(data stored in ACNUC7421 zone)

EMBL: CP002121

ID   CP002121; SV 1; circular; genomic DNA; STD; PRO; 2130580 BP.
XX
AC   CP002121; EF469826; FJ517581;
XX
PR   Project:PRJNA32641;
XX
DT   08-SEP-2010 (Rel. 106, Created)
DT   20-JAN-2018 (Rel. 135, Last updated, Version 10)
XX
DE   Streptococcus pneumoniae AP200, complete genome.
XX
KW   .
XX
OS   Streptococcus pneumoniae AP200
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
OS   Streptococcus phage PhiSpn_200
OC   Viruses; unclassified viruses; unclassified bacterial viruses.
XX
RN   [1]
RP   818751-870207
RX   DOI; 10.1128/AAC.01081-07.
RX   PUBMED; 18070957.
RA   Camilli R., Del Grosso M., Iannelli F., Pantosti A.;
RT   "New genetic element carrying the erythromycin resistance determinant
RT   erm(TR) in Streptococcus pneumoniae";
RL   Antimicrob. Agents Chemother. 52(2):619-625(2008).
XX
RN   [2]
RC   Publication Status: Online-Only
RP   1-2130580
RX   DOI; .1186/1471-2180-11-25.
RX   PUBMED; 21284853.
RA   Camilli R., Bonnal R.J., Del Grosso M., Iacono M., Corti G., Rizzi E.,
RA   Marchetti M., Mulas L., Iannelli F., Superti F., Oggioni M.R.,
RA   De Bellis G., Pantosti A.;
RT   "Complete genome sequence of a serotype 11A, ST62 Streptococcus pneumoniae
RT   invasive isolate";
RL   BMC Microbiol. 11:25-25(2011).
XX
RN   [3]
RP   818751-870207
RA   Camilli R.;
RT   ;
RL   Submitted (05-MAR-2007) to the INSDC.
RL   Infectious, Parasitic and Immune-mediated Diseases, Istituto Superiore di
RL   Sanita', Viale Regina Elena 299, Rome, Italy
XX
RN   [4]
RC   Sequence update by submitter
RP   818751-870207
RA   Camilli R., Bonnal R.J.P., Iacono M.;
RT   ;
RL   Submitted (07-AUG-2008) to the INSDC.
RL   Infectious, Parasitic and Immune-mediated Diseases, Istituto Superiore di
RL   Sanita', Viale Regina Elena 299, Rome, Italy
XX
RN   [5]
RP   1-2130580
RA   Camilli R., Bonnal R.J.P., Iacono M., Corti G., Rizzi E., Del Grosso M.,
RA   Mulas L., Marchetti M., Iannelli F., Superti F., De Bellis G.,
RA   Oggioni M.R., Pantosti A.;
RT   ;
RL   Submitted (16-JUL-2010) to the INSDC.
RL   ITB, CNR, via F.lli Cervi 93, Segrate - Milan 20090, Italy
XX
DR   MD5; c5c0fb935757455f1c8d2e33f3141a89.
DR   BioSample; SAMN02603428.
DR   EnsemblGenomes-Gn; EBG00001006489.
DR   EnsemblGenomes-Gn; EBG00001006490.
DR   EnsemblGenomes-Gn; EBG00001006491.
DR   EnsemblGenomes-Gn; EBG00001006492.
DR   EnsemblGenomes-Gn; EBG00001006493.
DR   EnsemblGenomes-Gn; EBG00001006494.
DR   EnsemblGenomes-Gn; EBG00001006495.
DR   EnsemblGenomes-Gn; EBG00001006496.
DR   EnsemblGenomes-Gn; EBG00001006497.
DR   EnsemblGenomes-Gn; EBG00001006498.
DR   EnsemblGenomes-Gn; EBG00001006499.
DR   EnsemblGenomes-Gn; EBG00001006500.
DR   EnsemblGenomes-Gn; EBG00001006501.
DR   EnsemblGenomes-Gn; EBG00001006502.
DR   EnsemblGenomes-Gn; EBG00001006503.
DR   EnsemblGenomes-Gn; EBG00001006504.
DR   EnsemblGenomes-Gn; EBG00001006505.
DR   EnsemblGenomes-Gn; EBG00001006506.
DR   EnsemblGenomes-Gn; EBG00001006507.
DR   EnsemblGenomes-Gn; EBG00001006508.
DR   EnsemblGenomes-Gn; EBG00001006509.
DR   EnsemblGenomes-Gn; EBG00001006510.
DR   EnsemblGenomes-Gn; EBG00001006511.
DR   EnsemblGenomes-Gn; EBG00001006512.
DR   EnsemblGenomes-Gn; EBG00001006513.
DR   EnsemblGenomes-Gn; EBG00001006514.
DR   EnsemblGenomes-Gn; EBG00001006515.
DR   EnsemblGenomes-Gn; EBG00001006516.
DR   EnsemblGenomes-Gn; EBG00001006517.
DR   EnsemblGenomes-Gn; EBG00001006518.
DR   EnsemblGenomes-Gn; EBG00001006519.
DR   EnsemblGenomes-Gn; EBG00001006520.
DR   EnsemblGenomes-Gn; EBG00001006521.
DR   EnsemblGenomes-Gn; EBG00001006522.
DR   EnsemblGenomes-Gn; EBG00001006523.
DR   EnsemblGenomes-Gn; EBG00001006524.
DR   EnsemblGenomes-Gn; EBG00001006525.
DR   EnsemblGenomes-Gn; EBG00001006526.
DR   EnsemblGenomes-Gn; EBG00001006527.
DR   EnsemblGenomes-Gn; EBG00001006528.
DR   EnsemblGenomes-Gn; EBG00001006529.
DR   EnsemblGenomes-Gn; EBG00001006530.
DR   EnsemblGenomes-Gn; EBG00001006531.
DR   EnsemblGenomes-Gn; EBG00001006532.
DR   EnsemblGenomes-Gn; EBG00001006533.
DR   EnsemblGenomes-Gn; EBG00001006534.
DR   EnsemblGenomes-Gn; EBG00001006535.
DR   EnsemblGenomes-Gn; EBG00001006536.
DR   EnsemblGenomes-Gn; EBG00001006537.
DR   EnsemblGenomes-Gn; EBG00001006538.
DR   EnsemblGenomes-Gn; EBG00001006539.
DR   EnsemblGenomes-Gn; EBG00001006540.
DR   EnsemblGenomes-Gn; EBG00001006541.
DR   EnsemblGenomes-Gn; EBG00001006542.
DR   EnsemblGenomes-Gn; EBG00001006543.
DR   EnsemblGenomes-Gn; EBG00001006544.
DR   EnsemblGenomes-Gn; EBG00001006545.
DR   EnsemblGenomes-Gn; EBG00001006546.
DR   EnsemblGenomes-Gn; EBG00001006547.
DR   EnsemblGenomes-Gn; EBG00001006548.
DR   EnsemblGenomes-Gn; EBG00001006549.
DR   EnsemblGenomes-Gn; EBG00001006550.
DR   EnsemblGenomes-Gn; EBG00001006551.
DR   EnsemblGenomes-Gn; EBG00001006552.
DR   EnsemblGenomes-Gn; EBG00001006553.
DR   EnsemblGenomes-Gn; EBG00001006554.
DR   EnsemblGenomes-Gn; EBG00001006555.
DR   EnsemblGenomes-Gn; EBG00001006556.
DR   EnsemblGenomes-Gn; EBG00001006557.
DR   EnsemblGenomes-Gn; EBG00001006558.
DR   EnsemblGenomes-Gn; EBG00001006559.
DR   EnsemblGenomes-Gn; EBG00001006560.
DR   EnsemblGenomes-Gn; EBG00001006561.
DR   EnsemblGenomes-Gn; EBG00001006562.
DR   EnsemblGenomes-Gn; EBG00001006563.
DR   EnsemblGenomes-Gn; EBG00001006564.
DR   EnsemblGenomes-Gn; EBG00001006565.
DR   EnsemblGenomes-Gn; EBG00001006566.
DR   EnsemblGenomes-Gn; EBG00001006567.
DR   EnsemblGenomes-Gn; EBG00001006568.
DR   EnsemblGenomes-Gn; EBG00001006569.
DR   EnsemblGenomes-Gn; EBG00001006570.
DR   EnsemblGenomes-Gn; EBG00001006571.
DR   EnsemblGenomes-Gn; EBG00001006572.
DR   EnsemblGenomes-Gn; EBG00001006573.
DR   EnsemblGenomes-Gn; EBG00001006574.
DR   EnsemblGenomes-Gn; EBG00001006575.
DR   EnsemblGenomes-Gn; EBG00001006576.
DR   EnsemblGenomes-Gn; EBG00001006577.
DR   EnsemblGenomes-Gn; EBG00001006578.
DR   EnsemblGenomes-Gn; EBG00001006579.
DR   EnsemblGenomes-Gn; EBG00001006580.
DR   EnsemblGenomes-Gn; EBG00001006581.
DR   EnsemblGenomes-Gn; EBG00001006582.
DR   EnsemblGenomes-Gn; EBG00001006583.
DR   EnsemblGenomes-Gn; EBG00001006584.
DR   EnsemblGenomes-Gn; EBG00001006585.
DR   EnsemblGenomes-Gn; EBG00001006586.
DR   EnsemblGenomes-Gn; EBG00001006587.
DR   EnsemblGenomes-Gn; EBG00001006588.
DR   EnsemblGenomes-Gn; EBG00001006589.
DR   EnsemblGenomes-Gn; EBG00001006590.
DR   EnsemblGenomes-Gn; EBG00001006591.
DR   EnsemblGenomes-Gn; EBG00001006592.
DR   EnsemblGenomes-Gn; EBG00001006593.
DR   EnsemblGenomes-Gn; EBG00001006594.
DR   EnsemblGenomes-Gn; EBG00001006595.
DR   EnsemblGenomes-Gn; SPAP_0015.
DR   EnsemblGenomes-Gn; SPAP_0016.
DR   EnsemblGenomes-Gn; SPAP_0017.
DR   EnsemblGenomes-Gn; SPAP_0018.
DR   EnsemblGenomes-Gn; SPAP_0019.
DR   EnsemblGenomes-Gn; SPAP_0020.
DR   EnsemblGenomes-Gn; SPAP_0830.
DR   EnsemblGenomes-Gn; SPAP_0831.
DR   EnsemblGenomes-Gn; SPAP_0847.
DR   EnsemblGenomes-Gn; SPAP_1185.
DR   EnsemblGenomes-Gn; SPAP_1273.
DR   EnsemblGenomes-Gn; SPAP_1319.
DR   EnsemblGenomes-Gn; SPAP_1603.
DR   EnsemblGenomes-Gn; SPAP_1782.
DR   EnsemblGenomes-Gn; SPAP_1899.
DR   EnsemblGenomes-Gn; SPAP_1900.
DR   EnsemblGenomes-Gn; SPAP_1901.
DR   EnsemblGenomes-Gn; SPAP_1902.
DR   EnsemblGenomes-Gn; SPAP_1903.
DR   EnsemblGenomes-Gn; SPAP_1904.
DR   EnsemblGenomes-Gn; SPAP_1905.
DR   EnsemblGenomes-Gn; SPAP_1906.
DR   EnsemblGenomes-Gn; SPAP_1907.
DR   EnsemblGenomes-Gn; SPAP_1908.
DR   EnsemblGenomes-Gn; SPAP_1909.
DR   EnsemblGenomes-Gn; SPAP_1910.
DR   EnsemblGenomes-Gn; SPAP_1911.
DR   EnsemblGenomes-Gn; SPAP_1912.
DR   EnsemblGenomes-Gn; SPAP_1913.
DR   EnsemblGenomes-Gn; SPAP_1914.
DR   EnsemblGenomes-Gn; SPAP_1915.
DR   EnsemblGenomes-Gn; SPAP_1916.
DR   EnsemblGenomes-Gn; SPAP_1917.
DR   EnsemblGenomes-Gn; SPAP_1918.
DR   EnsemblGenomes-Gn; SPAP_1972.
DR   EnsemblGenomes-Gn; SPAP_2018.
DR   EnsemblGenomes-Gn; SPAP_2019.
DR   EnsemblGenomes-Gn; SPAP_2020.
DR   EnsemblGenomes-Gn; SPAP_2021.
DR   EnsemblGenomes-Gn; SPAP_2022.
DR   EnsemblGenomes-Gn; SPAP_2023.
DR   EnsemblGenomes-Gn; SPAP_2024.
DR   EnsemblGenomes-Gn; SPAP_2025.
DR   EnsemblGenomes-Gn; SPAP_2026.
DR   EnsemblGenomes-Gn; SPAP_2027.
DR   EnsemblGenomes-Gn; SPAP_2028.
DR   EnsemblGenomes-Gn; SPAP_2029.
DR   EnsemblGenomes-Gn; SPAP_2030.
DR   EnsemblGenomes-Gn; SPAP_2097.
DR   EnsemblGenomes-Gn; SPAP_2098.
DR   EnsemblGenomes-Gn; SPAP_2099.
DR   EnsemblGenomes-Gn; SPAP_2101.
DR   EnsemblGenomes-Gn; SPAP_2102.
DR   EnsemblGenomes-Gn; SPAP_2103.
DR   EnsemblGenomes-Gn; SPAP_2104.
DR   EnsemblGenomes-Gn; SPAP_2105.
DR   EnsemblGenomes-Gn; SPAP_2107.
DR   EnsemblGenomes-Gn; SPAP_2108.
DR   EnsemblGenomes-Gn; SPAP_2109.
DR   EnsemblGenomes-Gn; SPAP_2110.
DR   EnsemblGenomes-Gn; SPAP_2111.
DR   EnsemblGenomes-Gn; SPAP_2112.
DR   EnsemblGenomes-Gn; SPAP_2113.
DR   EnsemblGenomes-Gn; SPAP_2114.
DR   EnsemblGenomes-Gn; SPAP_2278.
DR   EnsemblGenomes-Gn; SPAP_2279.
DR   EnsemblGenomes-Gn; SPAP_2286.
DR   EnsemblGenomes-Gn; SPAP_2290.
DR   EnsemblGenomes-Tr; EBT00001531375.
DR   EnsemblGenomes-Tr; EBT00001531377.
DR   EnsemblGenomes-Tr; EBT00001531379.
DR   EnsemblGenomes-Tr; EBT00001531381.
DR   EnsemblGenomes-Tr; EBT00001531383.
DR   EnsemblGenomes-Tr; EBT00001531385.
DR   EnsemblGenomes-Tr; EBT00001531388.
DR   EnsemblGenomes-Tr; EBT00001531390.
DR   EnsemblGenomes-Tr; EBT00001531393.
DR   EnsemblGenomes-Tr; EBT00001531396.
DR   EnsemblGenomes-Tr; EBT00001531398.
DR   EnsemblGenomes-Tr; EBT00001531400.
DR   EnsemblGenomes-Tr; EBT00001531402.
DR   EnsemblGenomes-Tr; EBT00001531405.
DR   EnsemblGenomes-Tr; EBT00001531406.
DR   EnsemblGenomes-Tr; EBT00001531408.
DR   EnsemblGenomes-Tr; EBT00001531411.
DR   EnsemblGenomes-Tr; EBT00001531413.
DR   EnsemblGenomes-Tr; EBT00001531415.
DR   EnsemblGenomes-Tr; EBT00001531417.
DR   EnsemblGenomes-Tr; EBT00001531419.
DR   EnsemblGenomes-Tr; EBT00001531421.
DR   EnsemblGenomes-Tr; EBT00001531424.
DR   EnsemblGenomes-Tr; EBT00001531426.
DR   EnsemblGenomes-Tr; EBT00001531427.
DR   EnsemblGenomes-Tr; EBT00001531428.
DR   EnsemblGenomes-Tr; EBT00001531430.
DR   EnsemblGenomes-Tr; EBT00001531433.
DR   EnsemblGenomes-Tr; EBT00001531434.
DR   EnsemblGenomes-Tr; EBT00001531435.
DR   EnsemblGenomes-Tr; EBT00001531439.
DR   EnsemblGenomes-Tr; EBT00001531441.
DR   EnsemblGenomes-Tr; EBT00001531443.
DR   EnsemblGenomes-Tr; EBT00001531445.
DR   EnsemblGenomes-Tr; EBT00001531447.
DR   EnsemblGenomes-Tr; EBT00001531450.
DR   EnsemblGenomes-Tr; EBT00001531452.
DR   EnsemblGenomes-Tr; EBT00001531455.
DR   EnsemblGenomes-Tr; EBT00001531456.
DR   EnsemblGenomes-Tr; EBT00001531457.
DR   EnsemblGenomes-Tr; EBT00001531458.
DR   EnsemblGenomes-Tr; EBT00001531459.
DR   EnsemblGenomes-Tr; EBT00001531460.
DR   EnsemblGenomes-Tr; EBT00001531461.
DR   EnsemblGenomes-Tr; EBT00001531462.
DR   EnsemblGenomes-Tr; EBT00001531463.
DR   EnsemblGenomes-Tr; EBT00001531464.
DR   EnsemblGenomes-Tr; EBT00001531465.
DR   EnsemblGenomes-Tr; EBT00001531466.
DR   EnsemblGenomes-Tr; EBT00001531467.
DR   EnsemblGenomes-Tr; EBT00001531468.
DR   EnsemblGenomes-Tr; EBT00001531469.
