT                   /translation="MRCQKFFDKKNTLFLSYLSFFAVFSFAYYFLSSKNSFYSGIIGII
FT                   LIILYPVGAFFYGYKTGDRFRSPLAGIVSYTFLILFISLLVNFQNPLSSGYLLLFAGYH
FT                   LALLICLGIIGFLASGREKLHLIAAGILSVIWFLIFISGIS"
FT   sig_peptide     complement(466547..466627)
FT                   /locus_tag="Mpet_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(466635..467474)
FT                   /locus_tag="Mpet_0458"
FT   CDS_pept        complement(466635..467474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA0566 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35232"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH08"
FT                   /protein_id="ADN35232.1"
FT                   /translation="MKMEKTMRPLSLLFTALIVSVILVQAVSAEKTSPRIVSEWEKEHA
FT                   ILVEHTTEYYVSDETLYVKDVYSGSELKKRFNVEQLEKTNSYKVDPDYVKKFNLVEGKH
FT                   YTSTESSYEVFTLKNDPPVSSKSYDYPQWIYEKLGDTYHQLDEPINIAWESNDLNTVKA
FT                   EILNEGWWDVIAEDTYYIYDSGWKADDGLADDPLRVFGGWHIRLWQMNDGDVVGAAHHD
FT                   TWAPHEADGFENAEEEVAGFYDQPGDVMWHVYEDDYSLNNYVASPYNNGMCTRIFYG"
FT   sig_peptide     complement(467391..467474)
FT                   /locus_tag="Mpet_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(468047..468241)
FT                   /locus_tag="Mpet_0459"
FT   CDS_pept        complement(468047..468241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dpe:Dper_GL25355 GL25355 gene product from
FT                   transcript GL25355-RA; SPTR: GL25355"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35233"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH09"
FT                   /protein_id="ADN35233.1"
FT                   /translation="MRLYIIIFDPFNTVSVDFIVPGPLCNAAGIADINVDPPVIRSSVV
FT                   IVKKYPETLVVGSVDLQPQ"
FT   gene            468257..468991
FT                   /locus_tag="Mpet_0460"
FT   CDS_pept        468257..468991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3398 conserved hypothetical protein; KEGG:
FT                   mba:Mbar_A0654 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35234"
FT                   /db_xref="GOA:E1RH10"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH10"
FT                   /protein_id="ADN35234.1"
FT                   /translation="MQNVSKLILFFYILLIFMVTGVQAAEGDYIIKPHEDNQGLIDKGL
FT                   IDSGGADSTITFWELPLLIKISFIAGILAAIIGTIKIIPIIQGRLEDLFDNQNRNDIFD
FT                   FISENPGCSIADISNNLGINRGSTKYHIGKLISDSKVTLVKSGKFIRIFENSGIFDEQQ
FT                   KVLASHLRNETGRKLLLSIMENPGITNMDLAEKHDMNKSTIHWPLKKFQKSGIVQSSPE
FT                   GKYKKYSLNPTFENDLKDYFSK"
FT   sig_peptide     468257..468328
FT                   /locus_tag="Mpet_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(469259..469876)
FT                   /locus_tag="Mpet_0461"
FT   CDS_pept        complement(469259..469876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0461"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mco:MCJ_006700 ABC transporter ATP binding
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35235"
FT                   /db_xref="GOA:E1RH11"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH11"
FT                   /protein_id="ADN35235.1"
FT                   /translation="MQRYDFKKFKIHLDTNFKDSLRLLENSNTDWEEAVEVFSNFFEEL
FT                   EKMPISTERNVKMLLATRFFNHILSSLILTLYSLYVDSVICSRTAIESLAAFKLICANP
FT                   KKAESYHADNFPSPIKVRIELENLGYTTEANNIRTIYKSDSELTHITRDHERFSMDYNY
FT                   FTKDGQLFVGGHFSKDDTEYMIKYLPTLIHWFLMPLDNTISD"
FT   gene            complement(469999..470208)
FT                   /locus_tag="Mpet_0462"
FT   CDS_pept        complement(469999..470208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0462"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="COGs: COG1598 conserved hypothetical protein;
FT                   InterPro IPR005357; KEGG: mhu:Mhun_0585 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0150; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   protein family (UPF0150)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35236"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH12"
FT                   /protein_id="ADN35236.1"
FT                   /translation="MFRFLIIIEKADGNYSAYSPDLPGCVATGKTREEAEKNMHEAIAF
FT                   HIEGLKDDGLPIPEGKSSASWVLV"
FT   gene            complement(470208..470402)
FT                   /locus_tag="Mpet_0463"
FT   CDS_pept        complement(470208..470402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0463"
FT                   /product="YcfA family protein"
FT                   /note="COGs: COG1724 periplasmic or secreted lipoprotein;
FT                   InterPro IPR012933; KEGG: mhu:Mhun_0586 YcfA-like; PFAM:
FT                   YcfA family protein; SPTR: YcfA-like; PFAM: YcfA-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35237"
FT                   /db_xref="GOA:E1RH13"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH13"
FT                   /protein_id="ADN35237.1"
FT                   /translation="MKVREVIKIIEVEGWYLVSVRGSHRQYKNPNIPGRITIPGNMNDT
FT                   LAPGTLNSILKQAGIKERK"
FT   gene            complement(471173..471559)
FT                   /locus_tag="Mpet_0464"
FT   CDS_pept        complement(471173..471559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0464"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="COGs: COG1143 Formate hydrogenlyase subunit
FT                   6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I);
FT                   InterPro IPR001450:IPR017896:IPR017900; KEGG: mhu:Mhun_1746
FT                   4Fe-4S ferredoxin, iron-sulfur binding; PFAM: 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; SPTR: Ech
FT                   hydrogenase subunit F; PFAM: 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35238"
FT                   /db_xref="GOA:E1RH14"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH14"
FT                   /protein_id="ADN35238.1"
FT                   /translation="MGKITFTMAKRILKNLVGGPATLRYPFEPAKRYDASRGHIEINID
FT                   DCIFCGLCSKNCPADAIEVSKPDRTWEIDRFRCIICNSCVEACPKDCLSTSNVYKEPVL
FT                   SGPVKDKVIGPEVEAEKEAPAGAE"
FT   gene            complement(471566..472648)
FT                   /locus_tag="Mpet_0465"
FT   CDS_pept        complement(471566..472648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0465"
FT                   /product="NADH-ubiquinone oxidoreductase chain 49kDa"
FT                   /note="COGs: COG3261 Ni Fe-hydrogenase III large subunit;
FT                   InterPro IPR001501:IPR001135:IPR018194:IPR014029; KEGG:
FT                   mpl:Mpal_2728 NADH-ubiquinone oxidoreductase chain 49kDa;
FT                   PFAM: NADH-ubiquinone oxidoreductase chain 49kDa;
FT                   nickel-dependent hydrogenase large subunit; SPTR:
FT                   NADH-ubiquinone oxidoreductase chain 49kDa; PFAM:
FT                   Respiratory-chain NADH dehydrogenase, 49 Kd subunit;
FT                   Nickel-dependent hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35239"
FT                   /db_xref="GOA:E1RH15"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH15"
FT                   /protein_id="ADN35239.1"
FT                   /translation="MTGRRTVVPFGPQHPVLPEPIHLDLVIEDERVVEAVPSIGYVHRG
FT                   LEKLVEKKDYKNYVYIAERICGICSFIHSVGFCQGIENIMGVEVPERAQYLRTIWSEYS
FT                   RMHSHLLWMGLFADAMGFENLFMNAWRIREQVLDVMEETTGGRVIQGSCKVGGVRRDIS
FT                   DSKLKEMSAGLDRTYAEVEELNHVFFDDSTVIHRTSGIGYLSKDDAYHLGAVGPTARGC
FT                   GVAIDARETGYLKYPELDFKPIVETEGDCYSRCVVRAKEVLQSADLIKQAIEKIPDGDI
FT                   EVKVKGNPDGEYFSRVEQPRGECIHYVKGNGKRFLVRERVRTPTLTNIPPLVKMLAGCE
FT                   MADVPVIVLTIDPCIGCAER"
FT   gene            complement(472645..473073)
FT                   /locus_tag="Mpet_0466"
FT   CDS_pept        complement(472645..473073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0466"
FT                   /product="NADH dehydrogenase (ubiquinone) 30 kDa subunit"
FT                   /note="InterPro IPR001268; KEGG: mbn:Mboo_0027 NADH
FT                   dehydrogenase (ubiquinone), 30 kDa subunit; PFAM: NADH
FT                   dehydrogenase (ubiquinone) 30 kDa subunit; SPTR: NADH
FT                   dehydrogenase (Ubiquinone), 30 kDa subunit; PFAM:
FT                   Respiratory-chain NADH dehydrogenase, 30 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35240"
FT                   /db_xref="GOA:E1RH16"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH16"
FT                   /protein_id="ADN35240.1"
FT                   /translation="MTIEEQLIREISVGELLDEVKAKSDDGYRLVQIGCTRIEDAFEIN
FT                   YSFDKENRFENLRVTIGEDVTMPSISDIYWGAFIYENEMHDLYGIPVEGMNIDFNGYLF
FT                   KTSIPHPFRGEVTVKKVPAKKAVEETKEEAKADAGGEE"
FT   gene            complement(473075..473515)
FT                   /locus_tag="Mpet_0467"
FT   CDS_pept        complement(473075..473515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0467"
FT                   /product="NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /note="COGs: COG3260 Ni Fe-hydrogenase III small subunit;
FT                   InterPro IPR006137; KEGG: mbn:Mboo_0026 NADH ubiquinone
FT                   oxidoreductase, 20 kDa subunit; PFAM: NADH ubiquinone
FT                   oxidoreductase 20 kDa subunit; SPTR: NADH ubiquinone
FT                   oxidoreductase, 20 kDa subunit; PFAM: NADH ubiquinone
FT                   oxidoreductase, 20 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35241"
FT                   /db_xref="GOA:E1RH17"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH17"
FT                   /protein_id="ADN35241.1"
FT                   /translation="MAYITKSPWIIHYDASSCNGCDIEVLACLTPLYDVERFGIINTGN
FT                   PKHADVFLVTGSVNEQNKPVIKNIYKQMPKPNVVVAIGACALSGGVFRECYNVAGGVDK
FT                   LIPVDVYVPGCAAKPEAIIDGVVKALGILEQKREDMKKEAGH"
FT   gene            complement(473522..474403)
FT                   /locus_tag="Mpet_0468"
FT   CDS_pept        complement(473522..474403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0468"
FT                   /product="respiratory-chain NADH dehydrogenase subunit 1"
FT                   /note="COGs: COG0650 Formate hydrogenlyase subunit 4;
FT                   InterPro IPR001694; KEGG: mem:Memar_0363 respiratory-chain
FT                   NADH dehydrogenase, subunit 1; PFAM: respiratory-chain NADH
FT                   dehydrogenase subunit 1; SPTR: Ech hydrogenase subunit B;
FT                   PFAM: NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35242"
FT                   /db_xref="GOA:E1RH18"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH18"
FT                   /protein_id="ADN35242.1"
FT                   /translation="MSAIELLTGEPVIGILLFIVLAPFIGTIVLGLDRIITARMQGRVG
FT                   PPLFQPMYDILKLFEKEKMVIHESQNFWIFGYLVFIIITGALFFGGSDILLVIFALTLA
FT                   EVSLILGAFSSGSPYAHVGAERELIQLMAIEPMIIIAAVGFYEVTNSFNTFEIASYGSP
FT                   LILVLPGIFIGFVYILTVKLRKSPFDISTSHHAHQELVRGLNTEFAGSTLGMIELAHLY
FT                   EVVFLLGFLFLFFGFAAPIIGIIVIALVYLLEIFVDNATSRVKWGFMLDSCWIVTAVAG
FT                   VLNLMALYLILR"
FT   gene            complement(474400..476334)
FT                   /locus_tag="Mpet_0469"
FT   CDS_pept        complement(474400..476334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0469"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="COGs: COG1009 NADH:ubiquinone oxidoreductase subunit
FT                   5 (chain L)/Multisubunit Na+/H+ antiporter MnhA subunit;
FT                   InterPro IPR001516:IPR001750:IPR003916:IPR001412; KEGG:
FT                   mbn:Mboo_0024 NADH dehydrogenase (quinone); PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); NADH-Ubiquinone
FT                   oxidoreductase (complex I) chain 5/L domain protein; SPTR:
FT                   NADH dehydrogenase (Quinone); PFAM: NADH-Ubiquinone
FT                   oxidoreductase (complex I), chain 5 N-terminus;
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35243"
FT                   /db_xref="GOA:E1RH19"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH19"
FT                   /protein_id="ADN35243.1"
FT                   /translation="MESLIFLILFPLIAGVIMLFLPNSRGRDLFVNFAAIVTCLGSLYL
FT                   LFEYFGKGEVLFAVDGTFVDPLILVAEVAIGLFIIGISLKFKKYLVTVLAALQLAMAAY
FT                   TEIVFEPAHYAGFDLFIDPFSLIMALIIGIIGSLICVYATGYMKTYHEHHTDVVDRRPL
FT                   FFFLMFLFLSAMFGIVFSNNIMWLFMFWEITTLCSFLLIGYARDEVSWKNAFWALLLNV
FT                   IGGVAFSGAILFINAFSSGSDIYLNELLKSSPEIALVAAAFIGFAGLTKSAQFPFSSWL
FT                   VGAMVAPTPVSALLHSSTMVKAGVYVIVRFAPVFESNLIGIAFAFIGALTFLTASAIAI
FT                   SQSNAKKVLAYSTIANLGLVVACAGIGTEEAVWAAILLIIFHAVAKSLLFLSVGSVEHQ
FT                   KHSRDIEDMGGLIATMPKIALMMLIGMAGMFLAPFGMLISKWASIHAFVNAIPPFGMLL
FT                   IAIIAYGSGITVFFWTKWMGRILEVRTERKPVEKEASRPEMSAIFTLGGLTVLACLIFP
FT                   LISSTMIEPYIHEVYHTASPLLSLSNEIIMLFMVVVVILLPLSLFHFAKGRTLRRQYMS
FT                   ARVSEVDGEHLKFLGSMGVMKEEELSNYYFPNMFGEKELSRAGVWSSILIIVVMFALLS
FT                   WLVPLGVMM"
FT   gene            complement(476435..476560)
FT                   /locus_tag="Mpet_0470"
FT   CDS_pept        complement(476435..476560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35244"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH20"
FT                   /protein_id="ADN35244.1"
FT                   /translation="MKLLPENFFGKIKFREHAKFYPRGTIKPCITGEDNINGITE"
FT   gene            complement(476730..477578)
FT                   /locus_tag="Mpet_0471"
FT   CDS_pept        complement(476730..477578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0471"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: act:ACLA_083430 FF domain protein; SPTR: FF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35245"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH21"
FT                   /protein_id="ADN35245.1"
FT                   /translation="MELKYLPEIDRRLVLWRNTLQLFRKLNRPKFEGPFHKCNYNYQIE
FT                   PFLRNNYEETDYNPDIVASNDNSWLIIELTNNSDKSKCDQILKYKDLEGRNLSIYGLKP
FT                   HKTTPEILTSRIEYIDDKECCQIIVKEKLEVCKLNLLDYSALIDALTTSKGDDLSKLPA
FT                   IPITLVPESKKLEIRRGISDIVMMLFKPGSEGLTSRQMVELSLERISEKTGEKQKKDLA
FT                   KKIEIEMELLIGRFLKGYIKLDSGKYISTTDSVKSVQRREYIESRIEEWASSEQSNLSN
FT                   F"
FT   gene            complement(477556..478593)
FT                   /locus_tag="Mpet_0472"
FT   CDS_pept        complement(477556..478593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0472"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mja:MJECL33 hypothetical protein; SPTR:
FT                   Uncharacterized protein MJECL33"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35246"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH22"
FT                   /protein_id="ADN35246.1"
FT                   /translation="MPKIHDLNGVKELIQAGFDDNEETLSKYKKYTKPQLKAYLIESNE
FT                   KDLNNFRPPFGTWRKLSSDGWYILDSKDYNNSVFINTAGERVWTLYNIENAKESDLFIE
FT                   KLVENNIGLDRCWLSRGYLHYKKNKSNWIQKGIGLKYLDGLAEEDEGGQFSLKAWYGNK
FT                   QIEGLDKIIEEASDKLAIHSTRWKKISNGDTKISMEMYSEGKITINRAEDVDETLIEIS
FT                   EIANKYEDELIDASKLRDDKIGAFELNFEQKVDLSSFSKTVKKGKGQMRLWLTETESKD
FT                   DFKRFKGVDLHNWDRLLIDIGEDYAYITVPGKGCINAVPRIATLQGEDNAGYTSIFYDG
FT                   VEIFA"
FT   gene            complement(478872..480677)
FT                   /locus_tag="Mpet_0473"
FT   CDS_pept        complement(478872..480677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0473"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="COGs: COG0464 ATPase of the AAA+ class;
FT                   InterProIPR001440:IPR003959:IPR000641:IPR019734:IPR