DR   EnsemblGenomes-Tr; EBT00001531470.
DR   EnsemblGenomes-Tr; EBT00001531471.
DR   EnsemblGenomes-Tr; EBT00001531472.
DR   EnsemblGenomes-Tr; EBT00001531473.
DR   EnsemblGenomes-Tr; EBT00001531474.
DR   EnsemblGenomes-Tr; EBT00001531475.
DR   EnsemblGenomes-Tr; EBT00001531476.
DR   EnsemblGenomes-Tr; EBT00001531477.
DR   EnsemblGenomes-Tr; EBT00001531478.
DR   EnsemblGenomes-Tr; EBT00001531479.
DR   EnsemblGenomes-Tr; EBT00001531480.
DR   EnsemblGenomes-Tr; EBT00001531481.
DR   EnsemblGenomes-Tr; EBT00001531482.
DR   EnsemblGenomes-Tr; EBT00001531483.
DR   EnsemblGenomes-Tr; EBT00001531484.
DR   EnsemblGenomes-Tr; EBT00001531485.
DR   EnsemblGenomes-Tr; EBT00001531486.
DR   EnsemblGenomes-Tr; EBT00001531487.
DR   EnsemblGenomes-Tr; EBT00001531488.
DR   EnsemblGenomes-Tr; EBT00001531489.
DR   EnsemblGenomes-Tr; EBT00001531490.
DR   EnsemblGenomes-Tr; EBT00001531491.
DR   EnsemblGenomes-Tr; EBT00001531492.
DR   EnsemblGenomes-Tr; EBT00001531493.
DR   EnsemblGenomes-Tr; EBT00001531494.
DR   EnsemblGenomes-Tr; EBT00001531495.
DR   EnsemblGenomes-Tr; EBT00001531496.
DR   EnsemblGenomes-Tr; EBT00001531497.
DR   EnsemblGenomes-Tr; EBT00001531498.
DR   EnsemblGenomes-Tr; EBT00001531499.
DR   EnsemblGenomes-Tr; EBT00001531500.
DR   EnsemblGenomes-Tr; EBT00001531501.
DR   EnsemblGenomes-Tr; EBT00001531502.
DR   EnsemblGenomes-Tr; EBT00001531503.
DR   EnsemblGenomes-Tr; EBT00001531504.
DR   EnsemblGenomes-Tr; EBT00001531505.
DR   EnsemblGenomes-Tr; EBT00001531506.
DR   EnsemblGenomes-Tr; EBT00001531507.
DR   EnsemblGenomes-Tr; EBT00001531508.
DR   EnsemblGenomes-Tr; EBT00001531509.
DR   EnsemblGenomes-Tr; EBT00001531510.
DR   EnsemblGenomes-Tr; EBT00001531511.
DR   EnsemblGenomes-Tr; EBT00001531512.
DR   EnsemblGenomes-Tr; EBT00001531513.
DR   EnsemblGenomes-Tr; EBT00001531514.
DR   EnsemblGenomes-Tr; EBT00001531515.
DR   EnsemblGenomes-Tr; EBT00001531516.
DR   EnsemblGenomes-Tr; EBT00001531517.
DR   EnsemblGenomes-Tr; EBT00001531518.
DR   EnsemblGenomes-Tr; EBT00001531519.
DR   EnsemblGenomes-Tr; EBT00001531520.
DR   EnsemblGenomes-Tr; EBT00001531521.
DR   EnsemblGenomes-Tr; EBT00001531522.
DR   EnsemblGenomes-Tr; EBT00001531523.
DR   EnsemblGenomes-Tr; EBT00001531524.
DR   EnsemblGenomes-Tr; SPAP_0015-1.
DR   EnsemblGenomes-Tr; SPAP_0016-1.
DR   EnsemblGenomes-Tr; SPAP_0017-1.
DR   EnsemblGenomes-Tr; SPAP_0018-1.
DR   EnsemblGenomes-Tr; SPAP_0019-1.
DR   EnsemblGenomes-Tr; SPAP_0020-1.
DR   EnsemblGenomes-Tr; SPAP_0830-1.
DR   EnsemblGenomes-Tr; SPAP_0831-1.
DR   EnsemblGenomes-Tr; SPAP_0847-1.
DR   EnsemblGenomes-Tr; SPAP_1185-1.
DR   EnsemblGenomes-Tr; SPAP_1273-1.
DR   EnsemblGenomes-Tr; SPAP_1319-1.
DR   EnsemblGenomes-Tr; SPAP_1603-1.
DR   EnsemblGenomes-Tr; SPAP_1782-1.
DR   EnsemblGenomes-Tr; SPAP_1899-1.
DR   EnsemblGenomes-Tr; SPAP_1900-1.
DR   EnsemblGenomes-Tr; SPAP_1901-1.
DR   EnsemblGenomes-Tr; SPAP_1902-1.
DR   EnsemblGenomes-Tr; SPAP_1903-1.
DR   EnsemblGenomes-Tr; SPAP_1904-1.
DR   EnsemblGenomes-Tr; SPAP_1905-1.
DR   EnsemblGenomes-Tr; SPAP_1906-1.
DR   EnsemblGenomes-Tr; SPAP_1907-1.
DR   EnsemblGenomes-Tr; SPAP_1908-1.
DR   EnsemblGenomes-Tr; SPAP_1909-1.
DR   EnsemblGenomes-Tr; SPAP_1910-1.
DR   EnsemblGenomes-Tr; SPAP_1911-1.
DR   EnsemblGenomes-Tr; SPAP_1912-1.
DR   EnsemblGenomes-Tr; SPAP_1913-1.
DR   EnsemblGenomes-Tr; SPAP_1914-1.
DR   EnsemblGenomes-Tr; SPAP_1915-1.
DR   EnsemblGenomes-Tr; SPAP_1916-1.
DR   EnsemblGenomes-Tr; SPAP_1917-1.
DR   EnsemblGenomes-Tr; SPAP_1918-1.
DR   EnsemblGenomes-Tr; SPAP_1972-1.
DR   EnsemblGenomes-Tr; SPAP_2018-1.
DR   EnsemblGenomes-Tr; SPAP_2019-1.
DR   EnsemblGenomes-Tr; SPAP_2020-1.
DR   EnsemblGenomes-Tr; SPAP_2021-1.
DR   EnsemblGenomes-Tr; SPAP_2022-1.
DR   EnsemblGenomes-Tr; SPAP_2023-1.
DR   EnsemblGenomes-Tr; SPAP_2024-1.
DR   EnsemblGenomes-Tr; SPAP_2025-1.
DR   EnsemblGenomes-Tr; SPAP_2026-1.
DR   EnsemblGenomes-Tr; SPAP_2027-1.
DR   EnsemblGenomes-Tr; SPAP_2028-1.
DR   EnsemblGenomes-Tr; SPAP_2029-1.
DR   EnsemblGenomes-Tr; SPAP_2030-1.
DR   EnsemblGenomes-Tr; SPAP_2097-1.
DR   EnsemblGenomes-Tr; SPAP_2098-1.
DR   EnsemblGenomes-Tr; SPAP_2099-1.
DR   EnsemblGenomes-Tr; SPAP_2101-1.
DR   EnsemblGenomes-Tr; SPAP_2102-1.
DR   EnsemblGenomes-Tr; SPAP_2103-1.
DR   EnsemblGenomes-Tr; SPAP_2104-1.
DR   EnsemblGenomes-Tr; SPAP_2105-1.
DR   EnsemblGenomes-Tr; SPAP_2107-1.
DR   EnsemblGenomes-Tr; SPAP_2108-1.
DR   EnsemblGenomes-Tr; SPAP_2109-1.
DR   EnsemblGenomes-Tr; SPAP_2110-1.
DR   EnsemblGenomes-Tr; SPAP_2111-1.
DR   EnsemblGenomes-Tr; SPAP_2112-1.
DR   EnsemblGenomes-Tr; SPAP_2113-1.
DR   EnsemblGenomes-Tr; SPAP_2114-1.
DR   EnsemblGenomes-Tr; SPAP_2278-1.
DR   EnsemblGenomes-Tr; SPAP_2279-1.
DR   EnsemblGenomes-Tr; SPAP_2286-1.
DR   EnsemblGenomes-Tr; SPAP_2290-1.
DR   EuropePMC; PMC3055811; 21284853.
DR   EuropePMC; PMC3318815; 22307284.
DR   EuropePMC; PMC3485107; 22747711.
DR   EuropePMC; PMC3578082; 23168398.
DR   EuropePMC; PMC5687919; 29152579.
DR   EuropePMC; PMC6283594; 30475919.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   SILVA-LSU; CP002121.
DR   SILVA-SSU; CP002121.
XX
CC   On Oct 22, 2010 this sequence version replaced EF469826.2.
CC   Bacteria is available from Romina Camilli (romina.camilli@iss.it).
XX
FH   Key             Location/Qualifiers
FH
FT   source          order(1..23320,59331..2130580)
FT                   /organism="Streptococcus pneumoniae AP200"
FT                   /focus
FT                   /host="Homo sapiens"
FT                   /strain="AP200"
FT                   /serotype="11A"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /isolation_source="cerebrospinal fluid of a patient with
FT                   meningitis"
FT                   /collection_date="2003"
FT                   /db_xref="taxon:574093"
FT   source          23321..59330
FT                   /organism="Streptococcus phage PhiSpn_200"
FT                   /mol_type="genomic DNA"
FT                   /proviral
FT                   /db_xref="taxon:890041"
FT   gene            197..1558
FT                   /locus_tag="SPAP_0001"
FT   CDS_pept        197..1558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0001"
FT                   /product="ATPase involved in DNA replication initiation"
FT                   /note="Operon 1 Gene 1 COG0593 ATPase involved in DNA
FT                   replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83601"
FT                   /protein_id="ADM83601.1"
FT                   /translation="MKEKQFWNRILEFAQERLTRSMYDFYAIQAELIKVEENVATIFLP
FT                   RSEMEMVWEKQLKDIIVVAGFEIYDAEITPHYIFTKPQDTTSSQVEEATNLTLYDYSPK
FT                   LVSIPYSDTGLKEKYTFDNFIQGDGNVWAVSAALAVSEDLALTYNPLFIYGGPGLGKTH
FT                   LLNAIGNEILKNIPNARVKYIPAESFINDFLDHLRLGEMEKFKKTYRSLDLLLIDDIQS
FT                   LSGKKVATQEEFFNTFNALHDKQKQIVLTSDRSPKHLEGLEERLVTRFSWGLTQTITPP
FT                   DFETRIAILQSKTEHLGYNFQSDTLEYLAGQFDSNVRDLEGAINDITLIARVKKIKDIT
FT                   IDIAAEAIRARKQDVSQMLVIPIDKIQTEVGNFYGVSIKEMKGSRRLQNIVLARQVAMY
FT                   LSRELTDNSLPKIGKEFGGKDHTTVIHAHAKIKSLIDQDDNLRLEIESIKKKIK"
FT   gene            1717..2853
FT                   /locus_tag="SPAP_0002"
FT   CDS_pept        1717..2853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0002"
FT                   /product="DNA polymerase sliding clamp subunit"
FT                   /note="Operon 1 Gene 2 COG0592 DNA polymerase sliding clamp
FT                   subunit (PCNA homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83602"
FT                   /protein_id="ADM83602.1"
FT                   /translation="MIHFSINKNLFLQALNTTKRAISSKNAIPILSTVKIDVTNEGITL
FT                   IGSNGQISIENFISQKNEDAGLLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQNQI
FT                   VLTSGKSEITLKGKDSEQYPRIQEISASTPLILETKLLKKIINETAFAASTQESRPILT
FT                   GVHFVLSQHKELKTVATDSHRLSQKKLTLEKNSDDFDVVIPSRSLREFSAVFTDDIETV
FT                   EIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSMERARLL
FT                   SSATQNGTVKLEIKDGVVSAHVHSPEVGKVNEEIDTDQVTGEDLTISFNPTYLIDSLKA
FT                   LNSEKVTISFISAVRPFTLVPADTDEDFMQLITPVRTN"
FT   gene            2918..3112
FT                   /locus_tag="SPAP_0003"
FT   CDS_pept        2918..3112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0003"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 2 Gene 1 COG4481 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83603"
FT                   /protein_id="ADM83603.1"
FT                   /translation="MYQVGNFVEMKKSHACTIKSTGKKANRWEITRVGADIKIKCSNCE
FT                   HVVMMGRYDFERKMNKIID"
FT   gene            3196..4311
FT                   /locus_tag="SPAP_0004"
FT   CDS_pept        3196..4311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0004"
FT                   /product="Predicted GTPase, probable translation factor"
FT                   /note="Operon 3 Gene 1 COG0012 Predicted GTPase, probable
FT                   translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83604"
FT                   /protein_id="ADM83604.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTEMITPKKTVPTTFEFTDIAGIVKGASKGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPLADIDTINLELILADLESVNKRYARVEKMARTQKDKES
FT                   VAEFNVLQKIKPVLEDGKSARTIEFTDEEQKVVKGLFLLTTKPVLYVANVDEDVVSEPD
FT                   SIDYVKQIREFAATENAEVVVISARAEEEISELDDEDKKEFLEAIGLTESGVDKLTRAS
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGMKATQAAGIIHSDFEKGFIRAVTMSYEDLVKYGS
FT                   EKAVKEAGRLREEGKEYIVQDGDIMEFRFNV"
FT   gene            4382..4951
FT                   /locus_tag="SPAP_0005"
FT   CDS_pept        4382..4951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0005"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /note="Operon 3 Gene 2 COG0193 Peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83605"
FT                   /protein_id="ADM83605.1"
FT                   /translation="MTKLLVGLGNPGDKYFETKHNVGFMLIDQLAKKQNVTFTHDKIFQ
FT                   ADLASFFLNGEKIYLVKPTTFMNESGKAVHALLTYYGLDIDDLLIIYDDLDMEVGKIRL
FT                   RAKGSAGGHNGIKSIIQHIGTQVFNRVKIGIGRPKNGMSVVHHVLSKFDRDDYIGILQS
FT                   VDKVDDSVNYYLQEKNFEKTMQRYNG"
FT   gene            4952..8461
FT                   /locus_tag="SPAP_0006"
FT   CDS_pept        4952..8461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0006"
FT                   /product="Transcription-repair coupling factor (superfamily
FT                   II helicase)"
FT                   /note="Operon 3 Gene 3 COG1197 Transcription-repair
FT                   coupling factor (superfamily II helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83606"
FT                   /protein_id="ADM83606.1"
FT                   /translation="MVTLLDLFSENDQIKKWHQNLTDKKRQLILGLSTSTKALAIASSL
FT                   EKEDRIVLLTSTYGEAEGLVSDLISILGEELVYPFLVDDAPMVEFLMSSQEKIISRVEA
FT                   LRFLTDSSKKGILVCNIAASRLILPSPNAFKDSIVKISVGEEYDQHAFIHQLKENGYRK
FT                   VTQVQTQGEFSLRGDILDIFEISQLEPCRIEFFGDEIDGIRSFEVETQLSKENKTELTI
FT                   FPASDMLLREKDYQRGQSALEKQISKTLSPILKSYLEEILSSFHQKQSHADSRKFLSLC
FT                   YDKTWTVFDYIEKDTPIFFDDYQKLMNQYEVFERELAQYFTEELQNSKAFSDMQYFSDI
FT                   EQIYKKQSPVTFFSNLQKGLGNLKFDKIYQFNQYPMQEFFNQFSFLKEEIERYKKMDYT
FT                   IILQSSNSMGSKTLEDMLEEYQIKLDSRDKTSICKESVNLIEGNLRHGFHFVDEKILLI
FT                   TEHEIFQKKLKRRFRRQHVSNAERLKDYNELEKGDYVVHHIHGIGQYLGIETIEIKEIH
FT                   RDYVSVQYQNGDQISIPVEQIHLLSKYISSDGKAPKLNKLNDGHFKKAKQKVKNQVEDI
FT                   ADDLIKLYSERSQLKGFAFSADDDDQDAFDDAFPYVETDDQLRSIEEIKRDMQASQPMD
FT                   RLLVGDVGFGKTEVAMRAAFKAVNDHKQVVILVPTTVLAQQHYTNFKERFQNFAVNVDV
FT                   LSRFRSKKEQTATLEKLKNGQVDILIGTHRVLSKDVVFADLGLMIIDEEQRFGVKHKET
FT                   LKELKKQVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVLEKNDSVIRD
FT                   AVLREMERGGQVYYLYNKVDTIVQKVSELQELIPEASIGYVHGRMSEVQLENTLLDFIE
FT                   GQYDILVTTTIIETGVDIPNANTLFIENADHMGLSTLYQLRGRVGRSNRIAYAYLMYRP
FT                   EKSISEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNLLGKSQSGFIDSVGFELYSQ
FT                   LLEEAIAKRNGNANANTRTKGNAELILQIDAYLPDTYISDQRHKIEIYKKIRQIDNRVN
FT                   YEELQEELIDRFGEYPDVVAYLLEIGLVKSYLDKVFVQRVERKDNKITIQFEKVTQRLF
FT                   LAQDYFKALSVTNLKAGIVENKGLMELVFDVQNKKDYEILEGLLIFGESLLEIKESKEE
FT                   NSI"
FT   gene            8519..8785
FT                   /locus_tag="SPAP_0007"
FT   CDS_pept        8519..8785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0007"
FT                   /product="ribosome-associated heat shock protein"
FT                   /note="Operon 3 Gene 4 COG1188 Ribosome-associated heat
FT                   shock protein implicated in the recycling of the 50S
FT                   subunit (S4 paralog)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83607"
FT                   /protein_id="ADM83607.1"
FT                   /translation="MRLDKYLKVSRIIKRRTVAKEVADKGRIKVNGILAKSSTDLKVND
FT                   QVEIRFGNKLLLVKVLEMKDSTKKEDAAGMYEIISETRVEENV"
FT   gene            8778..9146
FT                   /locus_tag="SPAP_0008"
FT   CDS_pept        8778..9146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0008"
FT                   /product="Septum formation initiator"
FT                   /note="Operon 3 Gene 5 COG2919 Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83608"
FT                   /protein_id="ADM83608.1"
FT                   /translation="MSKNIVQLNNSFIQNEYQRRRYLMKERQKRNRFMGGVLILIMLLF
FT                   ILPTFNLAQSYQQLLQRRQQLADLQTQYQTLSDEKDKETAFATKLKDEDYAAKYTRAKY
FT                   YYSKSREKVYTIPDLLQR"
FT   gene            9151..9273
FT                   /locus_tag="SPAP_0009"
FT   CDS_pept        9151..9273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0009"
FT                   /product="hypothetical protein"
FT                   /note="Operon 3 Gene 6 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83609"
FT                   /protein_id="ADM83609.1"
FT                   /translation="MENLLDVIEQFLSLSDEKLEELADKNQLLRLQKEKERKNA"
FT   gene            9266..10534
FT                   /locus_tag="SPAP_0010"
FT   CDS_pept        9266..10534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0010"
FT                   /product="Beta-lactamase class A"