FT                   003593:IPR013026; KEGG: dhd:Dhaf_3309 AAA ATPase central
FT                   domain protein; PFAM: AAA ATPase central domain protein;
FT                   TPR repeat-containing protein; SMART: AAA ATPase;
FT                   Tetratricopeptide repeat; SPTR: AAA ATPase central domain
FT                   protein; PFAM: ATPase family associated with various
FT                   cellular activities (AAA); Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35247"
FT                   /db_xref="GOA:E1RH23"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH23"
FT                   /protein_id="ADN35247.1"
FT                   /translation="MGEEQVLSDELLEELENLNNKLAGVKSSYESGKEEKAESKYESSI
FT                   GIYDESVEHLGPAIDEIFELYDDDPDYIEEFLDEVESYYEAFFSWDDTFDYDFSDQEAG
FT                   VTAILDLSRGRLLALSEKYRLALKRLTDGLNSSPEEYQAAFREEIGNVHYKLEDYSRAL
FT                   EFYEEAIERDWERPGAWQGKILVLMEMERAEEAIEAAHTLLELCDDESAEYFAAKTSLV
FT                   LCNFNLGRYHDIVDNAPLILPEDEETDDLNALLWYYRYLALKEIDAPEDECREAYKEAL
FT                   RYNPDIESTDEFRELFEDKSPPEPVKPKKDNSKNSLNDMLKDLNGEKGGRSLEDLLEEL
FT                   NELTGLSSVKKDVNSQINIVKIRNLREKKGLKQPELSLHMVFSGNPGTGKTTVARLVSE
FT                   IYHKLGVLSKGHLVEVDRADLVAGYVGQTALKVQEVVQSALGGVLFIDEAYTLTSKEGN
FT                   DFGDEAIATLLKAMEDNRNDLLVIVAGYPDLMNEFLQSNPGLRSRFNKFINFEDYSPEE
FT                   LMEMLDMRCRKNGMALSDESRVYARAFFEKRCKTKGADFANGRDVRNFFERAYLNMSDR
FT                   LAMEENPSEEDLSTIILDDLKEVTL"
FT   gene            480770..481540
FT                   /locus_tag="Mpet_0474"
FT   CDS_pept        480770..481540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0474"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2230 Cyclopropane fatty acid synthase and
FT                   related methyltransferase; InterPro IPR013216; KEGG:
FT                   dsa:Desal_1057 methyltransferase type 11; PFAM:
FT                   Methyltransferase type 11; SPTR: Methyltransferase type 11;
FT                   PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35248"
FT                   /db_xref="GOA:E1RH24"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH24"
FT                   /protein_id="ADN35248.1"
FT                   /translation="MAGFEYKKSSKYTDYDTIYAQCSGPGGLQLAEFMAEKMGVAPGKK
FT                   LLDVGCNRGWQTCFLAKEYGIFAVGIDPWDDREEGDPMVEHLRRNSVLWGVEDSVLGIK
FT                   AGVPDTGFASKSFDYVYSTTALEMVRVSQGIEGYMEALKEIYRVLKPGGVFGVGEPMHL
FT                   GVPVPEDLEPYVSQDEYSWKVCFRSLDETTELIEEAGFRITESAYVPDAWDWWTAFARH
FT                   DPFCKEDPAGDPKTLEVDGGRWTSFGYVIGMKGE"
FT   gene            complement(481567..484518)
FT                   /locus_tag="Mpet_0475"
FT   CDS_pept        complement(481567..484518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4983 conserved hypothetical protein; KEGG:
FT                   mhu:Mhun_2956 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35249"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH25"
FT                   /protein_id="ADN35249.1"
FT                   /translation="MNPEKDAAATKKEIEKALSLLFPGGGVVELRAISDYNIHSGYFDN
FT                   SETLAEKAEKISRLSDVSGVYVTLNQVNPALLSRRANRIKMKLGRKDATTADADINRRK
FT                   WLPVDLDPVRPSGVSSTEEEHQAAITKAKKIARFLQTLGFPRPILADSGNGAHILYAVD
FT                   LPNDDDTTALVKDCLTTLDALFSDDSVTVDTANYNAARIWKLYGTVSRKGDDTPDRPHR
FT                   ISRIIDTPEETQIAGADTLRKLADLLPKDDEKPQAKSGDKKIDLSEWLSDHGIAVANER
FT                   PWQGGTLYVLEECPFSSAHKDGAFAIQFSNGAIYAGCHHNSCGGGKQRWSELRAMYEIK
FT                   SGRKERNAGRQNENTDKTEKTIRRGGNSFPEKTREKAAGILKNGDPVKFMLDTFSKFHV
FT                   GDETLAECLLMSIASQSVMNTNGLHVFVSGKSGKGKSVACRAMMKLVPEDYRLRGKVSD
FT                   KALYYNRDLKPETVFLFDDSHLSEDVCEILKSATTNFREKIEYQTLTTDRQLRIYNIPE
FT                   RCIWWVAKVESIGDDQVLNRMLTVWIDDTSEQDHRVLDNLKRCEAREIIVVGEPAEVGI
FT                   CRCIWTMLKEETTYVSIPFAERVQFSSSANRRNPAIFFDLVKCHALLFKEQRERFTPVD
FT                   EDGNSVENIAAIRATVDDFNAAVRIYAAINGDSGSQETKLTKNEADALDVICKMGWETV
FT                   TIKMLQDVMGISYHQARRIFQGYSRGDYSYSGLLEKCPAIGFIDATVSQEVDGYMVRRR
FT                   ENQFSFDYEIYQEWNRRTPVWLDEEENDNGPGDDDGGPGEDAPPESSSVCNFAQSLHTV
FT                   CKTNLQTKTGTEDGSFTENCTDDGDHLPVNSCLHKNPGAQEMNNRPIPIQKCVCTRGNF
FT                   ANIEKEYPDMPGNEETAADNNSLVCKNISQPVVNVCKVTNVPGDVSPVDARGSTLPLQG
FT                   VLDHRDFVRTEKELGKCDLCGMGKAVFSSDELKMSICERCFGRLLRERGNQSS"
FT   gene            complement(484515..484844)
FT                   /locus_tag="Mpet_0476"
FT   CDS_pept        complement(484515..484844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0476"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mem:Memar_1110 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35250"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH26"
FT                   /protein_id="ADN35250.1"
FT                   /translation="MKSHPMIKMKETNKRKTFVCCYKKSEKENGSPRNKPCTTTCCLRT
FT                   ANRNSTFRKISKTADPVPLYLIPQALSKEIRELGESIIGIDVRRTRGHNYSISMITSAK
FT                   GGRNP"
FT   gene            485379..485615
FT                   /locus_tag="Mpet_0477"
FT   CDS_pept        485379..485615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0477"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="COGs: COG1598 conserved hypothetical protein;
FT                   InterPro IPR005357; KEGG: pmo:Pmob_1308 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0150; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   protein family (UPF0150)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35251"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH27"
FT                   /protein_id="ADN35251.1"
FT                   /translation="MEKNYNFRIMLRKEPEGGYTAYVPSLPGCVTYGDTIDEAVDLVRE
FT                   AVELYIESLIEHNEPVPSDDEVLEYNLQIKAQA"
FT   gene            485612..485830
FT                   /locus_tag="Mpet_0478"
FT   CDS_pept        485612..485830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0478"
FT                   /product="YcfA family protein"
FT                   /note="COGs: COG1724 periplasmic or secreted lipoprotein;
FT                   InterPro IPR012933; KEGG: mem:Memar_1099 YcfA family
FT                   protein; PFAM: YcfA family protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: YcfA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35252"
FT                   /db_xref="GOA:E1RH28"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH28"
FT                   /protein_id="ADN35252.1"
FT                   /translation="MKLPNLNPDRVIKILESRGFVLDRVKGSHHIYIHPETRQRVVIPV
FT                   HKKDLPKGTLMEILRQAGIKKEDLEKE"
FT   gene            complement(485885..486736)
FT                   /locus_tag="Mpet_0479"
FT   CDS_pept        complement(485885..486736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbt:CLH_1062 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35253"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH29"
FT                   /protein_id="ADN35253.1"
FT                   /translation="MEDQIKTCFTAFVDILGYSEMIKNCNNDYDQLSEELAKIRTNLIE
FT                   PQNYLNESSSHLDGRNINFFSDSVFINVPLSSTSGRHFHDGRGEIGHSLDDLASYQFNL
FT                   AQNGYFIRGCATINFAYFDETIAFGPGILEVVKCEKTAKYPRICLTDSLIQIVRYYHDH
FT                   NWPGHENISSYICQDREGKYFLNYLQVINDYIDNCIDQIPEDVLEFPIYRNVPDSIELM
FT                   SKHKENIENNIQIASDASVKEKYIWLAKYHNFFCQKFLEEEDHLIIECDNGEFSLLYEE
FT                   DD"
FT   gene            486870..487289
FT                   /locus_tag="Mpet_0480"
FT   CDS_pept        486870..487289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0480"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="COGs: COG5485 ester cyclase; InterPro IPR009959;
FT                   KEGG: mrd:Mrad2831_5286 hypothetical protein; PFAM: protein
FT                   of unknown function DUF1486; SPTR: Putative uncharacterized
FT                   protein; PFAM: SnoaL-like polyketide cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35254"
FT                   /db_xref="GOA:E1RH30"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH30"
FT                   /protein_id="ADN35254.1"
FT                   /translation="MSDADANREKIKILFERVLNGGNDDYLDELIAADYIEHNPVPGQE
FT                   PGAEGVKIKLKDLRAAFPDIRFFPAETVAEGDLVAVRYHWEATHNGPFMGLAPTGKKVS
FT                   VNGMDFYRFKNGKLAEHWDCADMLGLMVQLKVFRV"
FT   gene            487343..487744
FT                   /locus_tag="Mpet_0481"
FT   CDS_pept        487343..487744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmx:MmarC6_0373 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35255"
FT                   /db_xref="GOA:E1RH31"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH31"
FT                   /protein_id="ADN35255.1"
FT                   /translation="MSLPKSRYSRAVLGGIVTWLVPFLVSLLFYNQNGLTIDVFLFKSI
FT                   MIVVGAIVGALMIVWYFRPETENFLRAGIIFGATALAVNWVLDLVVLCGMLGEDPLSWF
FT                   AGVGVRYLVIPVMSITVGYIAEEKAGVNP"
FT   gene            complement(487882..488130)
FT                   /locus_tag="Mpet_0482"
FT   CDS_pept        complement(487882..488130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpl:Mpal_0890 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35256"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH32"
FT                   /protein_id="ADN35256.1"
FT                   /translation="MSDIRSPGDKNSDERAKKRWICVHAGVSEREEIYARMSPESKKIS
FT                   TGTKWSEKGFIPSFEDTDEILMKAARRTYKNRSSKHR"
FT   gene            complement(488256..488837)
FT                   /locus_tag="Mpet_0483"
FT   CDS_pept        complement(488256..488837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0483"
FT                   /product="nitroreductase"
FT                   /note="COGs: COG0778 Nitroreductase; InterPro IPR000415;
FT                   KEGG: mem:Memar_1356 nitroreductase; PFAM: nitroreductase;
FT                   SPTR: Nitroreductase; PFAM: Nitroreductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35257"
FT                   /db_xref="GOA:E1RH33"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH33"
FT                   /protein_id="ADN35257.1"
FT                   /translation="MNDENEVTRAIMGRRSIRNYSDRVVPDELIEMLIDMGIHAPSALA
FT                   LFPWSFIVVKDRGMMKRVSEYVKPQILAELKNAKRVGMTQRYLDMVGEERFSIFYNAPS
FT                   LLLILGKNDAPISDVDCSLCAQNIMLAAHSLGLGTCWIGSARHLEKNPGLVEELGIPDE
FT                   YHLVASLVLGYPAENPEMPARPEPSVNWIK"
FT   gene            488940..489434
FT                   /locus_tag="Mpet_0484"
FT   CDS_pept        488940..489434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0484"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="InterPro IPR004360; KEGG: mla:Mlab_1725 hypothetical
FT                   protein; PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; SPTR: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; PFAM: Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35258"
FT                   /db_xref="GOA:E1RH34"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH34"
FT                   /protein_id="ADN35258.1"
FT                   /translation="MNENKPFSYHSTVLFVEDVERSKKFYTEVMGEEIELDLGKNVGFK
FT                   NGLAIWEGEYGRNVIFGDPSGGDYSSKKMLEIYYETEDMAETYEILKSAGVEFVHEVVE
FT                   QPWRQLTVRFLDPDGHMIEVGERMDVCIGRLAASGETPEMIAESTMMPAEIVNAILANR
FT                   D"
FT   gene            complement(489453..489776)
FT                   /locus_tag="Mpet_0485"
FT   CDS_pept        complement(489453..489776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbn:Mboo_0051 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35259"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH35"
FT                   /protein_id="ADN35259.1"
FT                   /translation="MKNKSLFFLIAISILLACIFISGCTSESSGTDTNTDTAQETGSGD
FT                   MGDMPAGDGNMTMPEGGNMTPPDGNMTMPAGDGNMTPPDGGMGGGEMPEGEMPDGTPPE
FT                   ESS"
FT   sig_peptide     complement(489699..489776)
FT                   /locus_tag="Mpet_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(489778..490443)
FT                   /locus_tag="Mpet_0486"
FT   CDS_pept        complement(489778..490443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2817 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35260"
FT                   /db_xref="GOA:E1RH36"
FT                   /db_xref="InterPro:IPR032531"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH36"
FT                   /protein_id="ADN35260.1"
FT                   /translation="MLSLSNTEVLFVLGFLINFIVAFIIVRLIYYPKKGEKNFIFTFLA
FT                   FNAVVYFIIGLFTSIELSIGAGFGLFALFSILRYRTETVPIREMTYLFIMVALPILNSI
FT                   LFDSGEYAKLLVIDVLMIVVVWILENGWGFKREVMQKEVVYEKIDLVKAGHENELIDDL
FT                   RIRTGLNVRDVDIRSIDFLRDVAQLKIYYTADPVEVMDSISENIEGNPENTGDKPKEE"
FT   gene            complement(490437..491342)
FT                   /locus_tag="Mpet_0487"
FT   CDS_pept        complement(490437..491342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0487"
FT                   /product="VTC domain protein"
FT                   /note="InterPro IPR018966; KEGG: mhu:Mhun_2816 hypothetical
FT                   protein; PFAM: VTC domain; SPTR: Putative uncharacterized
FT                   protein; PFAM: VTC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35261"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH37"
FT                   /protein_id="ADN35261.1"
FT                   /translation="MYTMTAQILQRGGHCGYDMNTRGSILMNRNDMDTYRKTDDEANIL
FT                   NGKISSAIEGYEQITLEELKNSDASLMSRKESKYLMTFDQCLELISGLDGDYMILDVDE
FT                   CKMSGYETEYYDDDSFTSYHQHHNGKANRYKLRARHYLSSDEYYIEVKEKKNTGVTVKN
FT                   RIEISESSEMSEEEYDRFLRMSFPFDYHEFHPVISVEYKRVTLVSKKMNERITLDFDLT
FT                   FKNSEKVYSFPAVVIGEVKMDKSITSSKALTYIRTLGIRERSFSKYCIGVSLIYSHLKH
FT                   NRFKPNLLFLSRISGSEAIC"
FT   gene            complement(491609..492358)
FT                   /locus_tag="Mpet_0488"
FT   CDS_pept        complement(491609..492358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0488"
FT                   /product="daunorubicin resistance ABC transporter, inner
FT                   membrane subunit B"
FT                   /note="InterProIPR013525:IPR013526:IPR000412:IPR010916:IPR
FT                   005942; KEGG: mhu:Mhun_1528 hypothetical protein; PFAM:
FT                   ABC-2 type transporter; SPTR: ABC-2; TIGRFAM: daunorubicin
FT                   resistance ABC transporter, inner membrane subunit B; PFAM:
FT                   ABC-2 type transporter; TIGRFAM: daunorubicin resistance
FT                   ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35262"
FT                   /db_xref="GOA:E1RH38"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR005942"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH38"
FT                   /protein_id="ADN35262.1"
FT                   /translation="MDVIYTIWLRSVKRYIRSKSRIVGSLGMPLFLLVFMGFGLNSVVV
FT                   IPNTGENYIVFLAPGIVAMGVLFTSIFAGIQIIWDKQFGFLKETLVAPVTRTEIMLGQT
FT                   FGGATTAIIQGTIILLISFLVGLSFPGITGLLIAAGFMILIGIAFTSLGIAIASRMEDM
FT                   NGFQLIMSFLIFPIFGLSGAMFPIDSLPSAFKSLTLFDPLTYGVEGIRYGLTGASQINP
FT                   LVCLIVLAAFSVAMILVGAYLFRKTSV"
FT   sig_peptide     complement(492233..492358)
FT                   /locus_tag="Mpet_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(492360..493343)
FT                   /locus_tag="Mpet_0489"
FT   CDS_pept        complement(492360..493343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0489"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro
FT                   IPR003439:IPR003593:IPR017871:IPR005894; KEGG:
FT                   mpl:Mpal_1460 daunorubicin resistance ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: Daunorubicin resistance ABC transporter