FT                   /note="Operon 3 Gene 7 COG2367 Beta-lactamase class A"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83610"
FT                   /protein_id="ADM83610.1"
FT                   /translation="MRKFLIILLLPSFLTISKVVSTEKEVVYTSKEIYYLSQSDFGIYF
FT                   REKLSSPMAYGEVPVYANEDLVVESGKLTPKTSFQITEWRLNKQGIPVFKLSNHQFIAA
FT                   DKRFLYDQSEVTPTIKKVWLESDFKLYNSPYDLKEVKSSLSAYSQVSIDKTMFVEGREF
FT                   LHIDQAGWVAKESTSEEDNRMSKVQEMLSEKYQKDSFSIYVKQLTTGKEAGINQDEKMY
FT                   AASVLKLSYLYYTQEKINEGLYQLDTTVKYVSAVNDFPGSYKPEGSGSLPKKEDNKEYS
FT                   LKDLITKVSKESDNVAHNLLGYYISNQSDATFKSKMSAIMGDDWDPKEKLISSKMAGKF
FT                   MEAIYNQNGFVLESLTKTDFDSQRIAKGVSVKVAHKIGDADEFKHDTGVVYADSPFILS
FT                   IFTKNSDYDTISKIAKDVYEVLK"
FT   gene            10531..11808
FT                   /locus_tag="SPAP_0011"
FT   CDS_pept        10531..11808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0011"
FT                   /product="Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /note="Operon 3 Gene 8 COG0037 Predicted ATPase of the
FT                   PP-loop superfamily implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83611"
FT                   /protein_id="ADM83611.1"
FT                   /translation="MREPDFLNHFLKKGYFKKHAKAVLALSGGLDSMFLFKVLSTYQKE
FT                   LEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFSEARARNFRYDFFQ
FT                   EVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQ
FT                   KKDFPSIFHFEDTSNQENHYFRNRIRNSYLPELEKENPRFRDAILGIGNEILDYDLAIA
FT                   ELSNNINVEDLQQLFSYSESTQRVLLQTYLNRFPDLNLTKAQFAEVQQILKSKSQYRHP
FT                   IKNGYELIKEYQQFQICKISPQADEEEDEFVLHYQNQVAYQGYLFSFGLPLEGESIQQI
FT                   PVSRETSIHIRHRKTGDVLIQNGHRKKLRRLFIDLKIPMEKRNSALIIEQFGEIVSILG
FT                   IATNNLSKKTKNDIMNTVLYIEKIDR"
FT   gene            11812..12354
FT                   /locus_tag="SPAP_0012"
FT   CDS_pept        11812..12354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0012"
FT                   /product="Hypoxanthine-guanine phosphoribosyltransferase"
FT                   /note="Operon 3 Gene 9 COG0634 Hypoxanthine-guanine
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83612"
FT                   /protein_id="ADM83612.1"
FT                   /translation="MLENDIKKVLVSHDEITEAAKKLGAQLTKDYAGKNPILVGILKGS
FT                   IPFMAELVKHIDTHIEMDFMMVSSYHGGTASSGVINIKQDVTQDIKGRHVLFVEDIIDT
FT                   GQTLKNLRDMFKAREAASVKIATLLDKPEGRVVEIEADYTCFTIPNEFVVGYGLDYKEN
FT                   YRNLPYIGVLKEEVYSN"
FT   gene            12370..14328
FT                   /locus_tag="SPAP_0013"
FT   CDS_pept        12370..14328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0013"
FT                   /product="ATP-dependent Zn protease"
FT                   /note="Operon 3 Gene 10 COG0465 ATP-dependent Zn proteases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83613"
FT                   /protein_id="ADM83613.1"
FT                   /translation="MKKQNNGLIKNPFLWLLFIFFLVTGFQYFYSGNNSGGSQQINYTE
FT                   LVQEITDGNVKELTYQPNGSVIEVSGVYKNPKTSKEGTGIQFFTPSVTKVEKFTSTILP
FT                   ADTTVSELQKLATDHKAEVTVKHESSSGIWINLLVSIVPFGILFFFLFSMMGNMGGGNG
FT                   RNPMSFGRSKAKAANKEDIKVRFSDVAGAEEEKQELVEVVEFLKDPKRFTKLGARIPAG
FT                   VLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAAPA
FT                   IIFIDEIDAVGRQRGVGLGGGNDEREQTLNQLLIEMDGFEGNEGIIVIAATNRSDVLDP
FT                   ALLRPGRFDRKVLVGRPDVKGREAILKVHAKNKPLAEDVDLKLVAQQTPGFVGADLENV
FT                   LNEAALVAARRNKSIIDASDIDEAEDRVIAGPSKKDKTVSQKERELVAYHEAGHTIVGL
FT                   VLSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDMKEQLAGLMGGRVAEEIIFNV
FT                   QTTGASNDFEQATQMARAMVTEYGMSEKLGPVQYEGNHAMFGAQNPQKSISEQTAYEID
FT                   EEVRSLLNEARNKAAEIIQSNRETHKLIAEALLKYETLDSTQIKALYETGKMPEAVEEE
FT                   SHALSYDEVKSKMNDEK"
FT   gene            14450..14713
FT                   /locus_tag="SPAP_0014"
FT   CDS_pept        14450..14713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0014"
FT                   /product="hypothetical protein"
FT                   /note="Operon 4 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83614"
FT                   /protein_id="ADM83614.1"
FT                   /translation="MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISRE
FT                   ERLVDDIPRLRKYFITKFRNRILDYIRSRRVISVDTMKNPYV"
FT   gene            15025..15096
FT                   /locus_tag="SPAP_0015"
FT   tRNA            15025..15096
FT                   /locus_tag="SPAP_0015"
FT                   /product="tRNA-Glu"
FT                   /note="anticodon TTC"
FT   gene            15364..16894
FT                   /locus_tag="SPAP_0016"
FT   rRNA            15364..16894
FT                   /locus_tag="SPAP_0016"
FT                   /product="16S ribosomal RNA"
FT                   /note="similar to INSD AJ295848"
FT   gene            16947..17019
FT                   /locus_tag="SPAP_0017"
FT   tRNA            16947..17019
FT                   /locus_tag="SPAP_0017"
FT                   /product="tRNA-Ala"
FT                   /note="anticodon TGC"
FT   gene            17144..20045
FT                   /locus_tag="SPAP_0018"
FT   rRNA            17144..20045
FT                   /locus_tag="SPAP_0018"
FT                   /product="23S ribosomal RNA"
FT                   /note="similar to INSD AB168128"
FT   gene            20115..20262
FT                   /locus_tag="SPAP_0019"
FT   rRNA            20115..20262
FT                   /locus_tag="SPAP_0019"
FT                   /product="5S ribosomal RNA"
FT                   /note="similar to INSD CP001033"
FT   gene            20243..20316
FT                   /locus_tag="SPAP_0020"
FT   tRNA            20243..20316
FT                   /locus_tag="SPAP_0020"
FT                   /product="tRNA-Asn"
FT                   /note="anticodon GTT"
FT   gene            complement(20410..20727)
FT                   /locus_tag="SPAP_0021"
FT   CDS_pept        complement(20410..20727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0021"
FT                   /product="Transposase-like protein"
FT                   /note="Operon 5 Gene 1 COG3464 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83615"
FT                   /protein_id="ADM83615.1"
FT                   /translation="MHLTNKEILDKLLSYSEDLKHHYNLYQLLLFHLFFRLCLKPSSKI
FT                   KKKSSTAFNYLIPTPNWKPPIISSNLSSTMPLVLGTLKTSKKKGRNLSFLKLSFSSTHY
FT                   S"
FT   gene            complement(20951..21157)
FT                   /locus_tag="SPAP_0022"
FT   CDS_pept        complement(20951..21157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0022"
FT                   /product="Transposase-like protein"
FT                   /note="Operon 6 Gene 1 COG3464 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83616"
FT                   /protein_id="ADM83616.1"
FT                   /translation="MRVAETSIVKKNHQIPCIINQKIAQKLIKKTSMTDIDHQLSISTS
FT                   TVIRKINDFHFEHDFSRLPEIMS"
FT   gene            21473..21709
FT                   /locus_tag="SPAP_0023"
FT   CDS_pept        21473..21709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0023"
FT                   /product="hypothetical protein"
FT                   /note="Operon 7 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83617"
FT                   /protein_id="ADM83617.1"
FT                   /translation="MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRY
FT                   GIGCRRDFIVYHYRVAYRLYLEKLVMNRGFISC"
FT   gene            21898..23226
FT                   /locus_tag="SPAP_0024"
FT   CDS_pept        21898..23226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0024"
FT                   /product="Adenylosuccinate synthase"
FT                   /note="Operon 7 Gene 2 COG0104 Adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83618"
FT                   /protein_id="ADM83618.1"
FT                   /translation="MYVRKEEPEGSDKIMTSVVVVGTQWGDEGKGKITDFLSANAEVIA
FT                   RYQGGDNAGHTIVIDGKKFKLHLIPSGIFFPEKISVIGNGMVVNPKSLVKELSYLHEEG
FT                   VTTDNLRISDRAHVILPYHIELDRLQEEAKGDNKIGTTIKGIGPAYMDKAARVGIRIAD
FT                   LLDKDIFRERLERNLAEKNRLFEKLYDSKAIVFDDIFEEYYEYGQQIKKYVIDTSVILN
FT                   DALDNGKRVLFEGAQGVMLDIDQGTYPFVTSSNPVAGGVTIGSGVGPSKIDKVVGVCKA
FT                   YTSRVGDGPFPTELFDEVGERIREVGHEYGTTTGRPRRVGWFDSVVMRHSRRVSGITNL
FT                   SLNSIDVLSGLDTVKICVAYDLDGQRIDYYPASLEQLKRCKPIYEELPGWSEDITGVRN
FT                   LEDLPENARNYVRRVSELVGVRISTFSVGPGREQTNILESVWS"
FT   gene            complement(23468..24616)
FT                   /locus_tag="SPAP_0025"
FT                   /note="PhiSpn_200p01"
FT   CDS_pept        complement(23468..24616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0025"
FT                   /product="Integrase"
FT                   /note="Operon 8 Gene 1 COG0582 Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83619"
FT                   /protein_id="ADM83619.1"
FT                   /translation="MKYNKTKYPNIYYYETAKGKRYYVRRSFFFRGKKREKSKSGFTTL
FT                   PQARAALVELEQQIQEQELGINTNLTLDQYWDIYSEKRLSTGRWNDTSYYLNDNLYKNH
FT                   IKAKFGSTLLKNLDRNEYELFIAEKLQNHTRYTVQTLNSSFMALLNDAVKNGNLLSNRL
FT                   KGVFIGQSDIPAANKKVTLKEFKTWIAKAEEIMPKQFYALTYLTIFGLRRGEVFGLRPM
FT                   DITQNDSGRAILHLRDSRSNQTLKGKGGLKTKDSERYVCLDDIGTDLIYYLIAEASKIK
FT                   RKLGIIKEQHKDYITINEKGGLINPNQLNRNFNLVNEATGLHVTPHMMRHFFTTQSIIA
FT                   GVPLEQLSQALGHTKVYMTDRYNQVEDELAEATTDLFLSHIR"
FT   gene            complement(24787..25587)
FT                   /locus_tag="SPAP_0026"
FT                   /note="PhiSpn_200p02"
FT   CDS_pept        complement(24787..25587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0026"
FT                   /product="hypothetical protein"
FT                   /note="Operon 9 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83620"
FT                   /protein_id="ADM83620.1"
FT                   /translation="MGWVKNPKKAMYNKVYHKTTFGLSDLFKSSKKRKKKVVNNKQQSI
FT                   LASNGKKQHTSKEYKEAGLVFMVLGAIFLFLFLPLGFFLFITGFITYIIGLLTANREKK
FT                   KKVENYSPQIDTTVFRDDFLLMGTNYHQEEAEIAADFLSKGVHYFGKDNKSLKSYMLET
FT                   YKPVYKYNKLKTVDVHLLPEPSNPHDKNAVKVLVNNIFVGYLPAMIATQVSSYISNPNY
FT                   RYDAILTGRGGPYKTLNIETERVVSRKSDLTYYLDLTVWRLAKK"
FT   gene            complement(25714..26469)
FT                   /locus_tag="SPAP_0027"
FT                   /note="PhiSpn_200p03"
FT   CDS_pept        complement(25714..26469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0027"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="Operon 9 Gene 2 COG2932 Predicted transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83621"
FT                   /protein_id="ADM83621.1"
FT                   /translation="MSNNKSKEIFSANLEKLMTSRGVDRNKLCSDLGLKYTTVRDWLKG
FT                   ITYPRIGKIELLADYFGVNKSDLIEDKTQEVKEVKIPTSPLVQKVTEKVVKLSTPRKQK
FT                   VLNYANEQLKEQNNKVIMIEEKLFEYKVYEKLSAGTGFSYFNDGNYDTVFYDKDLDHDF
FT                   ASWVFGDSMEPKYMNGEVVLIKETGFDYDGAVYAVDWDGQTYIKKVYKEKDGLRLVSIN
FT                   NKYKDKFAPFEEDPRIIGKIVGNFMPIEN"
FT   gene            26643..26849
FT                   /locus_tag="SPAP_0028"
FT                   /note="PhiSpn_200p04"
FT   CDS_pept        26643..26849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0028"
FT                   /product="hypothetical protein"
FT                   /note="Operon 10 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83622"
FT                   /protein_id="ADM83622.1"
FT                   /translation="MQKMTLKTLRTLKNWRQADAAEAIDVSVDTWGNWERGKTEPTVTQ
FT                   AYQIATTFGVSIDDIIFLHNIAV"
FT   gene            26871..27032
FT                   /locus_tag="SPAP_0029"
FT                   /note="PhiSpn_200p05"
FT   CDS_pept        26871..27032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83623"
FT                   /protein_id="ADM83623.1"
FT                   /translation="MNELVWFYFTIIINIVIGFATYYASKRDRKKRINGFKKIQDDELE
FT                   RVRKKFDL"
FT   gene            27066..27194
FT                   /locus_tag="SPAP_0030"
FT                   /note="PhiSpn_200p06"
FT   CDS_pept        27066..27194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0030"
FT                   /product="hypothetical protein"
FT                   /note="Operon 11 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83624"
FT                   /protein_id="ADM83624.1"
FT                   /translation="MNELERTALNEVLRTVAYIAEKLDKIENAMLTYQEADKHPKD"
FT   gene            complement(27157..27834)
FT                   /locus_tag="SPAP_0031"
FT                   /note="PhiSpn_200p07"
FT   CDS_pept        complement(27157..27834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0031"
FT                   /product="hypothetical protein"
FT                   /note="Operon 12 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83625"
FT                   /protein_id="ADM83625.1"
FT                   /translation="MYVPIKPTGDFSTNFTLSDSCKICKNITCPTVVNETTQSIDNDHY
FT                   RFCATRYCQQCNHYFVDEIEVTITVDSFANIDYQYDILDVKPELPSDIPISKELAKLSP
FT                   IGKEIYTQALKAEQEKLDHIAGIGFRKSLEFFVKDFVISFELENKDKVAKMPLKQVIDN
FT                   YIDNKTLKTFATATVYIGNDETHYTKKHSDKDLQDLKKFLHGFLHYMEMQLNLLDAYQL
FT                   LDR"
FT   gene            27889..28602
FT                   /locus_tag="SPAP_0032"
FT                   /note="PhiSpn_200p08"
FT   CDS_pept        27889..28602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0032"
FT                   /product="Prophage antirepressor"
FT                   /note="Operon 13 Gene 1 COG3617 Prophage antirepressor"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83626"
FT                   /protein_id="ADM83626.1"
FT                   /translation="MNEIFNFHGQEVRTLTIDDEPWFVGKDVADILGYAKPLDAISRHV
FT                   DEDDSVKYGLTDNLGRTQNTIIINESGLYSLILSSKLPQAKEFKRWVTSEVLPAIRKQG
FT                   GFIREDLDEDAFIALFTGQKKLREQQTSMLEDIDYLKSEQPIHPSYAQSLLKKRKARVV
FT                   ACLGGIDSPAYADKIFAQSVFRQAEIDFKDHFNISRYDLLPKKHADAALAYWMTWEPST
FT                   NTKMKIMKLNSFDEG"
FT   gene            28615..28872