FT                   ATPase subunit; TIGRFAM: daunorubicin resistance ABC
FT                   transporter ATPase subunit; PFAM: ABC transporter; TIGRFAM:
FT                   daunorubicin resistance ABC transporter ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35263"
FT                   /db_xref="GOA:E1RH39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH39"
FT                   /protein_id="ADN35263.1"
FT                   /translation="MKAVTVENLTKKFGDFTAVDNISFDIDENEIFGLLGPNGAGKSTT
FT                   ISILATMADATSGKAIVNGHDTADDEDGVRKSIGIVFQDQSLDEELTAWENMDFHGRLY
FT                   RIPGETRDKRIKELLELVGLYERKDDLVKTFSGGMRRRLEIARGLLHRPKVLFLDEPTL
FT                   GLDPQTRNYLWEYIENLNREFGISVIITTHYMEEADRLCDRIGIIDQGRIIALDTPENL
FT                   KNSIGGDIITVKSPDFNEKISGLNQPWIENISCYDGFFTISLSNAEEHLTAVISALLDN
FT                   GIEISSVSVHKPTLEDVFLHYTGKTIRDAELDSKDHMRMMHNMRRH"
FT   gene            complement(493324..493860)
FT                   /locus_tag="Mpet_0490"
FT   CDS_pept        complement(493324..493860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0490"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="COGs: COG1695 transcriptional regulator protein;
FT                   InterPro IPR005149; KEGG: mbn:Mboo_1018 PadR-like family
FT                   transcriptional regulator; PFAM: transcriptional regulator
FT                   PadR family protein; SPTR: Transcriptional regulator,
FT                   PadR-like family; PFAM: Transcriptional regulator PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35264"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH40"
FT                   /protein_id="ADN35264.1"
FT                   /translation="MKEDDFEMPGFHRHMKFENGRSHRTGGIMKLYVLHSLTVEPKTGY
FT                   DLIKETSEKTDGIWVPSKGMLYPLLKKMEEGGLIVVSDTGSRSKNIYEITEDGRDLLER
FT                   MIKHRKEAGKRMHVFRRIMADIFGGNFGKAGEFLYEIHQVLDEIPPEKEEEAASITGKC
FT                   LEELKRLKGNESGNS"
FT   gene            complement(494102..494956)
FT                   /locus_tag="Mpet_0491"
FT   CDS_pept        complement(494102..494956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0491"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR006189; KEGG: mhu:Mhun_1294 signal
FT                   transduction histidine kinase-like; SPTR: Signal
FT                   transduction histidine kinase-like; PFAM: CHASE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35265"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH41"
FT                   /protein_id="ADN35265.1"
FT                   /translation="MKNACSILFVAFIAMAVLLSSGCTSTSEICPACEAAQTADDSDSD
FT                   SLMQSSLSELQGETYSGLDDLFSRARICAGSVGTADLQEKISEAASGKDYILTIAYIGS
FT                   DGVLNAISPESGGINVGDSLEYQDSVVRMNENKTPLLTDLFELKQGGYAAAVYYPVFSG
FT                   DSYQGFISITFVPETFFSKYAAELKEESGFEVMVLQTDGLILYDPDESEAGQQTFNNPA
FT                   YEDFPGIIEAAEKVVKDWSGSCEYSYYATGTKDEIVKKAFWSTVDTGGNEWRIMVIKNT
FT                   GEE"
FT   sig_peptide     complement(494891..494956)
FT                   /locus_tag="Mpet_0491"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(495017..495751)
FT                   /locus_tag="Mpet_0492"
FT   CDS_pept        complement(495017..495751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0492"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="COGs: COG0110 Acetyltransferase (isoleucine patch
FT                   superfamily); InterPro IPR001451; KEGG: chu:CHU_2756
FT                   hexapeptide repeat-containing protein acetyltransferase;
FT                   PFAM: transferase hexapeptide repeat containing protein;
FT                   SPTR: Putative O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35266"
FT                   /db_xref="GOA:E1RH42"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH42"
FT                   /protein_id="ADN35266.1"
FT                   /translation="MKRSVEDYLSDERFAFTGDALKDGFIGQYAVYHEGKKLDYELMKQ
FT                   HPGAIIFEGATISPDCILGENVVVHPGIGITSSEIGDYTYTWSGMHNTKVGKFCSIALH
FT                   NRICYGFHPSHTFVAMHPAFYSKWNPGALASFTDETIFQESLPVTIGNDVWIGAGCSIL
FT                   DGISIGDGAIIGAGAVVTKDVPDYAIVAGVPARVIKYRFEEEQIELLKDFRWWDRDIEW
FT                   ISEHAGLFTDIEKFCKYIGENY"
FT   gene            complement(495853..496518)
FT                   /locus_tag="Mpet_0493"
FT   CDS_pept        complement(495853..496518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mla:Mlab_1670 TPR repeat-containing protein;
FT                   SPTR: Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35267"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH43"
FT                   /protein_id="ADN35267.1"
FT                   /translation="MNAGILLPLSGEYEKEGNNILSGIMAETNESGSGIEYLVRDTGGD
FT                   PQGAPEIAVWTGSPVNGSEAVKTIREYSRDTKIILSESSANDLFTENAGSYAEGVYGIE
FT                   YPGGLSEDTMYEYYGRDTAMVLEEALAEGADTIPEIREELDSNIVTGYTGIKYFRDGSS
FT                   APPYYIIIKVENGTWVKDNEYSARLMAGISAVYGGALEFDPLLNDDHARLPLPHGIYD"
FT   gene            complement(496515..497696)
FT                   /locus_tag="Mpet_0494"
FT   CDS_pept        complement(496515..497696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0494"
FT                   /product="phosphate transporter"
FT                   /note="COGs: COG0306 Phosphate/sulphate permease; InterPro
FT                   IPR001204; KEGG: mem:Memar_1038 phosphate transporter;
FT                   PFAM: phosphate transporter; SPTR: Phosphate transporter;
FT                   PFAM: Phosphate transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35268"
FT                   /db_xref="GOA:E1RH44"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH44"
FT                   /protein_id="ADN35268.1"
FT                   /translation="MEAILFFVTIVFALFFNFVNGMNDAANSIATVIGTRTISPLHAVL
FT                   LAGSMNFIGPFIFGTAIAETIGVGILEGSVLNCYVLFSAAFTAVLWVLLSTRYGIPISS
FT                   SHALIGGMMGAAVAYAGLGSVLWPSPATIVSLAIYMAAGGICGAVILLIFAKIKKKEPG
FT                   IMPLVFFAAGACLVVPVLMVTGTLPISGILAVLIFIVVSPAIGFITAYTLIVVMALILN
FT                   RKVNRGRINSTMKPLHVLSAAALAISHGANDAQNAMGIITSVLLAAGVLSTFEVPLWVI
FT                   VSSCLAIAMGTMIGGCNVIDKMANKITHISQYQGFAASTGGAMILSLMTAFGVPVSTTH
FT                   AISGSIMGAGATRGRAAVNWSASREIVTAWFVTIPASMALSYVVMLLIMAVFG"
FT   gene            complement(497708..498337)
FT                   /locus_tag="Mpet_0495"
FT   CDS_pept        complement(497708..498337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1022 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35269"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH45"
FT                   /protein_id="ADN35269.1"
FT                   /translation="MTFFDWLVPKDDKFYDSISLMMEDVNSGINLLSSGVHEMSDLETM
FT                   HKEMREVEHRTEKRLQEIKELLETAFITPIDPVEINEMVNDIKSMIHLLVDASTHIYIF
FT                   GKDCETTPDMEEAVSLLKRSMAEMESAFAHLKEKGKPKDILPHYMTVKEIEKEVYLLNA
FT                   RATHRIYTNEPLNIIKYGKIYGRVCDLASLCEDRTGAIYDIAVRQV"
FT   gene            498379..499209
FT                   /locus_tag="Mpet_0496"
FT   CDS_pept        498379..499209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0496"
FT                   /product="DNA alkylation repair enzyme"
FT                   /note="COGs: COG4912 DNA alkylation repair protein;
FT                   InterPro IPR014825; KEGG: mem:Memar_0896 hypothetical
FT                   protein; PFAM: DNA alkylation repair enzyme; SPTR: Putative
FT                   uncharacterized protein; PFAM: DNA alkylation repair
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35270"
FT                   /db_xref="GOA:E1RH46"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH46"
FT                   /protein_id="ADN35270.1"
FT                   /translation="MINMIYGSYFFTCADPFSIYFIGSTLYPGREYKLSQKMLMEEIIG
FT                   RIREELRSFPEEDRNPGVQRFFKENIKCYGLKSAPVKKVIGSYWKEVKGLEKEEIFSLC
FT                   EELFSSGYTEEASIASVWAEKCSGRFEEGDIETFHRWIDSYIDNWAKCDVLCNHAVGDY
FT                   IMMFPHRIADLKEWAKSENRWLRRASAVTLIIPAKKGFFLDDIFEISDILLEDGEDMVQ
FT                   KGYGWMLKDASITHMDEVFAYVMKNKRRMPRTALRYAIERMPKEMKAEAMKKDW"
FT   gene            499602..500513
FT                   /locus_tag="Mpet_0497"
FT   CDS_pept        499602..500513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0497"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439:IPR003593:IPR017871;
FT                   KEGG: mem:Memar_1411 ABC transporter-related protein; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter-related protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35271"
FT                   /db_xref="GOA:E1RH47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH47"
FT                   /protein_id="ADN35271.1"
FT                   /translation="MIELKNLVKTYGDTNAVDNLSLRIEKGEVFGLLGPNGAGKSTTIL
FT                   MLCGLIQPTSGECLIDGIEVSKNPIEVKRRLGYMPEDVGFYPNLSAGRNLDFFAKLNDI
FT                   PDTERKERIEVLLRLVGLSGVEKKVGGYSKGMRQRLGIAKALVNDPDVVILDEPTANLD
FT                   PQGVSDYRRIIRNIAGSGKTILVSSHILSEVSKVCSRVGIMQKGKLVRDGSWDEITRNL
FT                   DLLGLPEIIINVETESGMPELIHEDIIRVDYFAERTKARISASKDIRADIGRTLYKSGT
FT                   FPKEICLDAVTTEDAVLSYYNG"
FT   gene            500513..501610
FT                   /locus_tag="Mpet_0498"
FT   CDS_pept        500513..501610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0498"
FT                   /product="ABC-type transport system involved in
FT                   multi-copper enzyme maturation permease component-like
FT                   protein"
FT                   /note="COGs: COG1277 ABC-type transport system involved in
FT                   multi-copper enzyme maturation permease component; KEGG:
FT                   mpl:Mpal_0757 ABC-type transport system involved in
FT                   multi-copper enzyme maturation permease component-like
FT                   protein; SPTR: ABC-type transport system involved in
FT                   multi-copper enzyme maturation permease component-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35272"
FT                   /db_xref="GOA:E1RH48"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH48"
FT                   /protein_id="ADN35272.1"
FT                   /translation="MMMRSKGFITIAGKEFSDHLYGRTFLLFLSIIIVVTIIGMAAGSV
FT                   DYNNQIDSYNEKLVVAGDDPVSGSYIFKPSVMTIFDGVGGLLVSLGAILGIAMGFNLVT
FT                   KEKESKSLKILLSNPIYRDEVINGKAAGGILALVVALFITLVISLGVMLLFGIVPSADD
FT                   IGFILLFGVAAFLMIFSYFAISMFMSTVAEDSGTSLVYTLIIFVFLSSLVPVFVWGSTI
FT                   DMIVGPAPEYPEGLYMDMQYDPVTGGVTGTVVTSASSEDSEEEMAAQDEAMDQYFEEMD
FT                   EYWSKKDVISGFVNLFSPTSNFKDITDTLTYSVGASSSFGSEDGESPGITDVLGKLLWN
FT                   FIALIAIPVVFFGGAYVRFMRLDVR"
FT   gene            501614..503056
FT                   /locus_tag="Mpet_0499"
FT   CDS_pept        501614..503056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1470 membrane protein; KEGG: mem:Memar_1340
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: NPCBM-associated, NEW3 domain of
FT                   alpha-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35273"
FT                   /db_xref="GOA:E1RH49"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018905"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH49"
FT                   /protein_id="ADN35273.1"
FT                   /translation="MGGEYGLGPAFLLITACLLMFFIPQAVSAGTDSTANTEISCTFPG
FT                   RIVEAGETVTFDLKVKCNLGTNPRMLEFDTFKGEDDWKYHFYSGEKEIDRILMTEGEVI
FT                   PITFEIDTAGDTAVGIYPVRVRIDDARLWIYITIDKSHAGESGVLKLAVVDEQGENIDG
FT                   ALVKIVDERRHTVIKEVLTSRDGLRTEVDQGDYILYVGSEGYNDAHKDDVSIKCGYTTD
FT                   AGTIMLEKENYGLTIDVKSPLVTASIGNKPVYEAALTNVGKSDDVFGLDVNGLPGGWYG
FT                   RYKLTADSTESISKLYIDSGSEKTVFLEIIPPYSVEKGDYFFNMSVESSEKDYSEPLEA
FT                   RITGSSNMVIFSEKYRYDMTKGDSVEIPVTISNKGKGDALTNVRTEVSAPEGWNVRVTP
FT                   SSVPSIQPGEKATVILTVSPPANIAASDYKISVKVVSDQQEETDEIRIVINESSLVGIL
FT                   GLLLLLGACGGVYYFFRKHERR"
FT   sig_peptide     501614..501700
FT                   /locus_tag="Mpet_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            503176..503760
FT                   /locus_tag="Mpet_0500"
FT   CDS_pept        503176..503760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0500"
FT                   /product="Protein of unknown function DUF2178,
FT                   transmembrane"
FT                   /note="InterPro IPR019235; KEGG: mem:Memar_1409
FT                   hypothetical protein; PFAM: Protein of unknown function
FT                   DUF2178, transmembrane; SPTR: Putative uncharacterized
FT                   protein; PFAM: Predicted membrane protein (DUF2178)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35274"
FT                   /db_xref="GOA:E1RH50"
FT                   /db_xref="InterPro:IPR019235"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH50"
FT                   /protein_id="ADN35274.1"
FT                   /translation="MKIQTYFLCLICIAIAVAVLVILGFRSANPLVPAIVILAGIAAVY
FT                   FCRRRVTDVVTDDLSEMINGKAAVKTLEVVIIALVIIFLGTTTYFSYGGHGSGTHVGDD
FT                   GSTVVSFMQFYPPGNVIYIDNYSLEDPPGLTGNDLLGLERLFVEGHKVRDFPYVAGAAL
FT                   GFAAVVLAAVFAAFSLYYSRKYGCNEDEEQD"
FT   sig_peptide     503176..503259
FT                   /locus_tag="Mpet_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            503729..503980
FT                   /locus_tag="Mpet_0501"
FT   CDS_pept        503729..503980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0501"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="COGs: COG1476 transcriptional regulator protein;
FT                   InterPro IPR001387; KEGG: mem:Memar_1410 XRE family
FT                   transcriptional regulator; PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein; SPTR:
FT                   Transcriptional regulator, XRE family; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35275"
FT                   /db_xref="GOA:E1RH51"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH51"
FT                   /protein_id="ADN35275.1"
FT                   /translation="MGVTKMKNRIKVYRAMHDMTQEELAEKIRVTRKTINSIERGKYNP
FT                   SIEVAFKIAKIFRVPVEKIFFFEDETPEDVIEDPSSPD"
FT   gene            504048..504659
FT                   /locus_tag="Mpet_0502"
FT   CDS_pept        504048..504659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0502"
FT                   /product="Protein of unknown function DUF2115"
FT                   /note="COGs: COG4066 conserved hypothetical protein;
FT                   InterPro IPR019215; KEGG: mpl:Mpal_1923 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2115; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterized
FT                   protein conserved in archaea (DUF2115)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35276"
FT                   /db_xref="InterPro:IPR019215"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH52"
FT                   /protein_id="ADN35276.1"
FT                   /translation="MQVQPPDTKRNPPEERIEDAVAKLRAAGTKGELAEAIASEIIKYS
FT                   LYELQVIGGKVRQEIDKLPSPYREKVRPFFQQQLFDVYNRLMSMQRSGGFSRMKGKIDD
FT                   PALFAEFLDAVPAGCLKDPEHSGTDFNFGDPIKSLFYYLLCCFTMFVMDEPGHPVGTPF
FT                   PGGFIVEKRADGYYCPIRDKEEEVPFSICNFCPAKQMEGV"
FT   gene            complement(504672..505901)
FT                   /locus_tag="Mpet_0503"
FT   CDS_pept        complement(504672..505901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0503"
FT                   /product="peptidase C1A papain"
FT                   /note="InterPro IPR000668:IPR000169; KEGG: mhu:Mhun_3130
FT                   peptidase S8/S53 subtilisin kexin sedolisin; PFAM:
FT                   peptidase C1A papain; SMART: peptidase C1A papain; SPTR:
FT                   Peptidase S8 and S53, subtilisin, kexin, sedolisin; PFAM:
FT                   Papain family cysteine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35277"
FT                   /db_xref="GOA:E1RH53"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH53"
FT                   /protein_id="ADN35277.1"
FT                   /translation="MKYIGHIILVLCILSLILSYFVITSPQEDSDTCSSCSDPYGMYID
FT                   GVSLTTMLSGDPDVFRSVDPLDIEKAVDISIYEMADSIRLADLNDDVVTTDQSSDKTDE
FT                   VSTDFQTKIVLALQEANRNTPRYSAREYSGSTPDSYSLLEKFAYVPEEWDQTGGSPEHC
FT                   GNCWVWADTGALQMELYRQKGISDPLSVQYFTSAYHNGTGIWACYGGSPVWFADFYNIT
FT                   GRAVPLGNMNATFADSAVRSENGESTSVPASDIQVDPYYPIEEMHAEMIATNALYEERD
FT                   ISNETAIDSIKSALISGSAVVIIYTPDDWDPFMDFWENETESAVFTPESTQGATGNDGG
FT                   HAMLILGYNDTDPDERYWTVLNSWGAPDNRPDGTFRLDMDLDYSMQNPDGVNSFEFYVQ
FT                   NVTWGDFTSL"
FT   sig_peptide     complement(505818..505901)
FT                   /locus_tag="Mpet_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            506424..507860
FT                   /locus_tag="Mpet_0504"
FT   CDS_pept        506424..507860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0504"
FT                   /product="cation transporter"
FT                   /note="COGs: COG0168 Trk-type K+ transport systems membrane
FT                   components; InterPro IPR003445; KEGG: mmh:Mmah_1577 cation
FT                   transporter; PFAM: cation transporter; SPTR: Trk potassium
FT                   uptake system protein, transmembrane component H; PFAM:
FT                   Cation transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35278"
FT                   /db_xref="GOA:E1RH54"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH54"
FT                   /protein_id="ADN35278.1"
FT                   /translation="MYELVSPVDLSVVLKYTGRLMMAIAVVLAVPMAMAIVFMESYTAA
FT                   VYGLTAVLVACGGFILVKVLPDGELRWKESLVIAAIIFPFIALLNAFPFALSTGMSLSD
FT                   SFFEAVSGITTTGLSVAPADVGPVFLFARSWLQWVGGIGIVILVLSVLVQPGTSAFRLF
FT                   SANVGENRIGPNVMATARILVKIYLIITAIAFILLLLSGMPVFDSICHALSAVSTGGFS
FT                   TGSDSIASFPGFFIPLVIAAGFLMGAIDFGLYTRISGGLSGLKEIISDIQFRYFVVVLV
FT                   AGFLFLLFTMSEGMSFTEALSASAFQAASALSTAGFSTVDIGALSDSSKAVLTVLMWIG
FT                   GCTGSTAGGIKIMRLVILFAIVYLVFIRFFLPKEALTPLKVGGDVVEPDQIYHILTYVI
FT                   LYVLVILVSGFIFMLHGIGTGDAFFEVSSALGTVGLSTGITGSGMPDLMKWTLIVDMVL
FT                   GRIEIIPVCILLFPRTWIRR"
FT   sig_peptide     506424..506528
FT                   /locus_tag="Mpet_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            507845..508549
FT                   /locus_tag="Mpet_0505"
FT   CDS_pept        507845..508549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0505"
FT                   /product="TrkA-N domain protein"
FT                   /note="COGs: COG0569 K+ transport systems NAD-binding
FT                   component; InterPro IPR003148:IPR006037:IPR006036; KEGG:
FT                   mmh:Mmah_1578 TrkA-N domain protein; PFAM: TrkA-N domain
FT                   protein; TrkA-C domain protein; SPTR: Potassium uptake
FT                   protein TrkA; PFAM: TrkA-N domain; TrkA-C domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35279"
FT                   /db_xref="GOA:E1RH55"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH55"
FT                   /protein_id="ADN35279.1"
FT                   /translation="MDQEVNGLRVIIVGATALGMDLAEVLIKNNCEVIFIVREEKLAKD
FT                   LSESLDCTVINAEGTRPDILEKAEIDKADAIVACTSHDQDNILVGVIAKGYKVPEIIIM
FT                   TEDVQFMTVAKKLGFHHVVNPPQATAAIVYHTLRGIDTIELSTMMRGDVRFISVFAPLK
FT                   FAGMKLSGIALPKRSAFIGVYRDDLFMAYTEDPEIKEGDEVLIVSRLDEVNGIYEMFRP
FT                   VEEEEKKEQPSQ"
FT   gene            508652..510190
FT                   /locus_tag="Mpet_0506"
FT   CDS_pept        508652..510190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0506"
FT                   /product="AMP phosphorylase"
FT                   /EC_number="2.4.2.4"
FT                   /note="COGs: COG0213 Thymidine phosphorylase;
FT                   InterProIPR017459:IPR000312:IPR013102:IPR013466:IPR
FT                   000053:IPR017872:IPR017713; KEGG: mem:Memar_0551 thymidine
FT                   phosphorylase; PFAM: Pyrimidine nucleoside phosphorylase
FT                   domain; glycosyl transferase family 3; Glycosyl
FT                   transferase, family 3-like; PRIAM: Thymidine phosphorylase;
FT                   SPTR: Putative thymidine phosphorylase; TIGRFAM: AMP
FT                   phosphorylase; thymidine phosphorylase; PFAM: Pyrimidine
FT                   nucleoside phosphorylase C-terminal domain; Glycosyl
FT                   transferase family, a/b domain; Molydopterin dinucleotide
FT                   binding domain; Glycosyl transferase family, helical bundle
FT                   domain; TIGRFAM: AMP phosphorylase; putative thymidine
FT                   phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35280"
FT                   /db_xref="GOA:E1RH56"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013466"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017713"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH56"
FT                   /protein_id="ADN35280.1"
FT                   /translation="MVKLTAKILDIDYRGVLINRIDARKIGVLDGDRVQVINENTGIFV
FT                   QAFVSTTEKLIEEGSVGILYLTNKKLNASDGDPFEVRFADRPASIEYIRKKMDGGKLTA
FT                   DETKAIVMDIVDDILSPGEISAYITGSYIQGLDMDEVEHLTRAMVATGERLNFTSHPIV
FT                   DKHSIGGVPGNKISLLVVPIIAAAGLKIPKTSSRAITGAGGTADLMEVLAPVTFSAEEV
FT                   QKMTEKAGGVIVWGGATNIAPADDKIIIYEYPFKIDARGQMLASVMAKKYAAGADLVVI
FT                   DIPVGRNAKVATVEEGRKLAREFIDLGDRLGMKVECAITYGESPIGHAIGVNLEVREAL
FT                   SILEGSEIPGSLLQKSVSIAGIALEMSGKAQNGEGPMVARELLKNGKALDKMRQIIEIQ
FT                   GGDPNVKAADISPGENSFNVMAPENGYVVEMNNKALITIARSAGAPNDRGAGIYLHKKK
FT                   GQRVEKGEPIFTIYADRGWRLDKAVETARQLMPIIVEGMLIDRVPSGYWRPETE"
FT   gene            complement(510207..511136)
FT                   /locus_tag="Mpet_0507"
FT   CDS_pept        complement(510207..511136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0507"
FT                   /product="translation initiation factor, aIF-2BII family"
FT                   /EC_number="5.3.1.23"
FT                   /note="COGs: COG1184 Translation initiation factor 2B
FT                   subunit eIF-2B alpha/beta/delta family; InterPro
FT                   IPR000649:IPR011559:IPR005250; KEGG: mbn:Mboo_2432
FT                   translation initiation factor IF-2B subunit delta; PFAM:
FT                   initiation factor 2B related; PRIAM:
FT                   S-methyl-5-thioribose-1-phosphate isomerase; SPTR: Putative
FT                   translation initiation factor, aIF-2BII family; TIGRFAM:
FT                   translation initiation factor, aIF-2BII family; eIF-2B
FT                   alpha/beta/delta-related uncharacterized protein; PFAM:
FT                   Initiation factor 2 subunit family; TIGRFAM: eIF-2B
FT                   alpha/beta/delta-related uncharacterized proteins;
FT                   ribose-1,5-bisphosphate isomerase, e2b2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35281"
FT                   /db_xref="GOA:E1RH57"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005250"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH57"
FT                   /protein_id="ADN35281.1"
FT                   /translation="MSLEDTAEKIRTMEIRGAALIARAAVEALCKYGEGLGELALPEFK
FT                   EELERAAGVLLATRPTAVSLPNAVNIVMKDVRNADTIAEAREALRLSSIEFIRDSKEAL
FT                   SKIAEIGARHIPENAVLMTHCNSQAAIGCIIEAHRQGKIREVYATEVRPRNQGLLTIRA
FT                   LNDAGIKTNFIVDSAARFYMKKVDLFITGTDAVTVNGAVVNKIGTSQIALAAREARVPM
FT                   MVAAETFKFAPKTIAGDLIKIEERDSSEVLAKKIAGDLDNVTIKNPAFDVTPADFVDLI
FT                   ITEKGAIPPEMAYIIIRDYLGWEIGDFR"
FT   gene            complement(511229..512434)
FT                   /locus_tag="Mpet_0508"
FT   CDS_pept        complement(511229..512434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0508"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR002491; KEGG:
FT                   mmz:MmarC7_1467 periplasmic binding protein; PFAM:
FT                   periplasmic binding protein; SPTR: Periplasmic binding
FT                   protein; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35282"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH58"
FT                   /protein_id="ADN35282.1"
FT                   /translation="MSKRKHSLILLLILLAVIIAASGCTEDASNSYESDLDNTSGYKTV
FT                   TDMRGVEVTVPEDPQRVVAMSRSLIDTAMYIFGKEDRIVGCSVEKTATDQGTYVYNGTD
FT                   YTVNTWIGQILNPELLNTTNVGGFAGPYGEPNAETIAKLDPDLFILRDMGEQDENTEKF
FT                   IEQLDSMGIPVVVLKYPSCYENPDAETIYDEVMLLGEVFGEEEEAERIVETMRSRIDFI
FT                   TERTGNISEKEKVNVLYFGAPTNAFDKGGVGYAFGNGTIELALMEKIVNANNVYKDNGR
FT                   NLISSEQLISLDPDKIILSTWSGYHPPRQLYDEELYGNIQEMRAIKSGEVYSLAATPCK
FT                   SERLEFPVNVMIAAKAIYPERFEDIDLETWIREYIVELYGTDEETTNDIMNAFMLEYLE
FT                   IT"
FT   sig_peptide     complement(512366..512434)
FT                   /locus_tag="Mpet_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(512440..513672)
FT                   /locus_tag="Mpet_0509"
FT   CDS_pept        complement(512440..513672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0509"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR002491; KEGG:
FT                   mmz:MmarC7_1470 periplasmic binding protein; PFAM:
FT                   periplasmic binding protein; SPTR: Solute-binding protein
FT                   of iron ABC transporter; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35283"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH59"
FT                   /protein_id="ADN35283.1"
FT                   /translation="MKNLLIIAMILAAAAIMCTGCTGQSDQTNVSGEDEKFRTVTDSRG
FT                   EEVRVPADIERVVTISDGLVEGVMTVLGEEDKIVGVGSSCIQRNFNYTYPTTTDESYEY
FT                   KDGMNPVTYLNKDWIMNITRVGESGSAINYETLAGLNPDVVIIRVGSCTMRSMDDEGVQ
FT                   KSIRTIESLRIPVVVLKAHPCFDEPDLTTISDEIEIIGSVFGKEEEASELADYLESLVD
FT                   MVYERTKDIPESEKPTVLIFGASPKSRQSGGAGNVKGTDTIESYFIEEIVHAKNAYQEE
FT                   GNSVIVSAEQVLAINPDVIVLGTSSGYHPPEELYSAPYYQDLQEISAVKNRKVSSFPWE
FT                   PCNCAKRLEYPIDIMVIAKAAYPGLFEDIDLEDWLIDFYMNVYVVDQATAKELLSAQWM
FT                   EWCVDKCIACG"
FT   sig_peptide     complement(513604..513672)
FT                   /locus_tag="Mpet_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(513728..514489)
FT                   /locus_tag="Mpet_0510"
FT   CDS_pept        complement(513728..514489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0510"
FT                   /product="CODH nickel-insertion accessory protein"
FT                   /note="COGs: COG3640 CO dehydrogenase maturation factor;
FT                   InterPro IPR014433; KEGG: mba:Mbar_A1885 CODH
FT                   nickel-insertion accessory protein; SPTR: CODH
FT                   nickel-insertion accessory protein; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35284"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH60"
FT                   /protein_id="ADN35284.1"
FT                   /translation="MKIVICGKGGSGKSTIVALMAHEYARQNKNVLVVDTDESNMGLHS
FT                   ILGNDSPADLMKYFGGKPAITEKIMAAMPDPSKVKIFENTWTFEDLPKEYVSYKNGIRL
FT                   IAIGKIHDFGEGCACPMGILANQFLENLSLGEDDIVITDTEAGIEHFGRGIDRHADFIL
FT                   LVLDPSNESIRLAEKISGMTKDLEIPLYFILNKTDPEISSIIKEQIVDPSLLIGEIPGD
FT                   DEILKRGLRGVEMDIRNPYIEKITESLSSGI"
FT   gene            complement(514510..515358)
FT                   /locus_tag="Mpet_0511"
FT   CDS_pept        complement(514510..515358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0511"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2265 SAM-dependent methyltransferase
FT                   related to tRNA (uracil-5-)-methyltransferase; InterPro
FT                   IPR013216; KEGG: mmz:MmarC7_1469 methyltransferase type 11;
FT                   PFAM: Methyltransferase type 11; SPTR: Methyltransferase
FT                   type 11; PFAM: Ribosomal RNA adenine dimethylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35285"
FT                   /db_xref="GOA:E1RH61"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH61"
FT                   /protein_id="ADN35285.1"
FT                   /translation="MKTYYGIDWNEIWNEVNGANIRCEAFGECATIWQSREEARGFLNN
FT                   AIKNPERVQFILEKLPLSPGLRVLDIGSGPGTIAVPVAGQVDHVTGVEPSPGMADVMEE
FT                   YAAEKGVDNLDIIRKRWEEIDLSTDLKGPYDLVFASYSLGMQDLNKSIRMMCDISSKWV
FT                   YIFWISGTPSWEKGLIKLWPVLHGKEFCCTPQADIIYNVLYSMGIYPNIRVKEIESCNR
FT                   FPDLISAVSQMSQVYNIENNEQEGILKDYLSEKLVKDKDGFALRETNTSTVIWWETGKT
FT                   V"
FT   gene            complement(515355..516581)
FT                   /locus_tag="Mpet_0512"
FT   CDS_pept        complement(515355..516581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0512"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR002491; KEGG:
FT                   mmz:MmarC7_1470 periplasmic binding protein; PFAM:
FT                   periplasmic binding protein; SPTR: Periplasmic binding
FT                   protein; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35286"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH62"
FT                   /protein_id="ADN35286.1"
FT                   /translation="MTFRNLALILVISFIIIFSAGCVSEDQSADGNESDVSDSGYRTVV
FT                   DSRGVKVEIPEDIERVVTVSDGLVEGVMYSLGVEDTIVGLGSTCIAIEKTYSYPVDDGT
FT                   CVNGSGGSSIQLVLDPDINEVPLVMEYGVAMNYETLSSLDPDVVIIRLGSCSIQEKDSE
FT                   TAQKTIETIESLGIPLVVLYSPNCYSDQSLSHISDEIEIIGDVFGKKEQAAEIAEYLES
FT                   QVGLVEERTSDIAENEKPSVLMFGLSATHRAQGGAGVVQGLGTTESYMIEDVVNAKNAY
FT                   RSEGTWQIVNTEQVLALDPDVIVLCTAWGYHPMDELYNATYYSALSELTAVKNERVMSL
FT                   PFMPCNCDKRLEYPIEVMVIAKAAYPELFEDIELEEWLIEFYMNVYGVDQATAEELLYA
FT                   QWMEWCIEE"
FT   sig_peptide     complement(516510..516581)
FT                   /locus_tag="Mpet_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(516670..517908)
FT                   /locus_tag="Mpet_0513"
FT   CDS_pept        complement(516670..517908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0513"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR002491; KEGG:
FT                   mmz:MmarC7_1470 periplasmic binding protein; PFAM:
FT                   periplasmic binding protein; SPTR: Periplasmic binding
FT                   protein; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35287"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH63"
FT                   /protein_id="ADN35287.1"
FT                   /translation="MKTQTFRNLALILVISFIIIFSAGCVSEDQSADGNESDVSDSGYR
FT                   TVVDSRGVEVEIPEDIERVVTVSDGLVEGVMYSLGVEDTLVGLGSACIGKDWTYSYPTD
FT                   DGTYVNGSGGCNVMQVLYPEIKELPLAMQSGAAMNYETLSSLDPDVVIIRLGSCSIQEK
FT                   DSETAQKTIETIESLGIPLVVLYSPDCYSDPSLSQISDEIEIIGDIFGKKEQAAEIAEY
FT                   LESQVKLIEERTSDIAEDDKPSVLMFGLSATHRAQGGAGVVQGLGTTESYMIEDVVNAK
FT                   NAYQVDAGSFQLVNTEQVLALDPDVIVLCTAWGYHPPGELYNATYYSALRELTAVKNGR
FT                   VMSLPWTPCNCAKRLEYPIDVMVIAKAAYPELFEDIELEEWLIDFYMNVYGVDQATAEE
FT                   LLYAQWMEWCIEE"
FT   sig_peptide     complement(517828..517908)
FT                   /locus_tag="Mpet_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(517905..518744)
FT                   /locus_tag="Mpet_0514"