FT                   /locus_tag="SPAP_0033"
FT                   /note="PhiSpn_200p09"
FT   CDS_pept        28615..28872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0033"
FT                   /product="hypothetical protein"
FT                   /note="Operon 13 Gene 2 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83627"
FT                   /protein_id="ADM83627.1"
FT                   /translation="MDNVLLSLSEWIKSIIKDTITRLVEIEKDSDHYPELMDVNTTCEF
FT                   LGIKYATFSDNYRYLKGFPKELPGKKWSKRAIKEWLSNQI"
FT   gene            28958..29278
FT                   /locus_tag="SPAP_0034"
FT                   /note="PhiSpn_200p10"
FT   CDS_pept        28958..29278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0034"
FT                   /product="hypothetical protein"
FT                   /note="Operon 14 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83628"
FT                   /protein_id="ADM83628.1"
FT                   /translation="MFEPPILDQLMGVGALLLGFAGACRHIKLQEQRKEEERREEQEFA
FT                   SMIIQGYNHAYERGREAERQEIRKNIRRPFKGFTYDNEPPQGLRPEPLALPEPKQSAIR
FT                   FL"
FT   gene            29294..29587
FT                   /locus_tag="SPAP_0035"
FT                   /note="PhiSpn_200p11"
FT   CDS_pept        29294..29587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0035"
FT                   /product="hypothetical protein"
FT                   /note="Operon 14 Gene 2 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83629"
FT                   /protein_id="ADM83629.1"
FT                   /translation="MEELIEWLETKEKLNREMISDEETSDFNLHLENDNDTMFMIKEYL
FT                   NDYNKLAKDYRILSSENRLLKLEKMELEGRHIYEDMRMKYRANRRKWGARYV"
FT   gene            29571..30407
FT                   /locus_tag="SPAP_0036"
FT                   /note="PhiSpn_200p12"
FT   CDS_pept        29571..30407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0036"
FT                   /product="hypothetical protein"
FT                   /note="similar to gp19 of Streptococcus mitis phage SM1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83630"
FT                   /protein_id="ADM83630.1"
FT                   /translation="MLGMSEIKWIKIKTDIFDDEKMCLIDASPDRDAIIVIWIKLITLA
FT                   GKLNTKGVLTISKNIVYTDEMLAQTFHRPLNTVRMALEVFEKFGMVEKIDGVIMLPNWE
FT                   KHQNIDGMEKIKEQNRNRAARHRQKQKLLAQNNESNVTDNVMDNVTVTHGNALDKELDK
FT                   DIEINNNKVMISSSLSENLKNSGIHLTDKSHQQLLDYVGLDGMSFDMLNRAVEKTSGSH
FT                   KPSFNYLIAILESWKKKGFTSIEQVDEDDRKYKEGKKSRQQNDKTSEQEVRDEWGF"
FT   gene            30395..30553
FT                   /locus_tag="SPAP_0037"
FT                   /note="PhiSpn_200p13"
FT   CDS_pept        30395..30553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0037"
FT                   /product="hypothetical protein"
FT                   /note="Operon 14 Gene 4 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83631"
FT                   /protein_id="ADM83631.1"
FT                   /translation="MGILELIEQFEIDYYPLSYEKKTLLADQPIHQVVACLSEMTSWHE
FT                   CGGRLVW"
FT   gene            30547..31317
FT                   /locus_tag="SPAP_0038"
FT                   /note="PhiSpn_200p14"
FT   CDS_pept        30547..31317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0038"
FT                   /product="DNA replication protein"
FT                   /note="Operon 14 Gene 5 COG1484 DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83632"
FT                   /protein_id="ADM83632.1"
FT                   /translation="MVDNVFEEIALSYRRNTEQQEEFCEKHNIPLIKILRTESVVCRMC
FT                   ESERIHEENQERVNELANAENERERKYYLEKFSLYDEVLKNATLDNFETPTEKEAEKLA
FT                   FAKRICREWSEGARNNIVLQGEAGTGKSHLAFAMVKALSEYTKEIAIFINVTDLLMKIK
FT                   ADFSQEEFLVNKIASAKFLVLDDLGMEKDSEWSFTILYNILNKRSNTIITTNLISTDIQ
FT                   KRYGRPFMSRLMKGVDKDHLMVFNDLTNKRKQYF"
FT   gene            31332..31526
FT                   /locus_tag="SPAP_0039"
FT                   /note="PhiSpn_200p15"
FT   CDS_pept        31332..31526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0039"
FT                   /product="hypothetical protein"
FT                   /note="Operon 14 Gene 6 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83633"
FT                   /protein_id="ADM83633.1"
FT                   /translation="MFILKHGTREDKPFLRSAIISVTGLDISCSEEKKAMRFISRAAAL
FT                   QVSKALRGSFGNFYPVEVE"
FT   gene            31526..31753
FT                   /locus_tag="SPAP_0040"
FT                   /note="PhiSpn_200p16"
FT   CDS_pept        31526..31753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0040"
FT                   /product="hypothetical protein"
FT                   /note="Operon 14 Gene 7 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83634"
FT                   /protein_id="ADM83634.1"
FT                   /translation="MLELYFVYNGHCKFYLGTFDNVDDLIEQMEDHQWAFSAITHPRFQ
FT                   KHIGQRTTRFDYGSKDCYYLATFSGGEKND"
FT   gene            31746..31850
FT                   /locus_tag="SPAP_0041"
FT                   /note="PhiSpn_200p17"
FT   CDS_pept        31746..31850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0041"
FT                   /product="hypothetical protein"
FT                   /note="Operon 14 Gene 8 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83635"
FT                   /protein_id="ADM83635.1"
FT                   /translation="MIELIKEFGMAILWLFLGYLVGERAARKEKKDDQ"
FT   gene            31938..32147
FT                   /locus_tag="SPAP_0042"
FT                   /note="PhiSpn_200p18"
FT   CDS_pept        31938..32147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0042"
FT                   /product="hypothetical protein"
FT                   /note="Operon 14 Gene 9 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83636"
FT                   /protein_id="ADM83636.1"
FT                   /translation="MNYDKRTVIDGLKRTIEQNEEKIIEYSKPCDARKRRIRALERDLL
FT                   KKKNKELRRKAEELEDDGRVKEKS"
FT   gene            32119..32436
FT                   /locus_tag="SPAP_0043"
FT                   /note="PhiSpn_200p19"
FT   CDS_pept        32119..32436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0043"
FT                   /product="hypothetical protein"
FT                   /note="Operon 14 Gene 10 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83637"
FT                   /protein_id="ADM83637.1"
FT                   /translation="MMEELKKKVNAVYNWTVEDGKPQPPQQDLPQAVKERVDYFWEMAE
FT                   DGMTFMGAMECIFADEKPTDYDLGATKDWLPKSKEFDDWVGYSPSMAQVVIAVYLIYGG
FT                   N"
FT   gene            32438..33133
FT                   /locus_tag="SPAP_0044"
FT                   /note="PhiSpn_200p20"
FT   CDS_pept        32438..33133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0044"
FT                   /product="hypothetical protein"
FT                   /note="Operon 14 Gene 11 Putative gene predicted by
FT                   FgenesB; PhiSpn_200p20"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83638"
FT                   /protein_id="ADM83638.1"
FT                   /translation="MNIKALIKKYEAVECVVGIVSGKTILKTVLRDLEQLDEPQKVKVP
FT                   QFVAEWIEEARKACKDVAELFEFDFTNDEVRKWFMQERPFDLVARAWLDGYEVEKEKRY
FT                   FVSLNNGQPLTKTQSGKVLYFNQNIITGNYKFTRKELEEGMKNQSKRIKIPMEIRPFDV
FT                   GYRIVNKHGQALALKNGASIFALPSLAEKAIKKEFSKNDPDFDIEKHFVEEVAIVNLSK
FT                   FHSYFEDRV"
FT   gene            33371..33724
FT                   /locus_tag="SPAP_0045"
FT                   /note="PhiSpn_200p21"
FT   CDS_pept        33371..33724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0045"
FT                   /product="hypothetical protein"
FT                   /note="Operon 15 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83639"
FT                   /protein_id="ADM83639.1"
FT                   /translation="MQLRLKELREELCLSVGQMAKETGVSQNTIHLYERGGYPSIKQIE
FT                   MIAKTYDVNPAWLVGWIDDEMMHGVQVVEKVVYKESPTARLPDYFNNNNEGKIIKWVKT
FT                   KRYMGGKVWAKRT"
FT   gene            33706..34170
FT                   /locus_tag="SPAP_0046"
FT                   /note="PhiSpn_200p22"
FT   CDS_pept        33706..34170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0046"
FT                   /product="hypothetical protein"
FT                   /note="Operon 15 Gene 2 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83640"
FT                   /protein_id="ADM83640.1"
FT                   /translation="MGKKNLITARRDYLEFELNDKYLQIDKLIGQRRHELERLYEVKHL
FT                   TVPGIDDTGASGSGTFVNRSENLAVAYASDPMVLRLENFQTAISKLLDVLEPDDKKIFH
FT                   LKWGEHTRYDWIQVWHKMENGDTGYLYRHSKQIYRRREIILDTLAKLLFM"
FT   gene            34279..34821
FT                   /locus_tag="SPAP_0047"
FT                   /note="PhiSpn_200p23"
FT   CDS_pept        34279..34821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0047"
FT                   /product="Integrase"
FT                   /note="Operon 16 Gene 1 COG0582 Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83641"
FT                   /protein_id="ADM83641.1"
FT                   /translation="MNIVEPLRDKDDIQAMKDYLSSWNEKYYMLFLLGINTGFRVGDIL
FT                   KLKVKDVQGWHIKVREQKTGKYKSIKMTRPLKNELREFVKDKELHEYLFQSRVGKNKAL
FT                   SYKTVYWFLKRAAEDLGIDNVGTHTMRKTFGYHYYKKYKNVADLMSLFNHSSPAVTLIY
FT                   ICVRQDELDTKMSNFSL"
FT   gene            35027..35254
FT                   /locus_tag="SPAP_0048"
FT                   /note="PhiSpn_200p24"
FT   CDS_pept        35027..35254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83642"
FT                   /protein_id="ADM83642.1"
FT                   /translation="MNLIYLYHAKNSESKSRYVLFLLEVSMRPKRYPYSLTSEILVETS
FT                   IIYAWDKPMYKMISFMNRYTREIRVESFKL"
FT   gene            35251..35568
FT                   /locus_tag="SPAP_0049"
FT                   /note="PhiSpn_200p25"
FT   CDS_pept        35251..35568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0049"
FT                   /product="HNH endonuclease family protein"
FT                   /note="similar to SAG1857 prophage LambdaSa2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83643"
FT                   /protein_id="ADM83643.1"
FT                   /translation="MTFKNPKHSDWFRSWQIKFYNSKPWRTLRNRIRTTKRMRCDVCGR
FT                   LIHGKSIVDHIIEIDETNYQDESITLNEDNLQLLCLECHNTKTFQSKINLNLENRNINL
FT                   F"
FT   gene            35705..36190
FT                   /locus_tag="SPAP_0050"
FT                   /note="PhiSpn_200p26"
FT   CDS_pept        35705..36190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0050"
FT                   /product="hypothetical protein"
FT                   /note="Operon 18 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83644"
FT                   /protein_id="ADM83644.1"
FT                   /translation="MILKINEVLEKLGISRATLTRYRKKLGIFEETRSNITKSQFKELE
FT                   KLANQRQKYTREERVELSRKTFKLIPKEKMLEINDNDSVGLKNLKTQYNHNQKVIENFQ
FT                   LEINKVINDGELPDKYLLDGMEKYQKLNMQIMSTIEKQSPQGDSLKEMIQEKLARYG"
FT   gene            36183..37895
FT                   /locus_tag="SPAP_0051"
FT                   /note="PhiSpn_200p27"
FT   CDS_pept        36183..37895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0051"
FT                   /product="Phage terminase-like protein, large subunit"
FT                   /note="Operon 18 Gene 2 COG4626 Phage terminase-like
FT                   protein, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83645"
FT                   /protein_id="ADM83645.1"
FT                   /translation="MVEMRYFDKYAQLVYSGKIRVCELTMKSIKRVERYKEQYIFKQEE
FT                   VDKRIEFIEEECSNTKGLAGKLHLALPQKVWLETTWGFYHTVEVTKTDPDTLEEYKDFE
FT                   ERRLIHEVPIIVPRGTGKTTLGSAIGEVGQIIDGEWGADIQLLAYSREQAGYLFNASRA
FT                   MLSNEESLLHYMREADILRSTKQGILYETTNSLMSIKTSDYESLDGTNAHYNIFDEVHT
FT                   YDDDFIKVVNDGSSRKRKNWITWYISTNGTKRDKLFDKYYNIWVDILDEKIVNHSVMPW
FT                   IYQLDDVSEIHNPDMWQKAMPLLGITTEKETIAKDIEMSKNDPAQQAELMAKTFNLPVN
FT                   NYLAYFSNEECKGWLDKFDKSLFVGNEERSARCVLGVDLSDVNDICSVSFMVVRGEERQ
FT                   YLNKKFMPRHTIEGLPKELRDKYAEWELSGQLHVHELDYNDQAYIFEELRQFMSENRIL
FT                   PVAVGYDRWNAKELIRLINDYYGDICHDIPQTVKSLSNPLKVYKEKAKMGKIIFDDPVA
FT                   TWNHANVRVKIDANNNVFPNKEKAKEKIDVFASQLDAFICYENFKEDLSYYFD"
FT   gene            37904..39046
FT                   /locus_tag="SPAP_0052"
FT                   /note="PhiSpn_200p28"
FT   CDS_pept        37904..39046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0052"
FT                   /product="hypothetical protein"
FT                   /note="similar to SAG1854 prophage LambdaSa2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83646"
FT                   /protein_id="ADM83646.1"
FT                   /translation="MNKYINNLREVFARIFRPSNRKSTRTYLQRNLNYWRRNSIYLDNI
FT                   YNKISTDTAQVRFKHVRITRNPTGVDKMEWFENSDLANVLSFSPNPLEIPVVFWANVTR
FT                   AMLKDGVAVVVPRWENGRLIEIWFAKKTISWTAERVEIMIDDVEIELPLSDVWVFENPK
FT                   LNVTSQLNQITELIDINLDALTEKLGRGNSKLRGFLKLPTKAADEHLKKQAKSRVDSMM
FT                   ELAEIGGIAYLEQGEEFMELNKDYSTASKEEMEFLKSQLYHAHGINEKLFTCDYTEEQY
FT                   RAYYSSVMKLYQRVFSEEINRKYFTKTARTQGNKLLVFFDMADMISFKDLVEGGFKSKY
FT                   AGLMNSNEFRETYLGLPGYEGGEVFETNLNAVRIEPSESN"
FT   gene            39093..39635
FT                   /locus_tag="SPAP_0053"
FT                   /note="PhiSpn_200p29"
FT   CDS_pept        39093..39635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0053"
FT                   /product="Phage head maturation protease"
FT                   /note="Operon 19 Gene 2 COG3740 Phage head maturation
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83647"
FT                   /protein_id="ADM83647.1"
FT                   /translation="MEKLKTFVVKSVEEESADFHFEAYASTYGNTDRDGDVMAKGCFDN
FT                   TLKTKAVVPMCLNHDRNRVIGKHELSVDEKGLRTRSTFNLSDPEAKKTYDLMKMGALDS
FT                   LSIGFFINDYEPVDAKQPYGGWIFKEVEIFEISVVTVPANPQATIDNIKGFDMSVVDKR
FT                   IAQANMKQDIMSKLATI"
FT   gene            39650..40903
FT                   /locus_tag="SPAP_0054"
FT                   /note="PhiSpn_200p30"
FT   CDS_pept        39650..40903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0054"
FT                   /product="hypothetical protein"
FT                   /note="Operon 19 Gene 3 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83648"
FT                   /protein_id="ADM83648.1"
FT                   /translation="MKTLVELMEERQKHADELSEIKFKKASIEEKLESATIGEEELAQL
FT                   KSDAEGLVSKADELKNTISKLDVEIEEKQDNLNKAAKSIKEVQKGKIQMEYLKTKEAAL
FT                   DFARILMDNEGSSNSARKAWEANLVEKGVTDVNKILPEPVLIAIQNAFNDYDGILNHVT
FT                   KDPRYAVRVALQTQQAKAKGHQNGKTKKDESFVFIDYTINSAAVYIKYSFEYADLKKDT
FT                   TGAYFNYVMNELAQGFIRAVERAVVIGDGKNSDDDDKITEIKSIAEETLAQLFDTQEIS
FT                   VDGEFDSTVLENLVKGIDKLAANTTPILVTSKTIARKLKMVKDGEKRYIDPQPFAPISQ
FT                   TGNVIAGYQVYVYDWMEDATNPIIAFADKAYKMIGDDVSADRFEDYDVTMNRRHIELAS
FT                   VLGGRLGQYKSAVKFTKG"
FT   gene            40929..41264
FT                   /locus_tag="SPAP_0055"
FT                   /note="PhiSpn_200p31"
FT   CDS_pept        40929..41264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0055"
FT                   /product="hypothetical protein"
FT                   /note="Operon 19 Gene 4 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83649"
FT                   /protein_id="ADM83649.1"
FT                   /translation="MTILNQIKEMVEVDVEEEIFDTQFLSYINSGISYLTRNNIPINRI
FT                   DKESELTEWNEIEEDDKETILDWLHLRCVQRFDKSLMTGNSTTRSWIDEELTNILYQLK
FT                   AIYGVKS"
FT   gene            41261..41566
FT                   /locus_tag="SPAP_0056"
FT                   /note="PhiSpn_200p32"
FT   CDS_pept        41261..41566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0056"
FT                   /product="hypothetical protein"
FT                   /note="Operon 19 Gene 5 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83650"
FT                   /protein_id="ADM83650.1"
FT                   /translation="MKSSRVSIILCYDERTEVEKGVFEKQVVEKKVKAEKEKIYQRRLD
FT                   KALADGQVLTARFRIRSNYVTDSLDYVKYKGKEYKVNVGTESDDDHYTIIELGELK"
FT   gene            41566..41913
FT                   /locus_tag="SPAP_0057"
FT                   /note="PhiSpn_200p33"
FT   CDS_pept        41566..41913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0057"
FT                   /product="hypothetical protein"
FT                   /note="Operon 19 Gene 6 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83651"
FT                   /protein_id="ADM83651.1"
FT                   /translation="MAKKFFTRQEIQEILEKNTLKSKVFYMEREEKSSPDNVILYYRLT
FT                   PGSSITADDTVHMRKVTIQISHYHKKKLDSIEELMLSNFMCEPSQLNLKQPDTDYLLTT
FT                   YRIEVFTSGKW"
FT   gene            41900..42244
FT                   /locus_tag="SPAP_0058"
FT                   /note="PhiSpn_200p34"
FT   CDS_pept        41900..42244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0058"
FT                   /product="hypothetical protein"
FT                   /note="Operon 19 Gene 7 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83652"
FT                   /protein_id="ADM83652.1"
FT                   /translation="MGSGSVNAKTLKIDIQNQVLEIIEKSGKSTAGDIRDGSPRRNGVY
FT                   EKGWTHETIEDIAVVYNNGKEKSLAHLLENGHATKNGGFVAPQEHIRPAYLKNKEIFLN
FT                   NMKSIKIRPN"
FT   gene            42258..42926
FT                   /locus_tag="SPAP_0059"
FT                   /note="PhiSpn_200p35"
FT   CDS_pept        42258..42926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0059"
FT                   /product="hypothetical protein"
FT                   /note="Operon 19 Gene 8 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83653"
FT                   /protein_id="ADM83653.1"
FT                   /translation="MTYKYDTREVTHGNTTGFFAKISKTESGTLDLKKPYPFTGLRKTS
FT                   FETSQESNAYYADNVEHVRLQGKKSTEGSITTYQIPKQFMIDHLGKKLTTSTPPALIDT
FT                   GVNANFIWGYAETVTDEFGSEVEEFHIWTNVKASAPKGSTTTDESSATPKEIEIPCTAS
FT                   PNNFILDSDKKPVSEIVWRDTDKGVVRAKFDKLFASSTPMKLIDFINEALGTTAIVPGG
FT                   "
FT   gene            42928..43404
FT                   /locus_tag="SPAP_0060"
FT                   /note="PhiSpn_200p36"
FT   CDS_pept        42928..43404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0060"
FT                   /product="hypothetical protein"
FT                   /note="Operon 19 Gene 9 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83654"
FT                   /protein_id="ADM83654.1"
FT                   /translation="MIKKELSFTAFDSYGEEREYTGTVRFLYSLPAIKMYEQRTGRNFF
FT                   DDNQKALTAYTQLALATGVNGRLSALTDEEKVKLMPLLMEPDFMNFLTEVIPCLYGEVE
FT                   NGRLVQNELTAETASLAPWFGDLIDIGFFSDLFYEFNRSRAKVPQDRKKPQQKS"
FT   gene            43443..43571
FT                   /locus_tag="SPAP_0061"
FT                   /note="PhiSpn_200p37"
FT   CDS_pept        43443..43571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0061"
FT                   /product="hypothetical protein"
FT                   /note="Operon 19 Gene 10 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83655"
FT                   /protein_id="ADM83655.1"
FT                   /translation="MDVFWAESQHFNYLMGTLHQMSINENEKKTLSNAELLNVMSD"
FT   gene            43591..46329
FT                   /locus_tag="SPAP_0062"
FT                   /note="PhiSpn_200p38"
FT   CDS_pept        43591..46329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0062"
FT                   /product="Phage-related minor tail protein"
FT                   /note="Operon 19 Gene 11 COG5280 Phage-related minor tail
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83656"
FT                   /protein_id="ADM83656.1"
FT                   /translation="MAETFEGLYVKFGANTVEFDRSVKGINNALSSLKKDFNNINRQLK
FT                   MDPDNVDLLNRKLLNLQEQARVGAMKIAELKKQQKELGESEVGSAQWNKLQLEISKVES
FT                   QMKVVDQTMNSTKKHIEDVGNPKSILNLNKEINNVAKELDIVNQKLELDPKNVELSEEK
FT                   MKLLGKQSSLAKDKVQELKRKQEELGKEKIGTEEWRQLQNEIGQAEVEVLKIDKAMGNL
FT                   GDSSRSATGNIKEATGYLKADVMMNIAEKAGQLGQKMVDAGKKTVGAWSEIDEAMDTVT
FT                   TKTGLTGEALLGLQEIAKGIATSLPSATFQESADAVGELNTQFGLTGDTLQSAAEYLLK
FT                   YSKITGEDISNSAINAKKAIDAYGLSNEDLARVLDSVTKVGQDTGQSYDSIFQKAIDGA
FT                   PQIKMLGLSFKEGATLIGRFEKSGIDSSAALASLSKATVNYAKDGKTLTEGLNETVNAI
FT                   QNATSKTEAIRIASEVFGNRAAPKMVDAIQRGAFSFNDLAEAAQNSSGTVATTFAETKD
FT                   PFDDLTTYSNKAKEGLAEIGGTLLETVIPALEPLMGMLESAVNWFTSLNETDQQTIVIL
FT                   GLVTTAVMLLLGAIAPLVIAIGAIGAPVGIVVAAIVAAIAAITLIIQAIMNWGTISEWL
FT                   QSTWDACAAWLSELWTNIVTTATTAWSSFTAWLSEIWSSVVSTGQSLWSSFTSTLSNIF
FT                   SSLISGAQSLWSSFTSTLSNLWSGLVSTGSNLFNNLSGTISGIFNGILSTASNIWNSIK
FT                   STISNAIDGAKNAVSNAIQAIKNLFNFNISWPHIPLPHFYVSGSANPLDWLSQGVPSIG
FT                   IEWYAKGGIMTKPTLFGMNGNRAMVGGEAGAEAILPLNKSTLGAIGQSIANTMNTSNSI
FT                   NINFSGVTIREEADLNRLADVVGTRIAEELQRKTNLRGGFA"
FT   gene            46326..47048
FT                   /locus_tag="SPAP_0063"
FT                   /note="PhiSpn_200p39"
FT   CDS_pept        46326..47048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0063"
FT                   /product="hypothetical protein"
FT                   /note="Operon 19 Gene 12 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83657"
FT                   /protein_id="ADM83657.1"
FT                   /translation="MTKINELIIDGVKTSSFKCEILVETRPQIIVSSSKTSLLEHDGIS
FT                   GAIVQSNRHRRLIEKSYHISLINPTDEDLYRFSSLLNREKFWLENEQEPSVKYWCYKVD
FT                   DFKIIKDDFGAWTVDVKFTCHPTKYFKGSDTQRLTRSGTLTVQGSALAFPKITIVGQSA
FT                   VETSFTIAGQVIRLEKLSESLVMVNNPDNPSFKTTTGKPVKWSGDFITVDPAKVKNIGV
FT                   VLGPGIQSIEIETVWGWA"
FT   gene            47049..56156
FT                   /locus_tag="SPAP_0064"
FT                   /note="PhiSpn_200p40"
FT   CDS_pept        47049..56156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0064"
FT                   /product="PblB, putative"
FT                   /function="Phage-related protein"
FT                   /note="Operon 19 Gene 13 COG4926 Phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83658"
FT                   /protein_id="ADM83658.1"
FT                   /translation="MLYLLNKDVRTVRWNGEPLHEATSAIVKETMNGDFTLTVKYPISD
FT                   SGIYQLIQEDMLIKAPTPVLGAQLFRIKKPVENNDHLEITAYHISDDVMQRSITPVSVT
FT                   SQSCGMALSRMVQNTKTALGDFSFNSDIQDRRTFNTTEIETLYSVLLDGKHSIVGTWEG
FT                   ELVRDNFAMTVKKSRGENRGVVITTHKNLKDYQRTKNSQNVVTRIHARSTFKPEGAEKE
FT                   TTIRVTVDSPLINSYPYINEKEYENNNAKSVEELQKWAQAKFSNEGIDKISDAIKIEAY
FT                   ELDGQVVHMGDTVNLKSWKHNVDVFKKAIAYEFDALKEEYISLILDDKAGAGGSRTSGG
FT                   LSSAAYAILGVTESAQEVALENALQNADLDFDHKAGLLRQEISDGIELAKAKAEEVKQE
FT                   LSDTINQRFNSFDNGPLKEAKRKAEEALRNAGASSSLAQESKRIGLDSVARLEAFKSQT
FT                   TSAQTALSGDLDVLKRTIANDIRPKQAQAEAEIAKQVEALSRTKNELSGASTLLAQEAK
FT                   RIELDSVARLEAFKSQTTSAQTALSGDLDVLKRTIANDIRPKQAQAEAEIAKQVEALSR
FT                   TKNELSGASTLLAQEAKRIELDSVARLEAFKSQTTSAQTALSGDLDVLKRTIANDIRPK
FT                   QAQAEAEIAKQVKALSRTKNELSGVKSAQATYEETTTRRLSELTNLANGKASKSELTQT
FT                   AEELASRIASVQAGSSRNYFRNSRSRTFTTGGQAVYDYRTFIVPDFWKNSDRFKRDYVR
FT                   ISFDVTFPVALVNDMPAMVHFSAHPWYAYRNLIFKGGTVERQHFEFTIDLSSSSEDYQT
FT                   NNVFIRFGTNYGFPAGLQVVIENAMLSVGNYFPAYQPAYEDQEDRVSVVESNFKQRADS
FT                   LDAGVSRLTEGFRTKADISSLNVTAENIRQSVKSLETDTQNKLNQKLSQAEFEVRAGSI
FT                   RQEILNATKDKASKSELTQTAEELSSKIASVQASGRNLFLNSLFKQDISKTGIWTTSTY
FT                   TATIDSESKYLGHKALKIIGLNPSGRDGGNPKVTYPALGQFGKVIPGSTTNQDVTISFY
FT                   AKANKNGIMLRSRLGNIGYKTGNVTLSTEIKRYVVHIPKGWTNESKQTTNEWLFNFNQE
FT                   GTIWIWMPKFEISDVDTSYSEAPEDIEGQISTVESTFKQRANSLEAGVRSLTEGLRTKV
FT                   DISSLNVTAENIRQSVKSLETDTQNKLNQKLSQAEFEVRAGSIRQEILNATKDKASKSE
FT                   LTQTAEELASRIASVHLGRRNLLKGTKELARYKPVSEYNGFKVIRTVAGATRYQDSYVE
FT                   RTVIPTAGTEYIAIFYARASENDYPVRCHFYNPNTVVSSENSSGYKSRSSDGLSIIRLS
FT                   TDWQLCWVKWTQTATDQAKTVIIGRHGPQVGGKEGVWVEICAPAIFEGNLAGDWSPAYE
FT                   DQDERVSAVESNFKQRADSLEAGVNRLTEGLRTKADISSLNVTAENIRQSVKSLETDTQ
FT                   NKLNQKLSQAEFEVRAGSIRQEILNATKDKASKSELTQTAEELSSKIASVQASGRNLFL
FT                   NSLFKQDISKTGIWTTSTYTATIDSESKYLGHKALKIIGLNPSGRDGGNPKVTYPALGQ
FT                   FGKVIPGSTTNQDVTISFYAKANKNGIMLRSRLGNIGYKTGNVTLSTEIKRYVVHIPKG
FT                   WTNESKQTTNEWLFNFNQEGTIWIWMPKFEISDVDTSYSEAPEDIEGQISTVESTFKQR
FT                   ANSLEAGVRSLTEGLRTKVDISSLNVTAENIRQSVKSLETDTQNKLNQKLSQAEFEVRA
FT                   GSIRQEILNATKDKASKSELTQTAEELSSKIASVQVGGINLLRNTASLLIGDRSKGCWM
FT                   SASGGNGRAISVEVLDPPKKMIKNMIRVIENTNGGNKDLTQLVRLRIGEKYTISCYARI
FT                   ASDSPNANVNLLFRSWANNTDLNRKFQKSISHKNWQKYSFTFTADAIENSIQFGQSGAG
FT                   IIEICAPKIESGTLATDYSEAPEDIEGQISTVESTFKQRANSLDAGVSRLTEGLRTKVD
FT                   ISALNVTAENIRQSVKSLETDTQNKLNQKLSQAEFEVRAGSIRQEILNATKDKADKTLV
FT                   VSEAGKLREEFSKMKVGGRNLWIKSKTVGAVIEKLPENHVTGQKECYRLENNSTLTFNL
FT                   EPDFSSRLYQKVTFSAWIKYENVVQGRNFWNVFNCFKHYLFRKNSETGVQSGPDYATLG
FT                   MYKGSADWKYITFTYDYSEKTNFDQLKTSLRFNLEGATSGTAWVTGIKVEIGSVATDWS
FT                   PAPEDADGLITEAKATFERTAQGLRTDLSAIQEYVNKNGQRQEALQRYTREESTRQATA
FT                   VRELVNRDFVGKATYQEDVKGINQRIEAVKTSANKDIASQIASYRQSVDGKFTDISSQI
FT                   TTYKQDVGGQISGLSNRLTSSEQGTTTQISNISNRINSNKQGADNQISNLKTQVATNKD
FT                   NAERQMGRISDQVSANKANADSQFANVTNQLARKVETTDFQRVKETSKLYERILGNTEN
FT                   GIADKVARMALTNQLFQVEVGKYSVSGPNLIKNSDFKNATNEWGSTQNLGRLVKHSFYH
FT                   NGQKDLMRLSNATKNENFLYSHRFNLERNTDYVLNFRGFNNSALASYDVYILGRRAGES
FT                   DGFTIVKKVVSSKKLSTSRCEDVSVTFNSGEMDNAYIRFDNNGSSSGTADLYITEVDLY
FT                   KGYKPRTWQPHPEDAVADANKKLEATQTKMTQLAGSWVVENINSAGDIISGINLGANGH
FT                   NRLSGKLTHITGETLIDRAVIKSAMVDKLKTGNFEAGSVTTTILEAEAVTAEKLKVDNA
FT                   LIKKLTANDAFIDQLISKRIFSIKVESVISSSTFLEAYQGRIGGFTLGQFDQGGGRWIS
FT                   GVNQFSVGMGNGAGHGVRTAFWANWGNNWNYAGPKAWNVNTDGKMYCRNEVGFYDQVDF
FT                   SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYW
FT                   MEQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPKIVS
FT                   RDPENPDGYLHIDYTALVPYLIKAIQELNQKIEKMEKTIA"
FT   gene            56250..56453
FT                   /locus_tag="SPAP_0065"
FT                   /note="PhiSpn_200p41"
FT   CDS_pept        56250..56453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0065"
FT                   /product="hypothetical protein"
FT                   /note="Operon 19 Gene 15 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83659"
FT                   /protein_id="ADM83659.1"
FT                   /translation="MNTEQLNQALQMTISEMSTTSTDSMIASNFLSIQLNEQREENQRL
FT                   QARVDELEALLDEQTKPADKGE"
FT   gene            56456..56806
FT                   /locus_tag="SPAP_0066"
FT                   /note="PhiSpn_200p42"
FT   CDS_pept        56456..56806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0066"
FT                   /product="hypothetical protein"
FT                   /note="Operon 19 Gene 16 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83660"
FT                   /protein_id="ADM83660.1"
FT                   /translation="MAETIQNTNNLLDLTKITEPFDLASALRYMKENGEFIRCKNVSDD
FT                   FYMYRDVQKRPVIVNGRRQLKDVETVWAFNQWGGTIATINVAVLLNHEFYIMKFDAEGN
FT                   PDWTDPTVKPKE"
FT   gene            56816..57232
FT                   /locus_tag="SPAP_0067"
FT                   /note="PhiSpn_200p43"
FT   CDS_pept        56816..57232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0067"
FT                   /product="hypothetical protein"
FT                   /note="Operon 19 Gene 17 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83661"
FT                   /protein_id="ADM83661.1"
FT                   /translation="MQIEFFNFLRSVVQTEDGLVLYALALIVSMEIIDFVTGTIAAIIN
FT                   PDIEYKSKIGINGLLRKISGVLLLMILIPASVLLPEKTGFVFLHSIYLGYIAFTFQSLI
FT                   ENYRKLKGNVTLFQPIVKVFQRLLEKDDDTKKGE"
FT   gene            57236..57568
FT                   /locus_tag="SPAP_0068"
FT                   /note="PhiSpn_200p44"