FT   CDS_pept        complement(517905..518744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0514"
FT                   /product="Methyltransferase type 11"
FT                   /note="InterPro IPR013216; KEGG: mmz:MmarC7_1471
FT                   methyltransferase type 11; PFAM: Methyltransferase type 11;
FT                   SPTR: Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35288"
FT                   /db_xref="GOA:E1RH64"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH64"
FT                   /protein_id="ADN35288.1"
FT                   /translation="MDCNYIDWNEVWKQKYEKNIKSRGIGDCASIWDSKEKAKGFLARS
FT                   KNNPDRIREFVDLLGPDKECSILDVGAGPGTLAVPLAELSGHVTAVEPSKGMADVMADY
FT                   AAERGVSNLDIVRKKWEDVDPGMDLKESYDIVFASHSLGMPDIRESIEKMISVASGKIC
FT                   LFWFAGITAWEQRMTDLWPDLYKKEYSCGPKADVLFNLLYSMNIYPNVEPGLFTSDSVY
FT                   PDYDTAFHDFKEQFKLSTPEQESILNNYLKKSLVKENCHFLFPGVTTGIRLWWEVER"
FT   gene            complement(518763..519608)
FT                   /locus_tag="Mpet_0515"
FT   CDS_pept        complement(518763..519608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0515"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems ATPase components; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: mmz:MmarC7_1472 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35289"
FT                   /db_xref="GOA:E1RH65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH65"
FT                   /protein_id="ADN35289.1"
FT                   /translation="MLRVEDLHFSYDDLPVLSGISFSVNEGELCGLFGPNGCGKTTLFK
FT                   CCLKFLKYHKGSVHMAGRDTAQQSIEELAKIVSYVPQEHKPPFPYLVREVVLMGRTPHL
FT                   GGFFGVRRKDKEIALDALKKLEISDLAERPYNQLSGGQRQMVLMARAIAQDTPMMFLDE
FT                   PTSALDFQNQMKIWETMKDIAAEGKTILACSHDPNHVSWFCDRVIVVSSRGIVADGSPE
FT                   ATISEEVLDLIYSDTCAVRKNGDVQIVMPRSIVKKSDASVQLSNDDEEYSQCEIIETKA
FT                   "
FT   gene            complement(519615..520694)
FT                   /locus_tag="Mpet_0516"
FT   CDS_pept        complement(519615..520694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0516"
FT                   /product="transport system permease protein"
FT                   /note="COGs: COG0609 ABC-type Fe3+-siderophore transport
FT                   system permease component; InterPro IPR000522; KEGG:
FT                   mmz:MmarC7_1473 transport system permease protein; PFAM:
FT                   transport system permease protein; SPTR: Transport system
FT                   permease protein; PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35290"
FT                   /db_xref="GOA:E1RH66"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH66"
FT                   /protein_id="ADN35290.1"
FT                   /translation="MTETTRLKRLLEHFDYIDVPEFSDYRKIIMLLVIAGILFITAITA
FT                   VVLGAYDITIPQVYRTILTHITFGDVSNLEKLHNTIVWDIRVPRILLTIFVGGALAIAG
FT                   AVFQGVFRNPLVEPYILGVSSGAAFGAALGIVFPAIFFSTQLSAFAFGSLAVVLAYMLA
FT                   RVRGETPIVTLILAGVIIGSIFSALVSLLKYISDDTALREIVFWLMGGFYYATWSDIWM
FT                   IAPVVIIGFLILWALGWKLNILSMGDDEARTLGVNPEKYKFIVVAIATAITAFAVSLVG
FT                   IIAWVGLMMPHASRMILGPDNRFIIPASFMMGGIYLIICDTLARTVTSAEIPVGIIASI
FT                   LGAPYLCYLLRNKGRVIFG"
FT   gene            complement(521219..521947)
FT                   /locus_tag="Mpet_0517"
FT   CDS_pept        complement(521219..521947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0517"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="InterPro IPR005358; KEGG: mla:Mlab_1546 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0153; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   protein family (UPF0153)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35291"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH67"
FT                   /protein_id="ADN35291.1"
FT                   /translation="MASVNSINGIEKKTGELEEELRLLEEYDIEKLCSVIKEVGFSCTL
FT                   CGKCCTKEFNGHVFLLDEDTERVRRIRQDAIVPAPFFELCDQNGNFYVSGYALKTKENG
FT                   DCIFLKENRCTIYNDRFSICRIYPYMLHREYGEDGKLAWRQISGLNEHGEYNADIPDED
FT                   CLKAAKETITYEKAFLEKEIEFYSCALRHFTESGLKPVRKVYDQKIRAFQSGEPVTVFV
FT                   HFRGKFEMHSIIKDDYTIRL"
FT   gene            complement(522469..523575)
FT                   /locus_tag="Mpet_0518"
FT   CDS_pept        complement(522469..523575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0518"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="COGs: COG1509 Lysine 2 3-aminomutase; InterPro
FT                   IPR007197:IPR003739; KEGG: kol:Kole_1669 lysine
FT                   2,3-aminomutase YodO family protein; PFAM: Radical SAM
FT                   domain protein; PRIAM: Lysine 2,3-aminomutase; SPTR: Lysine
FT                   2,3-aminomutase YodO family protein; TIGRFAM: lysine
FT                   2,3-aminomutase YodO family protein; TIGRFAM: KamA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35292"
FT                   /db_xref="GOA:E1RH68"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1RH68"
FT                   /protein_id="ADN35292.1"
FT                   /translation="MYSPKYITDITKVPGLSEEEKKKLAEVQEMFAFRSNEYYLSLIDW
FT                   NDPADPIRKLVIPDPAELEEWGRLDASGEARYIVAPGMEHKYDQTALVLVSDMCAGFCR
FT                   YCFRKRIFMNGGAREVARDIDVDLEYISSHPEITNVLLSGGDPLFLSTNRLEKIIAWIR
FT                   EIDHVQIVRIGTKVPAYNPYRILNDTKLPEIIRRYSTEEKKIYIVTQFNHPRELTEQAI
FT                   KAVNILQESGAVFANQTPLLHGINDNPETMAELSRKLSFIGITPYYVFQCRPTLGNRDF
FT                   VVPVEDGYFILEQAKMNCSGLAKRFTFAMSHVCGKIAVVGIDEERTYLKYHQSAEWEDI
FT                   GKFMSFRRDPDALWFDDYKSPLSEKKVV"
FT   gene            complement(523666..524622)
FT                   /locus_tag="Mpet_0519"
FT   CDS_pept        complement(523666..524622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0519"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG0820 Fe-S-cluster redox enzyme; InterPro
FT                   IPR007197:IPR004383; KEGG: tma:TM0136 hypothetical protein;
FT                   PFAM: Radical SAM domain protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35293"
FT                   /db_xref="GOA:E1RHI4"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHI4"
FT                   /protein_id="ADN35293.1"
FT                   /translation="MKIIAETGNEDIARVYIAEIDDGRRIEFVESVQPPFTRSQKWVLI
FT                   VSSLFGCPVGCRMCDAGGGYRGKLSAEDIYAQIDYLVRKRFPGGYVDADKFKIQFARMG
FT                   EPAFNPAVLDVLESLKTRYKAPGLIPSLSTIAPEGCDEFFKRLLEIKNEHYRERFQLQF
FT                   SIHTTDMVTREWLIPVKTWSFEEMKEYGELFFDKGGRKITLNFALGDNMKIDTGVLRKY
FT                   FPPDVFLVKITPVNPTFRALENGINSFIRPGENETNCPDQERCPVKNLRDAGYDVIMSI
FT                   GEPEENLIGSNCGQYLEAYERSGTELKGGYEYEIHRK"
FT   gene            complement(524619..525503)
FT                   /locus_tag="Mpet_0520"
FT   CDS_pept        complement(524619..525503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0520"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG0492 Thioredoxin reductase; InterPro
FT                   IPR013027:IPR000103; KEGG: tnp:Tnap_0764 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; SPTR: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35294"
FT                   /db_xref="GOA:E1RHI5"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHI5"
FT                   /protein_id="ADN35294.1"
FT                   /translation="MGPEKIAVIGAGPAGMAAAIQLSRYGIRPVVFEKDKTGGLLPNAR
FT                   LVENYPGFPDGIRGTELSALFRKQFEKGSPELKTETVLQLDLDGKEFLIRTETETYRFD
FT                   RVIIASGTVPKRPGCNIDTDALACTYHDISRIRDLSGKTVAIAGSGDAAFDYALSLCTK
FT                   NRILILNRGEKTKCLDILFKEVAGSPNITYIENTNISGIVKTQNGIKLQCVSGGSNIEI
FT                   DADIMIFATGRDPCTEFISSEISGRTSELTGSGLLFFTGDVRNGILRQTAISVGDGVAA
FT                   AMRICKGPGGDAD"
FT   gene            complement(525493..526155)
FT                   /locus_tag="Mpet_0521"
FT   CDS_pept        complement(525493..526155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0521"
FT                   /product="isochorismatase hydrolase"
FT                   /note="COGs: COG1535 Isochorismate hydrolase; InterPro
FT                   IPR000868; KEGG: taf:THA_248 isochorismatase-related
FT                   protein; PFAM: isochorismatase hydrolase; SPTR:
FT                   Isochorismatase-related protein; PFAM: Isochorismatase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35295"
FT                   /db_xref="GOA:E1RHI6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHI6"
FT                   /protein_id="ADN35295.1"
FT                   /translation="MKECYFRPENIDKESMLMMEKIAGMNRKREQVFHPEASALLIIDM
FT                   QNYFTDPDSHAYVPSSAAVIPRIKKLAEAFAAKKRPVISTRHINTLIDAGMMEEWWGEL
FT                   LTETSTRSELNNDLDLPFSVRIRKSQYDAFYATELDLILRQNNVTDLVITGVMTHLCCE
FT                   TTARTAFVHGYRVFFPADGTATYNTDLHMASLMNLSHGFASITGTGNISEIMENYGP"
FT   gene            526384..528291
FT                   /locus_tag="Mpet_0522"
FT   CDS_pept        526384..528291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0522"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG1181 D-alanine-D-alanine ligase and related
FT                   ATP-grasp protein; InterPro
FT                   IPR013216:IPR011095:IPR011761:IPR000169; KEGG:
FT                   tnp:Tnap_0342 methyltransferase type 11; PFAM:
FT                   Methyltransferase type 11; D-alanine--D-alanine ligase
FT                   domain protein; SPTR: Methyltransferase type 11; PFAM:
FT                   Methyltransferase domain; D-ala D-ala ligase C-terminus;
FT                   TIGRFAM: D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35296"
FT                   /db_xref="GOA:E1RHI7"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHI7"
FT                   /protein_id="ADN35296.1"
FT                   /translation="MNKGNGKQHITTVLGPVESLESYVKADWWREIFNANYLRTDGDVV
FT                   DDESITKAEVDFFLSLLNPGFHDSILDLCCGQGRHSLELAGRGYSKICGLDRSHYLITR
FT                   ARKQARNDGLSVGFREGDARKLSYSADSFDFILLPGNSFGYFETNEDDKRVLKEAFRVL
FT                   RPGGRILLDITDGDYLRENFVPRSWEWIDQNHFVCRERSLSSDDERLITREVITHVKNG
FT                   VMADQFYAERLYNSGDIRAMLNECGYTSIEFHDPIITDSRRNQDLGMMARRLIITASVE
FT                   KEWTPKKKVSRKKKKVAVVLGDPRLKDVIKPSCVFDEDDYRTIGRLKEALSELGDYEFT
FT                   YFDNHSSMLSWLRQSGSKADFIFNLCDEGFLNDPRKELHVPAALEILSIPYTGGNPQCL
FT                   AYCYDKSLVRGIAKELDIPVPRAFVINPEDSSFIEFPIHFPVIVKPNFGDSSFGITQNS
FT                   VCRDISELQDAILRLKSFSGDCGTVLVEEFLTGGDISVGIIGNLPDKYEVLPVIEEDYS
FT                   SLPRGYPKICGYEAKWDPESPYAGITSIPADLSEEARRFLVASCLKLFGRLGCRDYARF
FT                   DWRIDSNGTPRLLEVNPNPGWCWDGHLAKMAGIAEITYAEMLGMILKAAEDRIFGDNGK
FT                   "
FT   gene            528477..528893
FT                   /locus_tag="Mpet_0523"
FT   CDS_pept        528477..528893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0523"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COGs: COG1846 Transcriptional regulators; InterPro
FT                   IPR000835; KEGG: mhu:Mhun_1347 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; SPTR: Transcriptional regulator, MarR family;
FT                   PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35297"
FT                   /db_xref="GOA:E1RHI8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHI8"
FT                   /protein_id="ADN35297.1"
FT                   /translation="MGLTEELNDNLVEFFDRFASWENSVIQQSSLTVAGAHAIEKLGHN
FT                   GSMSMKDLSKSLGVTTGTITVTVDRLEKGGYAVRDRSENDRRSYIIRLTEKGKEAFSDH
FT                   HSHHMSLSDEIASILSEDEVKNFVGILEKINKTI"
FT   gene            528905..530920
FT                   /locus_tag="Mpet_0524"
FT   CDS_pept        528905..530920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0524"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="COGs: COG2217 Cation transport ATPase;
FT                   InterProIPR008250:IPR005834:IPR001757:IPR001366:IPR
FT                   018303:IPR006416; KEGG: mhu:Mhun_1348 heavy metal
FT                   translocating P-type ATPase; PFAM: E1-E2 ATPase-associated
FT                   domain protein; Haloacid dehalogenase domain protein
FT                   hydrolase; SPTR: Heavy metal translocating P-type ATPase;
FT                   TIGRFAM: heavy metal translocating P-type ATPase; ATPase,
FT                   P-type (transporting), HAD superfamily, subfamily IC; PFAM:
FT                   E1-E2 ATPase; haloacid dehalogenase-like hydrolase;
FT                   TIGRFAM: heavy metal translocating P-type ATPase; ATPase,
FT                   P-type (transporting), HAD superfamily, subfamily IC; heavy
FT                   metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35298"
FT                   /db_xref="GOA:E1RHI9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHI9"
FT                   /protein_id="ADN35298.1"
FT                   /translation="MGVKEENHSDSVSCGEICHCGHDHGHNHEHDHRHEEHECGSACAC
FT                   GHDHGHDGGNTKEYAILAVGGILLAAAIAGEYLGLSNIAVSSFAVLSALCTGIPIILSS
FT                   VRGLLGGRQNVCELAGIAIIAAILIGEYVTAAEVGFILSLGEIAEEYAYGKSRRDIEKI
FT                   AALHPEHGLVERGGDFVEVPVDEIEVGDTVLIRPGDVVPSDGIVTSGATSVDESCLTGE
FT                   SVPVEKATGDPVYSGSINIDGAVRIEVTKRSRDSTYSKIVDFVREAEKRRPPTYPFIEK
FT                   FASIYTPLTLVVTALTWIFTGSIERAITILIVACPCALLLSTPSAVISAIGAGARRGIL
FT                   VKSGLYLEEAGKIDSVIFDKTGTLTSGRMRVKTTRAFGGFDEELMINLAAAAECGSGHP
FT                   VAAAILDFAAEKGLNGNGCLQVKSLPGLGVKGESDSGNILVGNIRFMDESGVSVPAPVS
FT                   AEIEELSASGISPVLLSLDNEIIGLLGVEDSVRDESPSVVRDLKENGITNVSIVSGDRK
FT                   EIAESVADKCGIERENVYSGIAPGEKRSIVDRFQKDGKKVCFVGDGVNDAPALAQANAG
FT                   VAIGSRKNTVAIETSHVVLLGEGLGQILSFIRLGRKTVRTIKINVAFALSFTFILMAMA
FT                   FLGIVHPAAGALGHQAAVLLVLANSALIPLGMDRWN"
FT   gene            531011..531337
FT                   /locus_tag="Mpet_0525"
FT   CDS_pept        531011..531337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbn:Mboo_2284 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35299"
FT                   /db_xref="GOA:E1RHJ0"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHJ0"
FT                   /protein_id="ADN35299.1"
FT                   /translation="MTRYFPGDVVLASMNLSGPGGRKIRPAVVLGECERNSFLLCPVTS
FT                   RQPDSGDFLPLGLDDFEKGGLDLFDESYVLVSEAGPVDGRYILGKKGKLVSSRFKEISG
FT                   RVRF"
FT   gene            531334..531831
FT                   /locus_tag="Mpet_0526"
FT   CDS_pept        531334..531831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0526"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1670 Acetyltransferase including
FT                   N-acetylase of ribosomal protein; InterPro IPR000182; KEGG:
FT                   mla:Mlab_0614 hypothetical protein; PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35300"
FT                   /db_xref="GOA:E1RHJ1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHJ1"
FT                   /protein_id="ADN35300.1"
FT                   /translation="MTRDINFREVTEDDLEVMNSLVNDEDIARFLDLIPPVPMSKTIDF
FT                   WEFAVSRGAMWWAILIGNDVIGSVGVVPEDPDGKMSHVGVMFVYLLKDHRGLGYGGIAI
FT                   DHALFMADVSGLKRIECLAAEGNSRAIALYLEKGFLIEGVKKGAFYDGEKYSDVIMMAK
FT                   IL"
FT   gene            complement(531978..532205)
FT                   /locus_tag="Mpet_0527"
FT   CDS_pept        complement(531978..532205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pag:PLES_21891 putative MoxR protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35301"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHJ2"
FT                   /protein_id="ADN35301.1"
FT                   /translation="MYLLATYRHGRGRVEGRGKPLPLPFYIIVEDFSNGNPCASSLREH
FT                   ALTSGLCALAITRPGRYPFGWPRPGESKLR"
FT   gene            complement(532252..533874)
FT                   /locus_tag="Mpet_0528"
FT   CDS_pept        complement(532252..533874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0528"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xce:Xcel_2652 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35302"
FT                   /db_xref="GOA:E1RHJ3"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHJ3"
FT                   /protein_id="ADN35302.1"
FT                   /translation="MKLRQPKEHYKDEENPPVIPGPLSITVSIGLIVTEDEFEAQNVNR
FT                   GIKETILSLEKILSSTPHIYKFVLPYHPGGEHVLLESLLADPVWNRLRNPEVELLNLPG
FT                   ELSLPYRLFEGPVKYKLSVVNRDESTPGYDPVYDSVIDNSSLVLLVGEWEPGAEKYRKG
FT                   SIFSLAKRYGRTIVAINQYSGHSYRLYHDDRIFESYTNLNTYNMEKINDRTFLAKQRQY
FT                   INLLENESDQAGLPSDILKDIYASLIPNYTRAKILARKYRRNYTSTGTLVSVLAALAVL
FT                   TITMQTLFFTDFPELVWLEVAEIALIIGLMTASRYGDYHRKWIDYNFLAERIRAAFFIS
FT                   IVCVTCKSPDTPPHMSLANRPNDWMVMAFMSIVSLRPTAYCRLNIPFEPMKKFLKAAWI
FT                   NNSLAYYERESKRSKQRYSLLAVTGELIFVIVLILAIIHATGIGHWEIHTDITVSHLLA
FT                   YLTITLPAVGSAIAAVRVQREYLRNSERYVHIVRHLTAIRNEMKHVSTMNELCSLLDEM
FT                   NEITLREQQDWRIIFRFRKIEAI"
FT   gene            complement(534035..534718)
FT                   /locus_tag="Mpet_0529"
FT   CDS_pept        complement(534035..534718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0529"
FT                   /product="DOMON domain protein"
FT                   /note="InterPro IPR013050:IPR005018; KEGG: ton:TON_0876
FT                   DOMON; PFAM: DOMON domain protein; SMART: DOMON domain
FT                   protein; SPTR: DOMON; PFAM: DOMON domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35303"
FT                   /db_xref="InterPro:IPR005018"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHJ4"
FT                   /protein_id="ADN35303.1"
FT                   /translation="MKRKILMIAVFAILILASGCTTEDDSLEVICIMPEETTTTQTFSP
FT                   TETTSLTPEVTESPEDNVTRWKADGIIEEGEYENNVTGFRDLFYIYWTSDNETLYMGIK
FT                   GKTSGYVSVGFNPVAMMKNADIILGGNIGTGGSLYIYDMYSPTASGPMRSDTVLGGEFN
FT                   IEESAGTEKAAFQTLEFSRKLDTGDKYDSVLEKGKSAKVIWFLSKYDDPLSNQISAEGS
FT                   VDIII"
FT   sig_peptide     complement(534653..534718)
FT                   /locus_tag="Mpet_0529"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            535190..537436
FT                   /locus_tag="Mpet_0530"
FT   CDS_pept        535190..537436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0530"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089:IPR004090:IPR000014; KEGG: mhu:Mhun_1406
FT                   methyl-accepting chemotaxis sensory transducer with PAS/Pac
FT                   sensor; PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; PAS domain containing
FT                   protein; SPTR: Methyl-accepting chemotaxis sensory
FT                   transducer with Pas/Pac sensor; TIGRFAM: PAS sensor
FT                   protein; PFAM: Methyl-accepting chemotaxis protein (MCP)
FT                   signaling domain; PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35304"
FT                   /db_xref="GOA:E1RHJ5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHJ5"
FT                   /protein_id="ADN35304.1"
FT                   /translation="MAMDYLEKKITEYINGNRGVSIDESSAGEEYSEICSLVNRLMKGM
FT                   KDAEDRAEYYYESILRTPTSSFIMDGSLNIVIVNDDFVELTGYSREKLTSFCLDDFYRE
FT                   FSLQKISGEGSKYALEKKRRASGLFHMTFKGDRRIIQIAIDPEFDKNGKPLEVIVTLND
FT                   VTDIENQRAWYESILDAVPYPIHVTDNDMKWTFLNKAFEALLIENNEIKDRESSYGMPC
FT                   STANANICNTENCGIRQLRTTGQNETFFDWHGTECKQTTAPVLDADGNTMGYVETVQDL
FT                   TDIIRPQRYLEQELANVAADLECIASGRPEDLKLKVGEADEKTMEIREKFLEVTASVSS
FT                   VNDTVRRLTDDIMNLVGAGEEGKLEFRADVSKYEGAYREIVENMNNLLEAVALPLKEGM
FT                   RVCSLYSNADFTARFSDNVYVSGDFLEFRTAVDNIGVSVSELVSASVEVTKMIVSNSNE
FT                   VSKGADEVAKAAEGVAGTSQKTAEQTKELLRNIENVNRQIADLSASNEEIASTSQEVFN
FT                   ATNDVVVIGKEANSLGIDANNKMNNVKAIAEASVGEIQDLTEKVKEVSKVVKLINDIAG
FT                   QINLLALNAAIEAARAGEHGRGFAVVAGEVKNLAGEARAATDSIENVVSMVQSSSEKTA
FT                   NAITAANDEIVEGVESVNKAIEALNTIIKNAEQVSNDIGEITKAIEDQANISNNIVREM
FT                   DSGTEQTKDVQRDAEELAALAEEASASIEEIGSAMHEVNSYVQKLESANSRFKY"
FT   gene            537449..537916
FT                   /locus_tag="Mpet_0531"
FT   CDS_pept        537449..537916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0531"
FT                   /product="CheW protein"
FT                   /note="COGs: COG0835 Chemotaxis signal transduction
FT                   protein; InterPro IPR002545; KEGG: mem:Memar_1544 putative
FT                   CheW protein; PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; SPTR: CheW protein; PFAM: CheW-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35305"
FT                   /db_xref="GOA:E1RHJ6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHJ6"
FT                   /protein_id="ADN35305.1"
FT                   /translation="MSAFKDVVQFEISGVQYALDIQIAREIVEMIPITPVPRAPDHIAG
FT                   IINLRGEITNILNLNQLMGLSASGTAENGKIIVLVPEAANGSNLGLIVDDVRSVLQVSE
FT                   EDIDMMDGSVSKEAYVKGIIKSGRDNSGNKALIIWIDISKILSDILTDKNN"
FT   gene            complement(538384..539622)
FT                   /locus_tag="Mpet_0532"
FT   CDS_pept        complement(538384..539622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0532"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="COGs: COG1167 Transcriptional regulators containing
FT                   a DNA-binding HTH domain and an aminotransferase domain
FT                   (MocR family) and their eukaryotic orthologs; InterPro
FT                   IPR004839; KEGG: mem:Memar_0861 GntR family transcriptional
FT                   regulator; PFAM: aminotransferase class I and II; SPTR:
FT                   Aromatic amino acid aminotransferase; PFAM:
FT                   Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35306"
FT                   /db_xref="GOA:E1RHJ7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHJ7"
FT                   /protein_id="ADN35306.1"
FT                   /translation="MYSFSEITDPVAEKVKETWIKYLSMEYRFAARMRNAPESFLKKLF
FT                   AVSSDPSIISFAGGLPDSNLIDVAGIRDSAACVLEEEGREALQYTTTEGYLPLREFIAE
FT                   RYRNRLGIAASAENIRIVNGSQQCLDIIGKIFIEKNDRIGIERPGYLGAIEAFSLYEPV
FT                   IKSVDMNESGPDMEGFEKLVTDDKIKFFYGIPNFQNPTGRSYSYDARKQIGGIVGGSGS
FT                   LFYEDDAFGELAFDLKPRMPVNKFAPENVITSGSFSKTVAPGMRIGWIMAPPEIISVFD
FT                   TAKQAADLHSNFLCQKILDQYLRNNDYDAHLKRVVSVYHDNCMLMQDLLDDMTVAGITH
FT                   TSPEGGMFMTAGLPKGLSSMKLFEDGIKNGVAVLPGIPFYAGDGGDDMIRLNFSNTSEE
FT                   NIKEGMNRLSEIL"
FT   gene            539634..540749
FT                   /locus_tag="Mpet_0533"
FT   CDS_pept        539634..540749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0533"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; InterPro IPR004839; KEGG: deh:cbdb_A553
FT                   aminotransferase, classes I and II; PFAM: aminotransferase
FT                   class I and II; SPTR: Aminotransferase, classes I and II;
FT                   PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35307"
FT                   /db_xref="GOA:E1RHJ8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHJ8"
FT                   /protein_id="ADN35307.1"
FT                   /translation="MRPENFLLEKYMGIYEFSAPYLLCTSDCETITVSELLSFEEGAEA
FT                   GLMDLRLGYTEARGGKELREEISKLYGNISPDDVITFAGAEEGIFIFMNAVLSKGDHVI
FT                   VQFPAYQSLYEIAEAIGCEVTLWEMKEEDGWKPDPDFLVKNIRKNTKAIIINSPHNPTG
FT                   FNFPKEDFGTIVNAARENDLYLFSDEVYRQLEFDPGTRLPAAADLYEKGFSLGVMSKAF
FT                   GLAGLRSGWIAARNRETLEKISSLKDYTTICSSAPSEYLAAVALRHSDRLVDRSLGIIK
FT                   KNLEILDPFMERHSDLFEWVRPVAASIGFVKLKNGVSATDFCKKVVDETGVLLMPSTVY
FT                   GFGDSHFRVGFGREDMEQCLEKFEIFLKNNY"
FT   gene            complement(540772..541413)
FT                   /locus_tag="Mpet_0534"
FT   CDS_pept        complement(540772..541413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0534"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="COGs: COG2860 membrane protein; InterPro IPR005115;
FT                   KEGG: pne:Pnec_1555 protein of unknown function UPF0126;
FT                   PFAM: protein of unknown function UPF0126; SPTR: Putative
FT                   uncharacterized protein; PFAM: UPF0126 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35308"
FT                   /db_xref="GOA:E1RHJ9"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHJ9"
FT                   /protein_id="ADN35308.1"
FT                   /translation="MDVLPFSTWYYIMGIIGIAVFSITGVLAGAKRGMDLFGIVIIGVI
FT                   TALGGGTLRDLILDVPVFWINNNLYIAIALSAAIVAFFLAKPLWCSYRALLILDGLGVA
FT                   LFNVQAIDKTLAYGFSPVVAVIMGIITGITGGIIRDLLAGNPNLILKQELYATPILIGG
FT                   VFYIIWLTYLPDVPFGSLLAILIVFLIRFAAIKWDLRYPHWLLFPGKDDS"
FT   sig_peptide     complement(541330..541413)
FT                   /locus_tag="Mpet_0534"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            541550..541867
FT                   /locus_tag="Mpet_0535"
FT   CDS_pept        541550..541867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0535"
FT                   /product="translation initiation factor eIF-1A"
FT                   /note="COGs: COG0361 Translation initiation factor 1
FT                   (IF-1); InterPro IPR001253:IPR006196:IPR018104; KEGG:
FT                   mla:Mlab_1550 translation initiation factor IF-1A; PFAM: S1
FT                   IF1 family protein; SMART: initiation factor 1A (eIF-1A);
FT                   SPTR: Translation initiation factor 1A; TIGRFAM:
FT                   translation initiation factor eIF-1A; PFAM: Translation
FT                   initiation factor 1A / IF-1; TIGRFAM: eukaryotic/archaeal
FT                   initiation factor 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35309"
FT                   /db_xref="GOA:E1RHK0"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHK0"
FT                   /protein_id="ADN35309.1"
FT                   /translation="MKFLASYNNNQNNEEAIIRVKLPNSKKREMFATADLMLGANHIRV
FT                   RCYDGVTRTGRIKGKIKKRVWIREGDVLIVVPWDFQDEKCDIIYRYTKPQVEWLRRNNY
FT                   L"
FT   gene            complement(541880..542659)
FT                   /locus_tag="Mpet_0536"
FT   CDS_pept        complement(541880..542659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_2377 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35310"
FT                   /db_xref="GOA:E1RHK1"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHK1"
FT                   /protein_id="ADN35310.1"
FT                   /translation="MIKEYGSEGVSEAIGFLIMFTIVLTGIAMVSLVGYPMLIQTQISS
FT                   DERNMEQAMISVQNDMKIMTFSNVPFRDSTIKVSGGGLTAIDNTSFGQSFTISDDTGTG
FT                   FSVEYKPGAIQYESDDGTAVLTLMNGAVVRREKFQSGSVMIAEPRWFYDSDEKTLVIYM
FT                   TVLNADREYYERGIGTIKMSMKTQPVIIDTPYGTPATVTVTYAYDPDDDYSVAWRNYLT
FT                   GDSIVEGGFAETGSGKYSLSGVERLVVKEYDIKIENM"
FT   gene            complement(542662..543144)
FT                   /locus_tag="Mpet_0537"
FT   CDS_pept        complement(542662..543144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mem:Memar_2376 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35311"
FT                   /db_xref="GOA:E1RHK2"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHK2"
FT                   /protein_id="ADN35311.1"
FT                   /translation="MRPTGCRKKNEQGIYCVREKDEAVSTVLEYMNITAVLIVMMILLT
FT                   LLINSVIIEDSSEKLKYHAFVDIGNGVSTRIVDLYVIAPSNGRVVTSLDLPDDVANGDY
FT                   TVKMDPSATGAAQQIIVTDGNVKSMISIAGIGATKAVIGNTTGKGLNRIIYDSGGV"
FT   gene            complement(543113..543496)
FT                   /locus_tag="Mpet_0538"
FT   CDS_pept        complement(543113..543496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_2375 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35312"
FT                   /db_xref="GOA:E1RHK3"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHK3"
FT                   /protein_id="ADN35312.1"
FT                   /translation="MERMNEDGQWIVLMGFIVSVSLFVLAIIINQSVTVGQTTSEAVLE
FT                   FPKNEITEVREAVIDIAKKDPSSYTLRQDLYALSMDRMNAVVYYDITNEKYQDIYYKYD
FT                   EILIRFNNGVTKYNETYWLPEKK"
FT   gene            complement(543484..544032)
FT                   /locus_tag="Mpet_0539"
FT   CDS_pept        complement(543484..544032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0539"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbn:Mboo_0131 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35313"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHK4"
FT                   /protein_id="ADN35313.1"
FT                   /translation="MVITDDCGQLFTIEGLVAGLIMLSAAFIVADSITIYTPGDAHIPD
FT                   MQLEQLGSDALLMLDTANNYSEKSTLRTVAEMVDNGGTDAYDAGILFKDAFENELARGS
FT                   GTSEIVDSIRYNATVYYRDIGSNSVMSYALGDSGTGESQPIGSEVSRQPEISTGRLIMV
FT                   EDSSGLDRIYRVEVRLWRE"
FT   gene            complement(544026..545096)
FT                   /locus_tag="Mpet_0540"
FT   CDS_pept        complement(544026..545096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_2373 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35314"
FT                   /db_xref="GOA:E1RHK5"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHK5"
FT                   /protein_id="ADN35314.1"
FT                   /translation="MRTFRENGILSVDFLIGFSIFLLALIMILTMIPGIFAGLDSAQID
FT                   YDAVAYRTSVILCEDPGWPADDDSWEFMDTYHKDDIDRLGLAVSSTSPNILSKEKTKAF
FT                   FNENENLVLDNDDYHSKVLFGEIPYYYNISLKIENDPVNTTGNIAPDSGYGYMRRLVKL
FT                   KEPGYAKIDSGEFNKTNTTITTLNPYVYTGFSVIFDYAEIQNKSIDEAYRLMLQSEPAS
FT                   ITIYNFSSSLNRSDISNVTLTKIRFINDDKEVPIVYSTYHNDTYRFFIDGIQHTMQGPF
FT                   EISDADELKFEIYPPLMFSDEIGTSLSVVFNMTYEFVPDESMKHYYISGDIPYIYNKDY
FT                   MTEPYLKDGVMEVMIW"
FT   sig_peptide     complement(544986..545096)
FT                   /locus_tag="Mpet_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(545104..545742)
FT                   /locus_tag="Mpet_0541"
FT   CDS_pept        complement(545104..545742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mem:Memar_2372 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35315"
FT                   /db_xref="GOA:E1RHK6"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHK6"
FT                   /protein_id="ADN35315.1"
FT                   /translation="MVVKKNRLILIIAIILILAAICGYVFINGIDPGNYLKESGFFSQS
FT                   PEQEQTDSSTDITTAGQNTESVPGLNQRSFETAVNKLYLLDSEGILDLNNVTYHQILGR
FT                   FVDVNGLADSWMIGAGKDGKSILLVYNSGEWNQQEWPGTLSEETIDLENITLPEDLYKQ
FT                   NSEIIRKTLEPANASYSDLSLKDGIYTISIQNTNNIAELKFKADSGEMI"
FT   sig_peptide     complement(545656..545742)
FT                   /locus_tag="Mpet_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(545874..547133)
FT                   /locus_tag="Mpet_0542"
FT   CDS_pept        complement(545874..547133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4198 conserved hypothetical protein;
FT                   InterPro IPR008323; KEGG: mem:Memar_2369 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR:
FT                   Uncharacterised conserved protein UCP033563; PFAM: Protein
FT                   of unknown function (DUF1015)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35316"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHK7"
FT                   /protein_id="ADN35316.1"
FT                   /translation="MVKIFSFPAIRPAAKDAGEIACVPYDVISREEAMEWIDKHPDSFM