FT   CDS_pept        57236..57568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0068"
FT                   /product="hypothetical protein"
FT                   /note="Operon 19 Gene 18 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83662"
FT                   /protein_id="ADM83662.1"
FT                   /translation="MQQITEIITNGAISILVILAGVVVRVVKEYLVKKGGEKTIKIVEI
FT                   LAKNAVNAVEQVAAETGYKGDEKLAQARAKIRAELTKYNISMTDKDLDTFVESAVKQMN
FT                   DAWKGR"
FT   gene            57572..58528
FT                   /locus_tag="SPAP_0069"
FT                   /note="PhiSpn_200p45"
FT   CDS_pept        57572..58528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0069"
FT                   /product="autolysin"
FT                   /note="Operon 19 Gene 19 COG5263 FOG: autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83663"
FT                   /protein_id="ADM83663.1"
FT                   /translation="MDIDRNRLRTGLPQVGVQPYRQVHAHSTGNRNSTAQNEADYHYRK
FT                   DPELGFFSHVVGNGRVMQVGPVNNGSWDVGGGWNAESYAAVELIESHSTKEEFMTDYRL
FT                   YIELLRNLADEAGLPKTLDTDDLAGIKTHEYCTNNQPNNHSDHVDPYPYLASWGISREQ
FT                   FKQDIENGLSAATGWQKNGTGYWYVHSDGSYPKDKFEKINGTWYYFDGSGYMLSDRWKK
FT                   HTDGNWYWFDNSGEMATGWKKIADKWYYFDVEGAMKTGWVKYKDTWYYLDAKEGAMVSN
FT                   AFIQSADGTGWYYLKPDGTMADKPEFTVEPDGLITVK"
FT   gene            complement(58666..58845)
FT                   /locus_tag="SPAP_0070"
FT                   /note="PhiSpn_200p46"
FT   CDS_pept        complement(58666..58845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0070"
FT                   /product="hypothetical protein"
FT                   /note="Operon 20 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83664"
FT                   /protein_id="ADM83664.1"
FT                   /translation="MREVIQELLDSSMSTSAISQGAGVPWTTVSDLRKGKTSMDKMALL
FT                   TAEKLYEFATTDKQ"
FT   gene            complement(58987..59142)
FT                   /locus_tag="SPAP_0071"
FT                   /note="PhiSpn_200p47"
FT   CDS_pept        complement(58987..59142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83665"
FT                   /protein_id="ADM83665.1"
FT                   /translation="MKLNKEDWLRLLEKAIDNIPETVTAIASLVTAITVARQNKKRKPK
FT                   SRQRKR"
FT   gene            59416..59883
FT                   /locus_tag="SPAP_0072"
FT   CDS_pept        59416..59883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0072"
FT                   /product="Cytosine/adenosine deaminase"
FT                   /note="Operon 21 Gene 1 COG0590 Cytosine/adenosine
FT                   deaminases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83666"
FT                   /protein_id="ADM83666.1"
FT                   /translation="MYYTLEEKEVFMREALREAEIALEHDEIPIGCVIVKDGEIIGRGH
FT                   NAREELQRAVMHAEIMAIEDANLSEESWRLLDCTLFVTIEPCVMCSGAIGLARIPNVVY
FT                   GAKNQKFGAAGSLYNILTDERLNHRVEVEIGILEDECAAIMQDFFRNRRKK"
FT   gene            60069..60512
FT                   /locus_tag="SPAP_0073"
FT   CDS_pept        60069..60512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0073"
FT                   /product="dUTPase"
FT                   /note="Operon 22 Gene 1 COG0756 dUTPase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83667"
FT                   /protein_id="ADM83667.1"
FT                   /translation="MKIRGFELVSSFTDENLLPKRETAHAAGYDLKVAVRTVVAPGEIV
FT                   LVPTGVKAYMQPTEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPGNEGHIFAQMKN
FT                   ITDQEVVLEVGERIVQAVFATFLIADGDAAGGVRTGGFGSTGH"
FT   gene            60514..61029
FT                   /locus_tag="SPAP_0074"
FT   CDS_pept        60514..61029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0074"
FT                   /product="Fructose-2,6-bisphosphatase"
FT                   /note="Operon 22 Gene 2 COG0406
FT                   Fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83668"
FT                   /protein_id="ADM83668.1"
FT                   /translation="MKIIFVRHGEPDYRELEERSYIGFGIDLAPLSEMGRQQVQKLSKN
FT                   PLLSSAEIIVSSAVTRALETASYVVCATGLPLRVEPLLHEWQVYKTGIENFETARRLFL
FT                   ENKGELLPNSPIQYETATEMKSRFLECMSKYREHQTVVVVAHRMLMRQFVPNEKIDFCQ
FT                   VIECELEI"
FT   gene            61142..62404
FT                   /locus_tag="SPAP_0075"
FT   CDS_pept        61142..62404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0075"
FT                   /product="Predicted ATP-dependent serine protease"
FT                   /note="Operon 23 Gene 1 COG1066 Predicted ATP-dependent
FT                   serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83669"
FT                   /protein_id="ADM83669.1"
FT                   /translation="MEEVEVAEVKNARVSLTGEKTKPMKLAEVTSINVNRTKTEMEEFN
FT                   RVLGGGVVPGSLVLIGGDPGIGKSTLLQQVSTQLSQVGTVLYVSGEESAQQIKLRAERL
FT                   GDIDSEFYLYAETNMQSVRAEVERIQPDFLIIDSIQTIMSPEISGVQGSVSQVREVTAE
FT                   LMQLAKTNNIAIFIVGHVTKEGTLAGPRMLEHMVDTVLYFEGERHHTFRILRAVKNRFG
FT                   STNEIGIFEMQSGGLVEVLNPSQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPT
FT                   MFGNAKRTTTGLDFNRASLIMAVLEKRAGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVA
FT                   IASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPKNSLTGITL
FT                   PKEIQVIGVTTIQEVLKKVFA"
FT   gene            62408..62974
FT                   /locus_tag="SPAP_0076"
FT   CDS_pept        62408..62974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0076"
FT                   /product="Carbonic anhydrase"
FT                   /note="Operon 23 Gene 2 COG0288 Carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83670"
FT                   /protein_id="ADM83670.1"
FT                   /translation="MTNSLKNDKIGEIFDYQIFKEGIVSYFEQFMQANQAYVALHGQLN
FT                   LPLKPKTRVAIVTCMDSRLHVAQALGLALGDAHILRNAGGRVTEDMIRSLVISQQQMGT
FT                   REIVVLHHTDCGAQTFENEPFQEYLKEELGVDVSDQDFLPFQDIEESVREDMQLLIESP
FT                   LIPDDVIISGAIYNVDTGSMTVVEL"
FT   gene            62999..63208
FT                   /locus_tag="SPAP_0077"
FT   CDS_pept        62999..63208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0077"
FT                   /product="hypothetical protein"
FT                   /note="Operon 23 Gene 3 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83671"
FT                   /protein_id="ADM83671.1"
FT                   /translation="MKKSSILFIFILLLCIGLQYETIYYTDGSRSGAEYGLMGISIFLA
FT                   LFYMIPALYFLFRIGKNGNCQRRF"
FT   gene            63229..63813
FT                   /locus_tag="SPAP_0078"
FT   CDS_pept        63229..63813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0078"
FT                   /product="Predicted membrane protein"
FT                   /note="Operon 23 Gene 4 COG2339 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83672"
FT                   /protein_id="ADM83672.1"
FT                   /translation="MFLSGWLSSFANTYIHDLLGVLFPDSTFLNAFESAIVAPLVEEPL
FT                   KLLPLVFVLALIPVRKLKSLFLLGIASGLGFQMIEDIGYIRTDLPEGFDFTISRILERI
FT                   ISGIASHWTFSGLAVVGVYLLYRAYKGQKVGKKQGLIFLGLALGTHFLFNSPFVELETE
FT                   LPLAIPVVTAIALYGFYHAYCFVEKHNELMT"
FT   gene            63958..64926
FT                   /locus_tag="SPAP_0079"
FT   CDS_pept        63958..64926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0079"
FT                   /product="Phosphoribosylpyrophosphate synthetase"
FT                   /note="Operon 24 Gene 1 COG0462 Phosphoribosylpyrophosphate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83673"
FT                   /protein_id="ADM83673.1"
FT                   /translation="MSFSDLKLFALSSNKELAERVAQEIGIELGKSSVRQFSDGEIQVN
FT                   IEESIRGKHVFILQSTSSPVNDNLLEILIMVDALKRASAESVNVVMPYYGYARQDRKAR
FT                   AREPITSKLVANMLEVAGVDRLLTIDLHAAQIQGFFDIPVDHLMGAPLIADYFERRGMV
FT                   GSDYVVVSPDHGGVTRARKLAEFLKTSIAIIDKRRSVDKMNTSEVMNIIGKVEGKTCIL
FT                   IDDMIDTAGTICHAADALAEAGAVEVYASCTHPVLSGPATDNIQKSAIKKLVVLDTIYL
FT                   PEERLIDKIEQISIAHLLGDAIVRIHEKRPLSPLFDIEKKI"
FT   gene            complement(64862..65341)
FT                   /locus_tag="SPAP_0080"
FT   CDS_pept        complement(64862..65341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0080"
FT                   /product="Transposase-like protein"
FT                   /note="Operon 25 Gene 1 COG3464 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83674"
FT                   /protein_id="ADM83674.1"
FT                   /translation="MEQLHFITKLLDIKDPNVQILNIINKDTHKEIIAKLDYDAPSCPE
FT                   CGNQLKKYDFQKPSKIPYLETTGIPTRILLRKRRFKCYHCSKMMVAETSDDVQSYFFSF
FT                   YYITVLNLALLDSPLLSIYSEKRRKNLRIISGLVIKFFSQYRKVEKVVVFHEYVR"
FT   gene            complement(65467..65700)
FT                   /locus_tag="SPAP_0081"
FT   CDS_pept        complement(65467..65700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0081"
FT                   /product="hypothetical protein"
FT                   /note="Operon 26 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83675"
FT                   /protein_id="ADM83675.1"
FT                   /translation="MFSQLHMREEQVLLAQDYALETARAEGLEQGLERGKVEGRAERKL
FT                   FAFLDIVRQGLLTSEVASQQLGMSVSEFEALL"
FT   gene            complement(66129..66338)
FT                   /locus_tag="SPAP_0082"
FT   CDS_pept        complement(66129..66338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0082"
FT                   /product="hypothetical protein"
FT                   /note="Operon 26 Gene 2 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83676"
FT                   /protein_id="ADM83676.1"
FT                   /translation="MIAKKIFSNPEITCQFIRDMLDLPAKNVTILEGSDIHVLLSMPYS
FT                   VQDFYTSIDVLAELDNGTQVIIEI"
FT   gene            66594..69263
FT                   /locus_tag="SPAP_0083"
FT   CDS_pept        66594..69263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0083"
FT                   /product="DNA polymerase I-3'-5' exonuclease and polymerase
FT                   domains"
FT                   /note="Operon 27 Gene 1 COG0749 DNA polymerase I - 3'-5'
FT                   exonuclease and polymerase domains"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83677"
FT                   /protein_id="ADM83677.1"
FT                   /translation="MVFFDSFLYNGCMDKKKLLLIDGSSVAFRAFFALYQQLDRFKNAA
FT                   GLHTNAIYGFQLMLSHLLERVEPSHILVAFDAGKTTFRTEMYADYKGGRAKTPDEFREQ
FT                   FPFIRELLDHMGIRHYELAQYEADDIIGTLDKLAEQDGFDITIVSGDKDLIQLTDEHTV
FT                   VEISKKGVAEFEAFTPDYLMEEMGLTPAQFIDLKALMGDKSDNIPGVTKVGEKTGIKLL
FT                   LEHGSLEGIYENIDGMKTSKMKENLINDKEQAFLSKTLATIDTKAPIAIGLEDLVYSGP
FT                   DVENLGKFYDEMGFKQLKQALNVSSADVSESLDFTIVDQISQDMLSEESIFHFELFGEN
FT                   YHTDNLVGFAWSCGDKLYATDKLELLQDPIFKDFLEKTSLRVYDFKKVKVLLQRFGVDL
FT                   QAPAFDIRLAKYLLSTVEDNEIATIASLYGQTYLVDDETFYGKGVKKAIPEREKFLEHL
FT                   ACKLAVLVETEPILLEKLSENGQLELLYDMEQPLAFVLAKMEIAGIMVKKETLLEMQAE
FT                   NELVIEKLTQEIYELAGEEFNVNSPKQLGVLLFEKLGLPLEYTKKTKTGYSTAVDVLER
FT                   LAPIAPIVKKILDYRQIAKIQSTYVIGLQDWILADGKIHTRYVQDLTQTGRLSSVDPNL
FT                   QNIPARLEQGRLIRKAFVPEWEDSVLLSSDYSQIELRVLAHISKDEHLIKAFQEGADIH
FT                   TSTAMRVFGIERPDDVTANDRRNAKAVNFGVVYGISDFGLSNNLGISRKEAKAYIDTYF
FT                   ERFPGIKNYMDEVVREARDKGYVETLFKRRRELPDINSRNFNIRGFAERTAINSPIQGS
FT                   AADILKIAMIQLDKALVAGGYQTKMLLQVHDEIVLEVPKSELVEMKKLVKQTMEEAIQL
FT                   SVPLIADENEGATWYEAK"
FT   gene            69348..69785
FT                   /locus_tag="SPAP_0084"
FT   CDS_pept        69348..69785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0084"
FT                   /product="Predicted CoA-binding protein"
FT                   /note="Operon 27 Gene 2 COG1832 Predicted CoA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83678"
FT                   /protein_id="ADM83678.1"
FT                   /translation="MSQEFINPSDGVIRQYLATSKTLAVVGLSDREETTSNRVTKEMQA
FT                   RGYKIIPVNPKAAGGEILGEKAYASLAEIPFPVDIVNVYRRSEFLPDVARDFLKADAKI
FT                   FWAQLGLESLEAKEILRDGGCDDIVMNRCIKREHTRLIEEA"
FT   gene            complement(69968..70978)
FT                   /locus_tag="SPAP_0085"
FT   CDS_pept        complement(69968..70978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0085"
FT                   /product="Predicted membrane protein"
FT                   /note="Operon 28 Gene 1 COG2855 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83679"
FT                   /protein_id="ADM83679.1"
FT                   /translation="MSFLSKNGAGILACLLISIVSWYLGGFFPVIGAPVFAIFIGMLLH
FT                   PFLSSYKQLDAGLTFSSKKLLQYAVVLLGFGLNISQVFAVGQSSLPVILSTISIALIIA
FT                   YLFQRFFALDTKLATLVGVGSSICGGSAIAATAPVIDAKEKEVAQAISVIFFFNVLAAL
FT                   IFPTLGTWLHLSNEGFALFAGTAVNDTSSVTAAASAWDSLYQSNTLESATIVKLTRTLA
FT                   IIPITLFLSYWQSRQQENKQSLQLKKVFPLFILYFILASLLTTLLTSLGVSSSFFTPLK
FT                   ELSKFLIVMAMSAIGLKTNLVAMVKSSGKSILLGAICWIAIILTTLGMQTLIGIF"
FT   gene            71127..72296
FT                   /locus_tag="SPAP_0086"
FT   CDS_pept        71127..72296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0086"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /note="Operon 29 Gene 1 COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83680"
FT                   /protein_id="ADM83680.1"
FT                   /translation="MDLTKRFNKQLDKIQVSLIRQFDQAISEIPGVLRLTLGEPDFTTP
FT                   DHVKEAAKRAIDQNQSYYTGMSGLLTLRQAASDFVKEKYQLDYAPENEILVTIGATEAL
FT                   SATLTAILEEGDKVLLPAPAYPGYEPIVNLVGAEIVEIDTTENGFVLTPEMLEKAILEQ
FT                   GDKLKAVILNYPANPTGITYSREQLEALAAVLRKYEIFVVCDEVYSELTYTGEAHVSLG
FT                   TMLRDQAIIINGLSKSHAMTGWRLGLIFAPAAFTSQLIKSHQYLVTAANTMAQHAAVEA
FT                   LTAGKNDAEPMKKEYIQRRDYIIEKMTALGFEIIKPDGAFYIFAKIPAGYNQDSFAFLK
FT                   DFAQKKAVAFIPGAAFGRYGEGYVRLSYAASMETIKEAMKRLEEYMREA"
FT   gene            72293..73063
FT                   /locus_tag="SPAP_0087"
FT   CDS_pept        72293..73063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0087"