FT                   KVIRSDAVLPDLPAESEEVYAEAKKNLEHMIKNRLLVRDDKPGIYLYRVKQGGNIYTGF
FT                   VANVSVDDYIENKIKKHELTRYDKEIDRTTHIDVTNTNTGLVVLLYRDPGDVFHYIESL
FT                   IPEEQPDSIVKMDSGIVHEVFRISDDAKIKKIIRMFEGIDSLYIADGHHRAKSSVNVAL
FT                   KRRENRTSTDESERFMAVIFSENRVKIHGYSRLVTDLGKYTPESFMKALGEKFEIKKYG
FT                   EIDDTVFRIPPLKESGIPRHVFHMYLKGEWYEITCPLENPGDTIGSLDVSVLQKKVMED
FT                   MLGINDPRGDPRLQYLGGARPLSDLEMRVNSGEFAVALSMQPVKVETVLKIADEGNIMP
FT                   PKSTWFEPKLLSGLTLHTLD"
FT   gene            547258..547710
FT                   /locus_tag="Mpet_0543"
FT   CDS_pept        547258..547710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0543"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="COGs: COG0456 Acetyltransferase; InterPro
FT                   IPR000182:IPR006464; KEGG: mem:Memar_2368
FT                   ribosomal-protein-alanine acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase; SPTR: Acetyltransferase,
FT                   GNAT family; TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: Acetyltransferase (GNAT) family;
FT                   TIGRFAM: ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35317"
FT                   /db_xref="GOA:E1RHK8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHK8"
FT                   /protein_id="ADN35317.1"
FT                   /translation="MNNVEITRAGLPDISRIVEIENNLFPDPWNEQAFRDVLFYYSNTF
FT                   FTLKSDGDIVGFITAGIEDTSEVLYGHIMNLAVVPEYRKMGLGGRLMQRMEYEFIVSGA
FT                   EGSQLEVRVSNGDAISFYKKLGYSQVMVIGGYYNNGEDAVLMMKWF"
FT   gene            complement(547744..548334)
FT                   /locus_tag="Mpet_0544"
FT   CDS_pept        complement(547744..548334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0544"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1670 Acetyltransferase including
FT                   N-acetylase of ribosomal protein; InterPro IPR000182; KEGG:
FT                   mem:Memar_1306 GCN5-related N-acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase; SPTR: GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35318"
FT                   /db_xref="GOA:E1RHK9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHK9"
FT                   /protein_id="ADN35318.1"
FT                   /translation="MKTNWSGEKIAVSYVRPEDLEDICKMLAKETVCRWLFFGPNTPEA
FT                   TTAYFTPLIESVSAALYEGRIPESPVFTISSKKNREFAGQCAILPVEFSPGSYLIGYQI
FT                   DDKYHGKGFGTEACEFLVYYAFTFTDAYRLNGDTAEGNTASRKIMERCGFEFEGRRKKY
FT                   WHAHGDYYDQLLYGLLKEALDESFQEYLRLKWG"
FT   gene            complement(548383..550668)
FT                   /locus_tag="Mpet_0545"
FT   CDS_pept        complement(548383..550668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpl:Mpal_2176 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35319"
FT                   /db_xref="GOA:E1RHL0"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHL0"
FT                   /protein_id="ADN35319.1"
FT                   /translation="MSDQLNGFIQKMRSGGWAVILLPVFLVFVAFIDVLTTNGAFCGDY
FT                   HDTLHSTLEWMIYTKSGFTLWDNLWITGFPEFASPGSDFYYPLIIPLLNITQDIYAQIN
FT                   YSTILHLIVAFITTYLLLGLITEKKNLKMAFSLLYIFSALMLSRVYVGHEIIVFSLAWI
FT                   PLLYYSFAKIIYKSEYTVTNVLIFSLTSALFFFTGVVYLFALSFILMGIFALYFIITKK
FT                   TDIKAIIILAISTVIFLLLTAIKSIPMISISDKLLRVDGTVDPLGGGGSLESNLASFIF
FT                   GTPINKGYAYTGLQYGIQESTVLIGAVSVFLIIIALVYGKRIITIPSFCAILFALIYAD
FT                   GGKVILSFIHLLPILSSFRCPGRVFCSLMPLLIFLSLYGLIIVCQKLKENNSFKLDTEQ
FT                   KKSLLYGTLILIVLKVIELPYEEIPTLEAVVAIVMVFGFIALLYSEKITKDTLIYIFSA
FT                   ALLINIIFIIIDFTITPLVIAKTAVVAIVVLALIIYGIKDKLTDKKSRIVPVLVGVNII
FT                   ICCMAGLTFIVPSNPELDTSAAIDVIDEFQNLPTDNIQKWAYTSGWAYQNMDYTYHFMN
FT                   NGIHSMSAYWAYYLDTMLPVFYTIGDKQYSTADYIVDTQYASSGELSITNYTTMVKGVP
FT                   ITVPENILPNVFILRSEELIPVEIEEFTPDEVIATGDFETGDIAVLKTAYYDGWKVNGE
FT                   AAASVGNMVGAEIKSDTGKVTFKFQPASFTTGLILSIIGVISIILLIVFRKKFENFVAV
FT                   PEKKKNKK"
FT   gene            complement(550913..552118)
FT                   /locus_tag="Mpet_0546"
FT   CDS_pept        complement(550913..552118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0546"
FT                   /product="3-hydroxy-3-methylglutaryl Coenzyme A reductase"
FT                   /EC_number="1.1.1.34"
FT                   /note="COGs: COG1257 Hydroxymethylglutaryl-CoA reductase;
FT                   InterPro IPR002202:IPR004554; KEGG: mem:Memar_2365
FT                   3-hydroxy-3-methylglutaryl coenzyme A reductase; PFAM:
FT                   hydroxymethylglutaryl-coenzyme A reductase; SPTR:
FT                   3-hydroxy-3-methylglutaryl-coenzyme A reductase; TIGRFAM:
FT                   3-hydroxy-3-methylglutaryl Coenzyme A reductase; PFAM:
FT                   Hydroxymethylglutaryl-coenzyme A reductase; TIGRFAM:
FT                   3-hydroxy-3-methylglutaryl Coenzyme A reductase,
FT                   hydroxymethylglutaryl-CoA reductase (NADP)"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35320"
FT                   /db_xref="GOA:E1RHL1"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHL1"
FT                   /protein_id="ADN35320.1"
FT                   /translation="MNDYLSGLKEGRLKLHSLEKEMPPKDAVAVRRAFIEMETGKKLDK
FT                   IGDFTINIDRAAEKNCENMIGAVQVPVGIAGKLKVNGEYADDEFYIPLATTEGALVASI
FT                   NRGCKAITLAGGADVRIQRDGMTRAPVFAAKNVVQATEAARWIEENITLLKEIAETTTS
FT                   HGKLLDIRCFVTGTNLHARIEFFTGDAMGMNMVTIASEKVAAKIQEETGVVLVALSGNM
FT                   CTDKKPSAINVILGRGKTVVAGVFLPDDLIKSTFKTDSKTMAEVNMKKNLVGSARAVSL
FT                   GFNSHAANVIAAVFLACGQDPAHVVEGSNTITTVEQAEGGVYVSVTLPSLQVGTVGGGT
FT                   GLDTQREALNLLGCAGGGETSGANSRKFAEIIAAAVLAGELSLIGALGAGHLARAHKQL
FT                   GR"
FT   gene            552163..553077
FT                   /locus_tag="Mpet_0547"
FT   CDS_pept        552163..553077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0547"
FT                   /product="protein of unknown function Met10"
FT                   /note="COGs: COG2520 methyltransferase; InterPro IPR003402;
FT                   KEGG: mem:Memar_2364 protein of unknown function Met10;
FT                   PFAM: protein of unknown function Met10; SPTR:
FT                   Methyltransferase; PFAM: Met-10+ like-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35321"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR040601"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHL2"
FT                   /protein_id="ADN35321.1"
FT                   /translation="MARESRCIKVLKKEGERTRRKLAEDGFLDNSLKPFSDEGFLYIPV
FT                   TGEIPGAVSEIFEERDASEPLPRHELIGGIAIMQDCDRGEARRLLDSRPVIHTVLHSEG
FT                   PVTGEYRTKDYIFLAGKETTKADYTEYGQRFLIDLSAAYFSARLANERQRIAAMMKDGE
FT                   RLLDMFAGVGPFAITLSGKCSVVYANDINPAAVSLLADNIRLNKKKNILPVLADARRLG
FT                   SIFPPENFDRIIMNLPMKSSEFLDTAFRLCKSGGMIHFYTLQSQPGEMEEELEKYECEK
FT                   ISEKVVRSYSPSQHHAVYDIRVI"
FT   gene            553143..553991
FT                   /locus_tag="Mpet_0548"
FT   CDS_pept        553143..553991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0548"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="COGs: COG3264 Small-conductance mechanosensitive
FT                   channel; InterPro IPR006685; KEGG: tko:TK1063
FT                   small-conductance mechanosensitive channel; PFAM: MscS
FT                   Mechanosensitive ion channel; SPTR: Small-conductance
FT                   mechanosensitive channel; PFAM: Mechanosensitive ion
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35322"
FT                   /db_xref="GOA:E1RHL3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHL3"
FT                   /protein_id="ADN35322.1"
FT                   /translation="MADFDLSATGLDASTLESNFETLSTITIEEIIFALIVLVVGYVVV
FT                   KIIINRIEHYFSKSTKMPKLMAINIVKAIKLFLYIIVILCALQALGIEVSVFIISIFAF
FT                   ISIIMSFGMKDTINNLASGVWIAASRAYDIDDEVELSGKHGTVMDMNVMATEIKQLDNT
FT                   RIIIPNGTVWNSPIINVTRMDRRMIAVEYGVAYNTVIQDAIDVALKVADEHPKLHKEPK
FT                   PIVRFREMADSAVVLQLRVWVDTDDYYQAKSDVLTGIYNGLNKAGIGIPFPQVDVHMKD
FT                   D"
FT   gene            complement(554341..554859)
FT                   /locus_tag="Mpet_0549"
FT   CDS_pept        complement(554341..554859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0549"
FT                   /product="TspO and MBR like protein"
FT                   /note="COGs: COG3476 Tryptophan-rich sensory protein
FT                   (mitochondrial benzodiazepine receptor homolog); InterPro
FT                   IPR004307; KEGG: mac:MA4214 benzodiazepine receptor TspO;
FT                   PFAM: TspO/MBR family protein; SPTR: Benzodiazepine
FT                   receptor TspO; PFAM: TspO/MBR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35323"
FT                   /db_xref="GOA:E1RHL4"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHL4"
FT                   /protein_id="ADN35323.1"
FT                   /translation="MEDHSAIPNPNDERIKKGSLLAGSVLVCLIAGGLGSIFTKTGPGT
FT                   WYAEELIKPDLTPPGFVFGIVWTCLYILMGISLYLLLNKDLKLKEVRIAVFFFFIQLVL
FT                   NFSWSYLFFGLENPLAGFSCIIALWIFILLTIVTSYRIDKNASYLLVPYLIWVTFAAFL
FT                   NWQILVLNS"
FT   gene            complement(554903..555295)
FT                   /locus_tag="Mpet_0550"
FT   CDS_pept        complement(554903..555295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0550"
FT                   /product="protein of unknown function DUF35"
FT                   /note="COGs: COG1545 nucleic-acid-binding protein
FT                   containing a Zn-ribbon; InterPro IPR002878; KEGG:
FT                   mhu:Mhun_0149 hypothetical protein; PFAM: protein of
FT                   unknown function DUF35; SPTR: Putative uncharacterized
FT                   protein; PFAM: Rubredoxin-like zinc ribbon domain
FT                   (DUF35_N); DUF35 OB-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35324"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHL5"
FT                   /protein_id="ADN35324.1"
FT                   /translation="MSVPRFWRKQPQRYNLIGSKCETCGTYYYPPRTVCPQCRRDGKMV
FT                   EHKFKGTGKVVTFSIIRTASAPYDYETPYPIAIIELEEGTRMTAPVVCDIEDMEIGMPV
FT                   RATFRKIVADGDSGMIVYGTKFVPVK"
FT   gene            complement(555295..556467)
FT                   /locus_tag="Mpet_0551"
FT   CDS_pept        complement(555295..556467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0551"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase; InterPro
FT                   IPR002155; KEGG: mhu:Mhun_0150 acetyl-CoA
FT                   acetyltransferase; SPTR: Thiolase; PFAM: Thiolase,
FT                   C-terminal domain; Thiolase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35325"
FT                   /db_xref="GOA:E1RHL6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHL6"
FT                   /protein_id="ADN35325.1"
FT                   /translation="MREVAVIGVGLTTFGEKWDSSFRQMCVEAGIKSLEDANVDGNQID
FT                   EMFVGNMSGGRFILQEHISALIADAVGLASTRHIPATRTEAACASGGLAFRQAYTSVAS
FT                   GMSDIVIAAGVEKMTDVDGGVTTDALAGAADREWEGIYGVTFPSLYAMIARDYMHRYGL
FT                   TREQLAQVAVKNHYNGARNPIAQFRKEITIDTVLNSTLVADPIRLMDCSPVTDGAAAVI
FT                   LCPLERAKEFTDSPVKVLASTQATDTIALHDRRDISTLDATVAAGNRAFEMAKLERKDI
FT                   DLVEVHDCFTIAELCAIEDLGFCEKGKAGIMTEEGETALGGRLPINPSGGLKACGHPVG
FT                   ATGIKQVCEVVEQLRGEATGRQVEGAEIGMTHNVGGTGATVVTNIFRRVN"
FT   gene            complement(556464..557513)
FT                   /locus_tag="Mpet_0552"
FT   CDS_pept        complement(556464..557513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0552"
FT                   /product="hydroxymethylglutaryl-CoA synthase"
FT                   /note="COGs: COG3425 3-hydroxy-3-methylglutaryl CoA
FT                   synthase; InterPro IPR013528:IPR013747:IPR004656; KEGG:
FT                   mhu:Mhun_0151 hypothetical protein; PFAM:
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; Hydroxymethylglutaryl-coenzyme A synthase domain;
FT                   SPTR: Hydroxymethylglutaryl-CoA synthase, putative;
FT                   TIGRFAM: hydroxymethylglutaryl-CoA synthase; PFAM:
FT                   Hydroxymethylglutaryl-coenzyme A synthase N terminal;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C
FT                   terminal; TIGRFAM: hydroxymethylglutaryl-CoA synthase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35326"
FT                   /db_xref="GOA:E1RHL7"
FT                   /db_xref="InterPro:IPR004656"
FT                   /db_xref="InterPro:IPR013528"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHL7"
FT                   /protein_id="ADN35326.1"
FT                   /translation="MVGIITYGAYIPRFRIKTEEIARVWGANGAEIAAGLGVKEKAVPD
FT                   LDEDTLTISVNAARFALERRSVNPDEIGAIYVGSESHPYAVKPTAATVGEAIGATPVMT
FT                   AADYEFACKAGTAGIQTCMGLVKSGMIKYGIAIGADVAQGAPGDALEYTAAAGGAAFVI
FT                   GDKDPIAEINHTCSFTTDTPDFWRREGQGYPRHGGRFSGEPAYFKHIQGAAKMMLEYMG
FT                   TKPSDYDYAVFHQPNAKFPRNVSAMLGFTSEQIKPGLAVPRLGNTYSGAVPVGLSATLD
FT                   IAKPGDRIFVTSYGSGSGSDAFDITVTDKIETLINRKAAPSVEDLLNHKKYVDYAVYAK
FT                   HKGKIVRAA"
FT   gene            complement(557507..558217)
FT                   /locus_tag="Mpet_0553"
FT   CDS_pept        complement(557507..558217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0553"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="COGs: COG1709 transcriptional regulator protein;
FT                   InterPro IPR001387:IPR017271; KEGG: mem:Memar_2360
FT                   helix-turn-helix domain-containing protein; SMART:
FT                   helix-turn-helix domain protein; SPTR: Transcriptional
FT                   regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35327"
FT                   /db_xref="GOA:E1RHL8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017271"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHL8"
FT                   /protein_id="ADN35327.1"
FT                   /translation="MKSVLRNRLAEKMAGEITLSDSPGEALKKWRMNFNIPPGLLAERL
FT                   EVSPSVISDYEGGRRKSPGTAVVGKIVETILSIDEDSGGKFMKKYANILYSDFDDDVIY
FT                   DMHDYDTPIQLDKFCESIGCTLINGDLDHQIYGYTIVNSLNAIIQLSSSEFNKIYGWST
FT                   ERALIFTNVSTGKSPMIAIRVTPFKPRCVILQGITPEKINPLVPELAKKDRITLLCTEN
FT                   GIDEIIKILRDEPW"
FT   gene            558311..559003
FT                   /locus_tag="Mpet_0554"
FT   CDS_pept        558311..559003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0554"
FT                   /product="transcriptional regulator, MarR family"
FT                   /EC_number="2.7.1.161"
FT                   /note="COGs: COG1339 Transcriptional regulator of a
FT                   riboflavin/FAD biosynthetic operon; InterPro
FT                   IPR000835:IPR002834; KEGG: mpl:Mpal_2512 protein of unknown
FT                   function DUF120; PFAM: protein of unknown function DUF120;
FT                   regulatory protein MarR; PRIAM: CTP-dependent riboflavin
FT                   kinase; SPTR: Putative uncharacterized protein; PFAM:
FT                   Domain of unknown function DUF120"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35328"
FT                   /db_xref="GOA:E1RHL9"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023470"
FT                   /db_xref="InterPro:IPR023602"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039063"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHL9"
FT                   /protein_id="ADN35328.1"