FT                   /product="Recombinational DNA repair protein (RecF
FT                   pathway)"
FT                   /note="Operon 29 Gene 2 COG1381 Recombinational DNA repair
FT                   protein (RecF pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83681"
FT                   /protein_id="ADM83681.1"
FT                   /translation="MIQSITSQGLVLYNRNFREDDKLVKIFTEQVGKCMFFVKHAGQSK
FT                   LAPVIQPLVLARFLLRINDDGLSYIEDYHEVMTFPKINSDLFVMAYATYVAALADASLQ
FT                   DNQQDAPLFAFLQKTLELMEAGLDYQVLTNIFEIQILTRFGISLNFNECVFCHRVGQAF
FT                   DFSFKYGACLCPEHYHEDERRCHLNPNIPYLLNQFQAIDFETLETISLKPGIKQELRQF
FT                   MDQLYEEYVGIHLKSKKFIDSLADWGQLLKEEKK"
FT   gene            73060..74052
FT                   /locus_tag="SPAP_0088"
FT   CDS_pept        73060..74052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0088"
FT                   /product="Fatty acid/phospholipid biosynthesis enzyme"
FT                   /note="Operon 29 Gene 3 COG0416 Fatty acid/phospholipid
FT                   biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83682"
FT                   /protein_id="ADM83682.1"
FT                   /translation="MKKIAVDAMGGDYAPQAIVEGVNQALSDFSDIEVQLYGDEAKIKQ
FT                   YLTATERVSIIHTDEKIDSDDEPTRAIRNKKNASMVLAAKAVKDGEADAVLSAGNTGAL
FT                   LAAGFFIVGRIKNIDRPGLMSTLPTVDGKGFDMLDLGANAENTAQHLHQYAVLGSFYAK
FT                   NVRGIAQPRVGLLNNGTESSKGDPLRKETYELLAADESLNFIGNVEARDLMNGVADVVV
FT                   ADGFTGNAVLKSIEGTAMGIMGLLKTAITGGGLRAKLGALLLKDSLRGLKKQLNYSDVG
FT                   GAVLFGVKAPVVKTHGSSDAKAVYSTIRQIRTMLETEVVAQTAREFSGE"
FT   gene            74058..74291
FT                   /locus_tag="SPAP_0089"
FT   CDS_pept        74058..74291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0089"
FT                   /product="Acyl carrier protein"
FT                   /note="Operon 29 Gene 4 COG0236 Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83683"
FT                   /protein_id="ADM83683.1"
FT                   /translation="MKEKEIFDSIVTIIQERQGEDFVVTESLSLKDDLDADSVDLMEFI
FT                   LTLEDEFSIEISDEEIDQLQSVGDVVKIIQGK"
FT   gene            75065..75184
FT                   /locus_tag="SPAP_0090"
FT   CDS_pept        75065..75184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0090"
FT                   /product="hypothetical protein"
FT                   /note="Operon 30 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83684"
FT                   /protein_id="ADM83684.1"
FT                   /translation="MDFKSFIIGLVVGIFGPYMDDLIRKKIFKVFGEENRKIC"
FT   gene            75778..77931
FT                   /locus_tag="SPAP_0091"
FT   CDS_pept        75778..77931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0091"
FT                   /product="ABC-type bacteriocin/lantibiotic exporter"
FT                   /note="Operon 31 Gene 1 COG2274 ABC-type
FT                   bacteriocin/lantibiotic exporters, contain an N-terminal
FT                   double-glycine peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83685"
FT                   /protein_id="ADM83685.1"
FT                   /translation="MKFGKRHYRPQVDQMDCGVASLAMVFGYYGSYYFLAHLRELAKTT
FT                   MDGTTALGLVKVAEEIGFETRAIKADMTLFDLPDLTFPFVAHVLKEGKLLHYYVVTGQD
FT                   KDSIHIADPDPGVKLTKLPRERFAEEWTGVTLFMAPSPDYKPHKEQKNGLFSFIPILVK
FT                   QRGLIANIVLATLLVTVINIVGSYYLQSIIDTYVPDQMRSTLGIISIGLVIVYILQQIL
FT                   SYAQEYLLLVLGQRLSIDVILSYIKHVFHLPMSFFATRRTGEIVSRFTDANSIIDALAS
FT                   TILSIFLDVSTVVIISLVLFSQNTNLFFMTLLALPIYTVIIFAFMKPFEKMNRDTMEAN
FT                   AVVSSSIIEDINGIETIKSLTSESQRYQKIDKEFVDYLKKSFTYSRAESQQKALKKVAH
FT                   LLLNVGILWMGAVLVMDGKMSLGQLITYNTLLVYFTNPLENIINLQTKLQTAQVANNRL
FT                   NEVYLVASEFEEKKTVEDLSLMKGDMTFKQVHYKYGYGRDVLSDINLTVPQGSKVAFVG
FT                   ISGSGKTTLAKMMVNFYDPSQGEISLGSVNLNQIDKKALRQYINYLPQQPYVFNGTILE
FT                   NLLLGAKEGTTQEDILRAVELAEIREDIERMPLNYQTELTSDGAGISGGQRQRIALARA
FT                   LLTDAPVLILDEATSSLDILTEKRIVDNLMALDKTLIFIAHRLTIAERTEKVVVLDQGK
FT                   IVEEGKHADLLAQGGFYAHLVNS"
FT   gene            77944..79293
FT                   /locus_tag="SPAP_0092"
FT   CDS_pept        77944..79293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0092"
FT                   /product="hypothetical protein"
FT                   /note="Operon 31 Gene 2 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83686"
FT                   /protein_id="ADM83686.1"
FT                   /translation="MKPEFLESAEFYNRRYHNFSSSVIVPMALLLVFLLGFATVAEKEM
FT                   SLSTRATVEPSRILANIQSTSNNRILVNHLEENKLVKKGDLLVQYQEGAEGVQAESYAS
FT                   QLDMLKDQKKQLEYLQKSLQEGENHFPEEDKFGYQATFRDYISQAGSLRASTSQQNETI
FT                   ASQNAAASQTQAEIGNLINQTEAKIRDYQTAKSAMETGASLASQNLAYSLYQSYKSQGE
FT                   ENPQTKVQAVAQVEAQISQLESSLATYRVQYAGSGTQQAYASGLSSQLESLKSQHLAKV
FT                   GQELTLLAQKILEAESGKKVQGNLLDKGKITASEDGVLHLNPETSDSSMVAEGALLAQL
FT                   YPSLEREGKAKLTAYLSSKDVARIKVGDSVRYTTTHDAGNQLFLDSTITSIDATATKTE
FT                   KGNFFKIEAETNLTSEQAEKLRYGVEGRLQMITGKKSYLRYYLDQFLNKE"
FT   gene            79463..80170
FT                   /locus_tag="SPAP_0093"
FT   CDS_pept        79463..80170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0093"
FT                   /product="Phosphoribosylaminoimidazolesuccinocarboxamide
FT                   (SAICAR) synthase"
FT                   /note="Operon 32 Gene 1 COG0152
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83687"
FT                   /protein_id="ADM83687.1"
FT                   /translation="MSKQLIYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAGK
FT                   GVLNNQISSFIFEKLNAAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSKRF
FT                   GVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAYLKEETRRINELLKV
FT                   WFAEIGLKLIDFKLEFGFDKDGKIILADEFSPDNCRLWDADGNHMDKDVFRRGLGELTD
FT                   VYEIVWEKLQGLK"
FT   gene            80227..83952
FT                   /locus_tag="SPAP_0094"
FT   CDS_pept        80227..83952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0094"
FT                   /product="Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, synthetase domain protein"
FT                   /note="Operon 32 Gene 2 COG0046
FT                   Phosphoribosylformylglycinamidine (FGAM) synthase,
FT                   synthetase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83688"
FT                   /protein_id="ADM83688.1"
FT                   /translation="MDKRIFVEKKADFQVKSESLVRELQHNVGLSSLKSIRIVQVYDVF
FT                   DLAEDLFAPAEKHIFSEQGTDHVLDEVSVQADLANYAFFAIESLPGQFDQRAASSQEAL
FT                   LLLGSSSDVTVNTAQLYLVNKDIDATELEAVKNYLLNPVDSRFKDITTGIAKQEFSESD
FT                   KTIPKLTFFESYTAEDFARYKAEQGMAMEVDDLLFIQDYFKSIGRVPTETELKVLDTYW
FT                   SDHCRHTTFETELKHIDFSASKFQKQLQSTYDKYIAMREELGRSEKPQTLMDMATIFGR
FT                   YERANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNETHNHPTEIEPFGGAATC
FT                   IGGAIRDPLSGRSYVYQAMRISGAGDITAPISETRAGKLPQQVISKTAAHGYSSYGNQI
FT                   GLATTYVREYFHPGFVAKRMELGAVVGAAPKGNVVREKPEAGDVIILLGGKTGRDGVGG
FT                   ATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRNGNVTRLIKKSNDFGAGGVCVAI
FT                   GELADGLEIDLNKVPLKYQGLNGTEIAISESQERMAVVVRPEDVDAFVAECNKENIDAV
FT                   VVAIVTEKPNLVMHWNGETIVDLERRFLDTNGVRVVVDAKVVDKDVKLPEERQTSAETL
FT                   ESDTLTVLSDLNHASQKGLQTIFDCSVGRSTVNHPLGGRYQLTPTEASVQKLPVQHGVT
FT                   HTASVIAQGFNPYVAEWSPYHGAAYAVIEATARLVAAGANWSKARFSYQEYFERMDKQA
FT                   ERFGQPVAALLGSIEAQIQLGLPSIGGKDSMSGTFEELTVPPTLVAFGVTTADSRKVLS
FT                   PEFKAVGENIYYIPGQALSAEIDFDLIKKNFAQFEAIQADHKVTSASAVKYGGVVESLA
FT                   LATFGNYIGAEVTLPELETALTAQLGGFVFTSPEEIAGVEKVGQTKADFTLTVNGVKLD
FT                   GHKLDSAFQGTLEEVYPTEFTQAKELEEVPAVASDVVIKAKEKVEKPVVYIPVFPGTNS
FT                   EYDSAKAFEKEGAEVNLVPFVTLNEEAIVKSVETMVDNIDKTNILFFAGGFSAADEPDG
FT                   SAKFIVNILLNEKVRVAIDSFIARGGLIIGICNGFQALVKSGLLPYGNFEDANSTSPTL
FT                   FYNDANQHVAKMVETRIANTNSPWLAGVQVGDIHAIPVSHGEGKFVVTAEEFAELRDNG
FT                   QIFSQYVDFNGKPSMDSKYNPNGSVHAIEGITSKNGQIIGKMGHSERYEDGLFQNIPGN
FT                   KDQHLFASAVKHFTGK"
FT   gene            84045..85487
FT                   /locus_tag="SPAP_0095"
FT   CDS_pept        84045..85487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0095"
FT                   /product="Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase"
FT                   /note="Operon 32 Gene 3 COG0034 Glutamine
FT                   phosphoribosylpyrophosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83689"
FT                   /protein_id="ADM83689.1"
FT                   /translation="MTYEVKSLNEECGVFGIWGHPDAAKLTYFGLHSLQHRGQEGAGIL
FT                   SNDQGQLKRHRDMGLLSEVFRNPANLDKLTGAGAIGHVRYATAGEASVDNIQPFLFRFH
FT                   DMQFGLAHNGNLTNAASLKKELEDRGAIFSATSDSEILAHLIRRSHNPSLMGKIKEALS
FT                   LVKGGFAYILLFEDKLIAALDPNGFRPLSIGKMANGAVVVSSETCAFEVIGAEWIRDLK
FT                   PGEIVIIDDEGIQYDSYTDDTQLAICSMEYIYFARPDSNIHGVNVHTARKRMGAQLARE
FT                   FKHEADIVVGVPNSSLSAAMGFAEESGLPNEMGLIKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSGVVKGKRVVMVDDSIVRGTTSRRIVQLLKEAGATEVHVAIGSPALAYPCFYGID
FT                   IQTRQELIAANHTVEETRQIIGADSMTYLSIDGLIESIGIETDAPNGGLCVAYFDGDYP
FT                   TPLYDYEEDYRRSLEEKTSFYK"
FT   gene            85524..86546
FT                   /locus_tag="SPAP_0096"
FT   CDS_pept        85524..86546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0096"
FT                   /product="hypothetical protein"
FT                   /note="Operon 32 Gene 4 protein supported
FT                   gi|169632702|ref|YP_001706438.1|
FT                   phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83690"
FT                   /protein_id="ADM83690.1"
FT                   /translation="MTNKNAYAQSGVDVEAGYEVVERIKKHVARTERAGVMGALGGFGG
FT                   MFDLSKTGVKEPVLISGTDGVGTKLMLAIKYDKHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYVATGKNEPAKLEQVVAGVAEGCVQAGAALIGGETAEMPGMYGEDDYDLAGFAVGVA
FT                   EKSQIIDGSKVVEGDVLLGLVSSGIHSNGYSLVRRVFADYTGEEVLPELEGKKLKEVLL
FT                   EPTRIYVKAVLPLIKEELVNGIAHITGGGFIENVPRMFADDLAAEIDESKVPVLPIFKA
FT                   LEKYGQIKHEEMFEIFNMGVGLMLAVSPENVERVKELLDEAVYEIGRIVKKENESVIIK
FT                   "
FT   gene            86543..87088
FT                   /locus_tag="SPAP_0097"
FT   CDS_pept        86543..87088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0097"
FT                   /product="Folate-dependent phosphoribosylglycinamide
FT                   formyltransferase PurN"
FT                   /note="Operon 32 Gene 5 COG0299 Folate-dependent
FT                   phosphoribosylglycinamide formyltransferase PurN"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83691"
FT                   /protein_id="ADM83691.1"
FT                   /translation="MKKIAVFASGNGSNFQVIAEEFPVEFVFSDHRDAYVLERAKQLGV
FT                   LSYAFELKEFESKADYEAALVELLEEHQIDLVCLAGYMKIVGPTLLSAYEGRIVNIHPA
FT                   YLPEFPGAHGIEDAWNAGVGQSGVTIHWVDSGVDTGQVIKQVRVPRLADDTIDRFEARI
FT                   HEAEYRLYPEVVKALFTD"
FT   gene            87172..87681
FT                   /locus_tag="SPAP_0098"
FT   CDS_pept        87172..87681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0098"
FT                   /product="Glycopeptide antibiotics resistance protein"
FT                   /note="Operon 33 Gene 1 COG4767 Glycopeptide antibiotics
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83692"
FT                   /protein_id="ADM83692.1"
FT                   /translation="MLESKKTTRYVFYVYLMLLTWGILFKFETNPEFIAFFLAPRYINW
FT                   IPFSEPLIVDGKIVFAEMLFNLISFIPLGVCFPLIKTNLSSLRIVGTGFLISLLFECLQ
FT                   YILAIGITDITDLTLNTLGVCVGLLIYQIFIRVFKSQTRKWINILGMLSLGFAYLVLLL
FT                   LHLIGV"
FT   gene            87706..89253
FT                   /locus_tag="SPAP_0099"
FT   CDS_pept        87706..89253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0099"
FT                   /product="AICAR transformylase/IMP cyclohydrolase PurH
FT                   (only IMP cyclohydrolase domain in Aful)"
FT                   /note="Operon 33 Gene 2 COG0138 AICAR transformylase/IMP
FT                   cyclohydrolase PurH (only IMP cyclohydrolase domain in
FT                   Aful)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83693"
FT                   /protein_id="ADM83693.1"
FT                   /translation="MTKRVLISVSDKAGIVEFAQELKKLGWEIISTGGTKVALDNAGVD
FT                   TIAIDDMTGFPEMMDGRVKTLHPNIHGGLLARRDLDSHLEAAKDNKIELIDLVVVNLYP
FT                   FKETILKPDVTYADAVENIDIGGPSMLRSAAKNHASVTVVVDPADYAVVLDELSANGET
FT                   TYETRQRLAAKVFRHTAAYDALIAEYFTAQVGESKPEKLTLTYDLKQAMRYGENPQQDA
FT                   DFYQKALPTDYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKDRPTVVALKHMNPCGI
FT                   GQADNIETAWDYAYESDPVSIFGGIVVLNREVDAATAEKMHGVFLEIIIAPSYTDEALA
FT                   ILINKKKNLRILALPFNAQEASEVEAEYTGVVGGLLVQNQDVVKESPADWQVVTKRQPT
FT                   ETEATALEFAWKAIKYVKSNGIIVTNDHMTLGVGPGQTNRVASVRLAIDQAKDRLNGAV
FT                   LASDSFFPFADNVEEIAKAGIKAIIQPGGSVRDQESIEAADKYGLTMVFTGVRHFRH"
FT   gene            89375..90637
FT                   /locus_tag="SPAP_0100"
FT   CDS_pept        89375..90637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0100"
FT                   /product="Phosphoribosylamine-glycine ligase"
FT                   /note="Operon 33 Gene 3 COG0151 Phosphoribosylamine-glycine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83694"
FT                   /protein_id="ADM83694.1"
FT                   /translation="MKLLVVGSGGREHAIAKKLLESKDVEKVFVAPGNDGMTLDGLELV
FT                   NISISEHSKLIDFAKTNDVAWTFIGPDDALAAGIVDDFNQAGLKAFGPTRAAAELEWSK
FT                   DFAKEIMVKYGVSTAAYGTFSDFEEAKAYIEKHGAPIVVKADGLALGKGVVVSETVEQA
FT                   VEAAHEMLLDNKFGDSGARVVIEEFLEGEEFSLFAFVNGDKFYIMPTAQDHKRAYDGDK
FT                   GPNTGGMGAYAPVPHLPQSVVDTAVDTIVKPVLEGMIKEGRPYLGVLYAGLILTADGPK
FT                   VIEFNARFGDPETQIILPRLTSDFAQNITDILDSKEPNIMWTDKGVTLGVVVASKGYPL