FT                   /translation="MHINFDIAMISNDDLMTLKKIALMGGLKSQVCLSSQAMGERLEIS
FT                   PQTASRRLISLEKEKLISRTIRPDGQYIRINESGEKILSGEYFDYCRVFEKTDVSYLLR
FT                   GEVISGLGEGRYYVSIPHYMKQFRDKLGFEPFPGTLNLRLDPVSLETRKELEKLEWVEI
FT                   EGFVDNDRTFGSAKCLPCRIEGSASAIIVPGRTHYPDDIIELLCEHGLRSKLGLKDGDR
FT                   IKVEITND"
FT   gene            558996..559664
FT                   /locus_tag="Mpet_0555"
FT   CDS_pept        558996..559664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0555"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="COGs: COG0108 3 4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; InterPro IPR000422; KEGG: mbn:Mboo_0160
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase; PFAM:
FT                   34-dihydroxy-2-butanone 4-phosphate synthase; SPTR:
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase; TIGRFAM:
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase; PFAM:
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase; TIGRFAM:
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35329"
FT                   /db_xref="GOA:E1RHM0"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHM0"
FT                   /protein_id="ADN35329.1"
FT                   /translation="MIEKAIEAMKNGEIILIYDFDSREGETDFAIRSDALTREDICRMR
FT                   KDAGGLICTAIHPKAAEKIGLPFASDALRETGFAERDGDIPYDPKNHSSFSIWVNHKDT
FT                   FTGITDNDRTLTANRLSDHVKSAMNGGKLNFSSEFRTPGHMALLRANEKLLDQRRGQTE
FT                   LSIAIAEFAGVTPCVTICEMLDDNTGKALSKKDAMEYGKKHNLVFVSGDEVLEYWNNNH
FT                   "
FT   gene            559776..560867
FT                   /locus_tag="Mpet_0556"
FT   CDS_pept        559776..560867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0556"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="InterPro IPR013656:IPR000014:IPR000700; KEGG:
FT                   mem:Memar_2294 signal transduction histidine kinase,
FT                   nitrogen specific, NtrB; PFAM: PAS fold-4 domain protein;
FT                   SPTR: Signal transduction histidine kinase, nitrogen
FT                   specific, NtrB; TIGRFAM: PAS sensor protein; PFAM: PAS
FT                   fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35330"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHM1"
FT                   /protein_id="ADN35330.1"
FT                   /translation="MTLSSPGDFMDSEDRLVSIFSGLREEIVIVVDLSSMKIEGANDKA
FT                   QNLLGYDLQELSCLKLSDIIACFGTPDVIGREEELFSGRSYFSEFISSNSGKIPVSFSL
FT                   NHVETGIKEYGVIIGRETPVGLETPGNTDFSPASFMKVLDSIKEAIVVVDRNMKIRLYN
FT                   APFRFLAEKCGYRSELIGASLHDTADFLTGKLSLEYKYVFKSGKRLDTSVKKKFSSQML
FT                   WYEVVKSPFTVDGEVTHVISVIRDITKQQELEEMKKESIFQIEKNMEQFAILNDHIRNP
FT                   LQAIVGLADLDGGSNSEKIIENAFQIDAIVKELDSGWIESDKIREMLLRHYGLKIKRRP
FT                   NVSSPIGMLTVIGKERNEKSDND"
FT   gene            560868..561542
FT                   /locus_tag="Mpet_0557"
FT   CDS_pept        560868..561542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0557"
FT                   /product="protein of unknown function DUF45"
FT                   /note="COGs: COG1451 metal-dependent hydrolase; InterPro
FT                   IPR002725; KEGG: afu:AF1707 hypothetical protein; PFAM:
FT                   protein of unknown function DUF45; SPTR: Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35331"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHM2"
FT                   /protein_id="ADN35331.1"
FT                   /translation="MKQYPFEIIINHREVSSSRIRISPDCRVYVTAPRGADIEALIDSK
FT                   IEWIMKKIGELDRLASEYQTGDGSFIYNGRMWHPVFSESRPVTFSWPDIHYPSVEKLRK
FT                   AVSQELKEDIIHRLDHYSKKMDVEYSRVSIRNQRTRWGSCSGKGNLNFNIRSMALPENI
FT                   RDYLVVHELSHRIEMNHSPAFWKKVSEYYPGFRQAEKELKAYWIIIARSRIWGSLLGSK
FT                   DI"
FT   gene            561611..562768
FT                   /locus_tag="Mpet_0558"
FT   CDS_pept        561611..562768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0558"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="COGs: COG1454 Alcohol dehydrogenase class IV;
FT                   InterPro IPR001670:IPR018211; KEGG: geo:Geob_0263
FT                   iron-containing alcohol dehydrogenase; PFAM:
FT                   iron-containing alcohol dehydrogenase; SPTR:
FT                   Iron-containing alcohol dehydrogenase; PFAM:
FT                   Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35332"
FT                   /db_xref="GOA:E1RHM3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHM3"
FT                   /protein_id="ADN35332.1"
FT                   /translation="MTGYNRDVRKFVSPEFITGIGARKFAGRYSSNFNLKKVLLVTDSC
FT                   VRRCRWISPITDSLCDNGIDYEVFSSITENPSVDEVMDGSRAFRDSGCEGIVAVGGGSV
FT                   LDCAKGIGIIAENSGHISEYIGIDMIRNPMPPLICIPSTAGSSADVSQYAVISDREQRT
FT                   KNLIISKSLVPDLSLIDPEPLSTLPGDIARSSAMDALIHAMEGYCSNGSSPVTDMFAMN
FT                   SIEMIAENIAPDYWNDPDRRFKIMIASLYAGLCFSNAGLGLVHSMAHALGGWTGMNHGL
FT                   ASFIVLRDVIQYNMEAAPGRYRKIAGFIGTDTEKLPDDSSVPDIIGDGMMEMFGYDERP
FT                   PLSGLGVLREDIPELVQRTMNDPCIATNPRLPRKNDVEELYLNLL"
FT   gene            562877..564037
FT                   /locus_tag="Mpet_0559"
FT   CDS_pept        562877..564037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0559"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="InterPro IPR013767:IPR000014; KEGG: mpl:Mpal_2251
FT                   signal transduction histidine kinase, nitrogen specific,
FT                   NtrB; PFAM: PAS fold domain protein; SMART: PAS domain
FT                   containing protein; SPTR: Signal transduction histidine
FT                   kinase, nitrogen specific, NtrB; TIGRFAM: PAS sensor
FT                   protein; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35333"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHM4"
FT                   /protein_id="ADN35333.1"
FT                   /translation="MSDPEYDQYDDLRKKILGLGDSSFRKTYYPVLRHKQMELERFRII
FT                   LDHVNDMVFLISYPECKVVDFSLRAAEKLGFRPEEITGSEISRFLHYDSGKPVSLHEMK
FT                   DKAERVLIRAEIECKQGERIPVEADLSFTNYGDEIYCAVICRDISERIQMEKMIFESES
FT                   QYRTTIEAITDGILVVNSSGRSIICNRAFRDQYLRFAGRVFSPKINAKDFFRNIGLFKD
FT                   DELDSFMSSRDFEEKTGKILMNDKMAVLKVRKMPISHEFRHGLSVLILSDITQSTVLDE
FT                   IRRDVFYQLNHNMEQFAILNDEIRNPLQALLGTIELENPMLAAAIHPFISEINTIVRRL
FT                   DIGWLESEKVRGMIKKHYGVSVLDKDEIGDAVLYLKEFGHDEGMIL"
FT   gene            complement(564034..564480)
FT                   /locus_tag="Mpet_0560"
FT   CDS_pept        complement(564034..564480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0560"
FT                   /product="cytidyltransferase-related domain protein"
FT                   /note="COGs: COG0615 Cytidylyltransferase; InterPro
FT                   IPR004820:IPR004821; KEGG: mpl:Mpal_0310
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   cytidylyltransferase; SPTR: Cytidyltransferase-related
FT                   domain protein; TIGRFAM: cytidyltransferase-related domain
FT                   protein; PFAM: Cytidylyltransferase; TIGRFAM:
FT                   cytidyltransferase-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35334"
FT                   /db_xref="GOA:E1RHM5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024902"
FT                   /db_xref="UniProtKB/Swiss-Prot:E1RHM5"
FT                   /protein_id="ADN35334.1"
FT                   /translation="MKRIVATGTFDILHPGHIYYLEESRKLGDELHVIIARDENVRHKP
FT                   KPVIPEQQRLRMVQSLKPVDYARLGSTTDIFEPIREIQPDIITLGFNQFFNEEKLKCDL
FT                   EENGISAEVVRIEGYSGEGFCSSRNIMKQILIRRCKELQDDSTD"
FT   gene            complement(564477..564848)
FT                   /locus_tag="Mpet_0561"
FT   CDS_pept        complement(564477..564848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0561"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1310 metal-dependent protease of the
FT                   PAD1/JAB1 superfamily; KEGG: mbn:Mboo_0210 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35335"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHM6"
FT                   /protein_id="ADN35335.1"
FT                   /translation="MPDIKIKRELLMILLELGKSSHPSEFLALLIKNGDTIDEFELAPG
FT                   TITGSSSARYQPDMMPLGTGISGSAHSHPSGAIRPSDADLRFFPAVGKYHIIIGAPYTE
FT                   DDWRCFFADGSPCSVEVID"
FT   gene            564945..565421
FT                   /locus_tag="Mpet_0562"
FT   CDS_pept        564945..565421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0562"
FT                   /product="UspA domain protein"
FT                   /note="COGs: COG0589 Universal stress protein UspA and
FT                   related nucleotide-binding protein; InterPro
FT                   IPR006016:IPR006015; KEGG: mpl:Mpal_0780 UspA domain
FT                   protein; PFAM: UspA domain protein; SPTR: UspA domain
FT                   protein; PFAM: Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35336"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHM7"
FT                   /protein_id="ADN35336.1"
FT                   /translation="MYSKILVAIDGSKPSLKALERAIEIGKCWKSEIHAVYAVNPGIYG
FT                   TTVVDPAIGVSDPGSERIFNMLQEESKKIIEDAKSFTGDQGYYVKYHEKLGDARNVILD
FT                   TAKDLGVDLIVLGSTGKGMAKRLVLGSVSSSVVFHSPVSTLVVRDLGEKKQKSN"
FT   gene            complement(565429..566847)
FT                   /locus_tag="Mpet_0563"
FT   CDS_pept        complement(565429..566847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0563"
FT                   /product="dihydropteroate synthase-related protein"
FT                   /note="COGs: COG0294 Dihydropteroate synthase; InterPro
FT                   IPR000489:IPR005236; KEGG: mem:Memar_2299 dihydropteroate
FT                   synthase-related protein; PFAM: dihydropteroate synthase
FT                   DHPS; SPTR: Dihydropteroate synthase-related protein;
FT                   TIGRFAM: dihydropteroate synthase-related protein; TIGRFAM:
FT                   dihydropteroate synthase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35337"
FT                   /db_xref="GOA:E1RHM8"
FT                   /db_xref="InterPro:IPR005236"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHM8"
FT                   /protein_id="ADN35337.1"
FT                   /translation="MRILLPTGEIAYPVVKKAAERFGADVAVAGKIAAFLAPKKLSAIL
FT                   SGSKVKYDMVIVSGMCTADFSGVEEEFGIPVYLGPRHAADLELILGHIDELQLSRTIPA
FT                   DELIASKKKEEAYSKISEAEERSEPDFYIGNLRIGGGSRMKVLAEIMDAHKTDNLREIV
FT                   FEFIESGADIIDLGFGFDATPDDVRRVFEEVSGIQTVFAADTQDPGLIRAALGHADLIL
FT                   SLHEGNIPVIGKEVAEAGAAAVIVPNEKTLEENLKMAGATGIKRIIADPLLQPAGSGLL
FT                   QSLSGFVPCGHPVFFGAGNVVELIDADSPGANALLAALAMEAGASIVFTSEHSDKTKGS
FT                   VREMRRASEMMVLASNRPYPKDLGIDLFCIKEKRRRHELPLSYTTCNEAGGIIDELVFD
FT                   PAGNIRIGIEDGYIVAVHKGRAIKGKKWEDLFHMLLKEERVSLMDHAAYLGKELYKAEL
FT                   ALKFNRSFEQDGPF"
FT   gene            566892..567560
FT                   /locus_tag="Mpet_0564"
FT   CDS_pept        566892..567560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0564"
FT                   /product="PHP domain protein"
FT                   /note="COGs: COG0613 metal-dependent phosphoesterase (PHP
FT                   family); InterPro IPR004013:IPR003141; KEGG: mbn:Mboo_0216
FT                   phosphotransferase domain-containing protein; PFAM: PHP
FT                   domain protein; SMART: phosphoesterase PHP domain protein;
FT                   SPTR: PHP C-terminal domain protein; PFAM: PHP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35338"
FT                   /db_xref="GOA:E1RHM9"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHM9"
FT                   /protein_id="ADN35338.1"
FT                   /translation="MLKCDLHVHTKYSRDGESSVEDIIRMAEKRGLDVIAITDHDTVGG
FT                   AKYAQTIKTDIMVIPGVEISTKSGHLIALGITETIPAGLDFYETVDRAREMGAFLILPH
FT                   PFHQFRHGVGTRLKDAIGAVDAVESFNSRYIIGSANKKAEKKAKKFKKPCVAGSDAHNA
FT                   RFVGYGVTVVDSEKDMQSIFDAISAGRVCIIGKMTPLKSYTGQSLKNTKRKIVRKVRHK
FT                   "
FT   gene            567557..568342
FT                   /locus_tag="Mpet_0565"
FT   CDS_pept        567557..568342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0565"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="COGs: COG0101 Pseudouridylate synthase; InterPro
FT                   IPR020097:IPR001406; KEGG: mem:Memar_2301 tRNA
FT                   pseudouridine synthase A; PFAM: Pseudouridine synthase I,
FT                   TruA, alpha/beta domain; SPTR: tRNA pseudouridine synthase
FT                   A; TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase; TIGRFAM: pseudouridylate synthase
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35339"
FT                   /db_xref="GOA:E1RHN0"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHN0"
FT                   /protein_id="ADN35339.1"
FT                   /translation="MRIAFLVSYIGTDFYGSQQQPGIRTVEGEFIGACIDLGLFSDWRD
FT                   ARFQFSGRTDAGVHARSQICAFDTDYPERAVSAINRKLPGDIRCRGWAGVPEGFNPRFE
FT                   VSERIYRYFFPDGNLDWGKMSLAAEYLPGVHDFSRFARVEGKNPERKIFLAEIIPDKEG
FT                   IIFEIRGESFLWNMVRCISHALWLVGSGSESPEVISAALSNTDGPRFPAAPPEGLVLWD
FT                   LVTDLEFAPVNGLEKSEKFLDDFKCRHHQLLKAAEFLIE"
FT   gene            complement(568690..569535)
FT                   /locus_tag="Mpet_0566"
FT   CDS_pept        complement(568690..569535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0566"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mla:Mlab_0053 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35340"
FT                   /db_xref="GOA:E1RHN1"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHN1"
FT                   /protein_id="ADN35340.1"
FT                   /translation="MVKLPDKKSLEGFTKKVGEAVKLPDKPEDKEPKPGLSQADEEKIR
FT                   KDERERIEREKREKENAEKAREYEKIEAEKQAEKERLAEEARKKKEKDEWAREEERKRL
FT                   EDERNRAQIEKEVRAQQKAEAPKKGHGGKIALGIIIILILIAAGGYVSLITGNSVLDAY
FT                   GYPLSYTGTYDVLIPDSQKIDFGPIPVQAISSGNAVTLSINNDRRTISLGESTTFPAKH
FT                   VIITMFGMPIYNADYEVTATYIGVVTNRDDFKVVLKTSQSIPGWLITVMKPSGVDIITT
FT                   "
FT   gene            complement(569602..570153)
FT                   /locus_tag="Mpet_0567"
FT   CDS_pept        complement(569602..570153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0567"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="COGs: COG0484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain; InterPro
FT                   IPR001623:IPR003095:IPR018253; KEGG: mga:MGA_1324d
FT                   hypothetical protein; PFAM: heat shock protein DnaJ domain
FT                   protein; SMART: heat shock protein DnaJ domain protein;
FT                   SPTR: DnaJ-like molecular chaperone; PFAM: DnaJ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mpet_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADN35341"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E1RHN2"
FT                   /protein_id="ADN35341.1"
FT                   /translation="MAQNYYEVLGLDANAESDEIIKAYRSLAKAYHPDTATHPNAKQLF
FT                   EKISAAYSVLSDPEKRSAYDRELNESSKEEEIPESDEYSLMADYEYTCEKEEHFLIDGA
FT                   EVAMTGARHLIMGEREYIVYDDGLIDIGGKLSFKVEGPERYLVDGAEKVLLNSDHFIQK
FT                   GDEYVVIDGKPFLVRKSDEK"
FT   gene            570256..571137
FT                   /locus_tag="Mpet_0568"
FT   CDS_pept        570256..571137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mpet_0568"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="COGs: COG1013 Pyruvate:ferredoxin oxidoreductase and
FT                   related