FT                   DYERGVELPAKTEGDVITYYAGAKFAENSRALLSNGGRVYMLVTTADTVKEAQASIYQE
FT                   LYQQKIEGLFYRTDIGSKAIK"
FT   gene            complement(90601..90801)
FT                   /locus_tag="SPAP_0101"
FT   CDS_pept        complement(90601..90801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0101"
FT                   /product="hypothetical protein"
FT                   /note="Operon 34 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83695"
FT                   /protein_id="ADM83695.1"
FT                   /translation="MVLGDGGGSKPSVSFLNFEPTVSKFPPDQNIHCSGLFTTTTIIVF
FT                   GDYGALFLYLYLIALLPISVR"
FT   gene            91040..91528
FT                   /locus_tag="SPAP_0102"
FT   CDS_pept        91040..91528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0102"
FT                   /product="Phosphoribosylcarboxyaminoimidazole (NCAIR)
FT                   mutase"
FT                   /note="Operon 35 Gene 1 COG0041
FT                   Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83696"
FT                   /protein_id="ADM83696.1"
FT                   /translation="MKPVISIIMGSKSDWATMQKTAEVLDRFGVAYEKKVVSAHRTPDL
FT                   MFKHAEEARSRGIKIIIAGAGGAAHLPGMVAAKTTLPVIGVPVKSRALSGVDSLYSIVQ
FT                   MPGGVPVATMAIGEAGATNAALFALRLLSVEDKSIADALANFAEEQGKIAEESSNELI"
FT   gene            91515..92606
FT                   /locus_tag="SPAP_0103"
FT   CDS_pept        91515..92606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0103"
FT                   /product="Phosphoribosylaminoimidazole carboxylase (NCAIR
FT                   synthetase)"
FT                   /note="Operon 35 Gene 2 COG0026
FT                   Phosphoribosylaminoimidazole carboxylase (NCAIR
FT                   synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83697"
FT                   /protein_id="ADM83697.1"
FT                   /translation="MSSSKTIGIIGGGQLGQMMAISAIYMGHKVIALDPAADCPASRVA
FT                   EIIVAPYNDVDALRQLADRCDVLTYEFENVDADGLDAVIKDGQLPQGTDLLRISQNRIF
FT                   EKDFLSNKAQVTVAPYKVVTSSLDLADIDLSKNYVLKTATGGYDGHGQKVIRSEADLEA
FT                   AYALADSADCVLEEFVNFDLEISVIVSGNGKEVTFFPVQENIHRNNILSKTIVPARISE
FT                   SLVDKAKAMAVRIAEQLNLSGTLCVEMFATDDDVIVNEIAPRPHNSGHYSIEACDFSQF
FT                   DTHILGVLGAPLPVIKLHAPAVMLNVLGQHVEAAEQYVTENSSAHLHMYGKIEAKHNRK
FT                   MGHVTLFSDVPDSVDELGEGIDF"
FT   gene            92616..92843
FT                   /locus_tag="SPAP_0104"
FT   CDS_pept        92616..92843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0104"
FT                   /product="hypothetical protein"
FT                   /note="Operon 35 Gene 3 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83698"
FT                   /protein_id="ADM83698.1"
FT                   /translation="MIQIIVNTFIEKDKTGAVVEVLYASADQDKVKAKYEELAAQYPEN
FT                   YLAIYDVPLDTDLNTLDHYPSVFIEKEEFE"
FT   gene            92906..94204
FT                   /locus_tag="SPAP_0105"
FT   CDS_pept        92906..94204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0105"
FT                   /product="Adenylosuccinate lyase"
FT                   /note="Operon 35 Gene 4 COG0015 Adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83699"
FT                   /protein_id="ADM83699.1"
FT                   /translation="MINRYSRPEMANIWSEENKYRAWLEVEILSDEAWAELGEIPKEDV
FT                   ALIRKKADFDIDRILEIEQETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTNIIADKAKEHKFTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NIERFEHAAAGVEAGKISGAVGNFANIPPFVEEYVCDKLGIRAQEISTQVLPRDLHAEY
FT                   FAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMITAYENVALWHERDISHSSAERIITPDTTILIDYMLNRFGNIVKNLTVFPEN
FT                   MIRNMNSTFGLIFSQRAMLTLIEKGMTREQAYDLVQPKTAYSWDNQVDFKPLLEADSEV
FT                   TSRLTQEEIDEIFNLVYYTKRVDDIFERLGLGD"
FT   gene            complement(94259..98218)
FT                   /locus_tag="SPAP_0106"
FT   CDS_pept        complement(94259..98218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0106"
FT                   /product="hypothetical protein"
FT                   /note="Operon 36 Gene 1 protein supported
FT                   gi|149001861|ref|ZP_01826834.1| 30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83700"
FT                   /protein_id="ADM83700.1"
FT                   /translation="MQSGGFAMKHEKQQRFSIRKYAVGAASVLIGFAFQAQTVAADGVT
FT                   PTTTENQPTIHTVSDSPQSSENRTEETPKAVLQPEAPKTVETETPATDKVASLPKTEEK
FT                   PQEEVSSTPSDKAEVVTPTSAEKETANKKAEEASPKKEEAKEVDSKESNTDKTDKDKPA
FT                   KKDEAKAEADKPETEAGKERAATVNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYG
FT                   YTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQM
FT                   TDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQA
FT                   VAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYE
FT                   KFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASS
FT                   KLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPII
FT                   GGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAE
FT                   SVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTPEALKEEEAKREVEK
FT                   LAKNKVISIDAGRKYFTLNQLKRIVDKASELGYSDVHLLLGNDGLRFLLDDMTITANGK
FT                   TYASDDVKKAIIEGTKAYYDDPNGTALTQAEVTELIEYAKSKDIGLIPAINSPGHMDAM
FT                   LVAMEKLGIKNPQAHFDKVSKTTMDLKNEEAMNFVKALIGKYMDFFAGKTKIFNFGTDE
FT                   YANDATSAQGWYYLKWYQLYGKFAEYANTLAAMAKERGLQPMAFNDGFYYEDKDDVQFD
FT                   KDVLISYWSKGWWGYNLASPQYLASKGYKFLNTNGDWYYILGQKPEDGGGFLKKAIENT
FT                   GKTPFNQLASTKYPEVDLPTVGSMLSIWADRPSAEYKEEEIFELMTAFADHNKDYFRAN
FT                   YNALREELAKIPTNLEGYSKESLEALDAAKTALNYNLNRNKQAELDTLVANLKAALQGL
FT                   KPAATHSGSLDENEVAANVETRPELITRTEEIPFEVIKKENPNLPAGQENIITAGVKGE
FT                   RTHYISVLTENGKTTETVLDSQVTKEVINQVVEVGAPVTHKGDESGLAPTTEVKPRLDI
FT                   QKEEIPFTTVTRENPLLLKGKTQVITKGVNGHRSNFYSVSTSADGKEVKTLVNSVVAQE
FT                   AVTQIVEVGTMVTHVGDENGQAAIAEEKPKLEIPSQPAPSTAPAEESKALPQDPAPVVT
FT                   EKKLPETGTHDSAGLVVAGLMSTLAAYGLTKRKED"
FT   gene            complement(98512..99255)
FT                   /locus_tag="SPAP_0107"
FT   CDS_pept        complement(98512..99255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0107"
FT                   /product="Transcriptional regulator"
FT                   /note="Operon 37 Gene 1 COG2188 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83701"
FT                   /protein_id="ADM83701.1"
FT                   /translation="MEKENRGKNMAIPKYQYIKDELKNKIISGQFSSGDKFYTEAELIS
FT                   MYDVSSITVVRALNDLAKDGYIVRQQGKGTFVSRARKHKLVEFSDIELFNAKDDKVTVL
FT                   SIERGNKLVYLEKLGLRGDQFYYKIERIRESNGVVYIYHTSYIPEQYINANYPNLEYYS
FT                   SIYNRFKLDYHIHMNDEHFEEINEIVFPTPEHAASVLGVDEQFPTVLQTKITKLESTGQ
FT                   VLEYSETYKRSDYYKIKFISCDRDH"
FT   gene            99576..101363
FT                   /locus_tag="SPAP_0108"
FT   CDS_pept        99576..101363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0108"
FT                   /product="Beta-galactosidase"
FT                   /note="Operon 38 Gene 1 COG1874 Beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83702"
FT                   /protein_id="ADM83702.1"
FT                   /translation="MTRFEIRDDFYLDGKSFKILSGAIHYFRVPPEDWYHSLYNLKALG
FT                   FNTVETYVAWNLHEPREGEFHFEGDLDLEKFLQIAQDLGLYAIVRPSPFICAEWEFGGL
FT                   PAWLLTKNMRIRSSDPAYIEAVGRYYDQLLPRLVPRLLDNGGNILMMQVENEYGSYGED
FT                   KAYLRAIRQLMEECGVTCPLFTSDGPWRATLKAGTLIEEDLFVTGNFGSKAPYNFSQMQ
FT                   EFFDEHGKKWPLMCMEFWDGWFNRWKEPIITRDPKELADAVREVLEQGSINLYMFHGGT
FT                   NFGFMNGCSARGTLDLPQVTSYDYDALLDEEGNPTAKYLAVKKMMATHFSEYPQLEPLY
FT                   KESMELDAIPLVEKVSLFETLDSLSSPVESLYPQKMEELGQSYGYLLYRTETNWDAEEE
FT                   RLRIIDGRDRAQLYVDGQWVKTQYQTEIGEDIFYQGKKKGLSRLDILIENMGRVNYGHK
FT                   FLADTQRKGIRTGVCKDLHFLLNWKHYPLPLDNPEKIDFSKGWTQGQPAFYAYDFTVEE
FT                   PKDTYLDLSEFGKGVAFVNGQNLGRFWNVGPTLSLYIPHSYLKEGANRIIIFETEGQYK
FT                   EEIHLTRKPTLKHIKGENL"
FT   gene            101360..101836
FT                   /locus_tag="SPAP_0109"
FT   CDS_pept        101360..101836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0109"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /note="Operon 38 Gene 2 COG3444 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83703"
FT                   /protein_id="ADM83703.1"
FT                   /translation="MTIVGCRIDGRLIHGQVANLWAGKLNVSRIMVVDDEVVNNDIEKS
FT                   GLKLATPPGVKLSILPVEKAAANILAGKYDSQRLFIVARKPDRFLGLVEAGVPLETLNV
FT                   GNMSQTPETRSITRSINVVDKDVEDFHKLAEKGVKLTAQMVPNDPISDFLSLLK"
FT   gene            101864..102769
FT                   /locus_tag="SPAP_0110"
FT   CDS_pept        101864..102769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0110"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /note="Operon 38 Gene 3 COG3715 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83704"
FT                   /protein_id="ADM83704.1"
FT                   /translation="MIQWWQILLLTLYSAYQICDELTIVSSAGSPVFAGFITGLIMGDV
FT                   TTGLLIGGNLQLFVLGVGTFGGASRIDATSGAVLATAFSVSQGIDAPLAITTIAVPVAA
FT                   LLTYFDVLGRMTTTFFAHRVDAAIERFDYKGIERNYLLGAIPWALSRALPVFFALAFGG
FT                   AFVQSVVDFVEAYKWVADGLTLAGRMLPGLGFAILLRYLPVKRNLHYLAMGFGLTAMLT
FT                   VLYSYVTGLGGAVAGIVGTLPAEVAEKIGFVNNFKGLSMIGISIVGIFLAVLHFKNSQK
FT                   VAVAAPSTPSESGEIEDDEF"
FT   gene            102756..103571
FT                   /locus_tag="SPAP_0111"
FT   CDS_pept        102756..103571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0111"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /note="Operon 38 Gene 4 COG3716 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83705"
FT                   /protein_id="ADM83705.1"
FT                   /translation="MTNSNYKLTKEDFNQINKRSLFTFQLGWNYERMQASGYLYMILPQ
FT                   LRKMYGDGTPELKEMMKVHTQFFNTSPFFHTIIAGFDLAMEEKDGVGSKDAVNGIKTGL
FT                   MGPFAPLGDTIFGSLVPAIMGSVAATMAIAGQPWGIFLWIAVAVAYDIFRWKQLEFAYK
FT                   EGVNLINNMQSTLTALIDAASVLGVFMMGALVATVINFEISYKLPIGEKMIDFQDILNQ
FT                   IFPRLLPAIFTAFIFWLLGKKGMNSTKAIGIIIVLALALSALGHFALGM"
FT   gene            103578..103982
FT                   /locus_tag="SPAP_0112"
FT   CDS_pept        103578..103982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0112"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /note="Operon 38 Gene 5 COG2893 Phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83706"
FT                   /protein_id="ADM83706.1"
FT                   /translation="MTKSLILVSHGRFCEELRGSTEMIMGPQDNIYTVALLPEDGPEEF
FT                   TAKFEAVIEGLDDFLVFADLLGGTPCNVVSRLIMEGRDIDLYAGMNLPMVIEFINASLT
FT                   GADADYKSRAAESIVKVNDLLAGFDDDEDE"
FT   gene            104281..105447
FT                   /locus_tag="SPAP_0113"
FT   CDS_pept        104281..105447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0113"
FT                   /product="Predicted phosphosugar isomerase"
FT                   /note="Operon 39 Gene 1 COG2222 Predicted phosphosugar
FT                   isomerases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83707"
FT                   /protein_id="ADM83707.1"
FT                   /translation="MLHYTKEDLLELGAEITTREIYQQPDVWREAFEFYQAKREEIAAF
FT                   LQEIADKHDYIKVILTGAGTSAYVGDTLLPYFKEVYDERKWNFNAIATTDIVANPATYL
FT                   KKDVATVLVSFARSGNSPESLATVDLAKSLVDELYQVTITCAADGKLALQAHGDDRNLL
FT                   LLQPAVSNDAGFAMTSSFTSMMLTTLLVFDPTEFAVKSERFEVVSSLARKVLDKAEDVK
FT                   ELVDLDFNRVIYLGAGPFFGLAHEAQLKILELTAGQVATMYESPVGFRHGPKSLINDNT
FT                   VVLVFGTTTDYTRKYDLDLVREVAGDQIARRVVLLSDQAFGLENVKEVALGCGGVLNDI
FT                   YRVFPYIVYAQLFALLTSLKVENKPDTPSPTGTVNRVVQGVIIHEYQK"
FT   gene            105563..106600
FT                   /locus_tag="SPAP_0114"
FT   CDS_pept        105563..106600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0114"
FT                   /product="hypothetical protein"
FT                   /note="Operon 40 Gene 1 protein supported
FT                   gi|15900011|ref|NP_344615.1| aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83708"
FT                   /protein_id="ADM83708.1"
FT                   /translation="MKAYTERVFGNVEGEDVLAYRFETDGGYQLEVMTYGATILRYVAP
FT                   DKAGNFANVILGFDDFDSYVGNSPKHGASVGPVAGRIAGATFELNGKTYDLEVNNASNC
FT                   NHSGSTGWDSSLFEVEEVSDHGLTLYTERTDGTGGFPGNLKIWISYHLEETGAYEISYK
FT                   VTTDQDTLVNPTNHSYFNLSGDFTQTIDRHVFQLNTEGIYSIAPDGVPAKTPEANRDVV
FT                   KHVYNGTLLKDIFAEEDEQIQLASGLDHPFALPAGHDNAGFLYDQNSGRFLLFKTEAPC
FT                   FVVYTANFVDESVIIGGQPMLQHNGIALEAQALPDAIHSDLKGQVILKAGQTFTSKTRY
FT                   ELVVK"
FT   gene            106762..107274
FT                   /locus_tag="SPAP_0115"
FT   CDS_pept        106762..107274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0115"
FT                   /product="hypothetical protein"
FT                   /note="Operon 41 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83709"
FT                   /protein_id="ADM83709.1"
FT                   /translation="MALTLAGAVLTNDVFANDRLVATQTTDGKNENVLTSEVLKPSSGN
FT                   VLVGIKGEFVAPHQQSILDAINAICKEAADEGLVDKYVPIKWSTDLEKAAFARATEASI
FT                   TMDHTRLSSKDLWSAFPTSNSIMGENLAWNHDGFLKAIEQWRAEKADYVEKKIVVQTTG
FT                   NLVTMSR"
FT   gene            107295..107930
FT                   /locus_tag="SPAP_0116"
FT   CDS_pept        107295..107930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0116"
FT                   /product="Choline binding protein I"
FT                   /note="Operon 41 Gene 2 COG5263 FOG: Choline binding
FT                   protein I"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83710"
FT                   /protein_id="ADM83710.1"
FT                   /translation="MGMAAFKNPNNQYKAITIAQTLGDDASSEELAGRYGSAVQCTEVT
FT                   ASNLSTVKTKATVVEKPLKDFRASTSDQSGWVESNGKWYFYESGDVKTGWVKTDGKWYY
FT                   LNDLGVMQTGFVKFSGSWYYLSNSGAMFTGWGTDGSRWFYFDGSGAMKTGWYKENGTWY
FT                   YLDEAGIMKTGWFKVGPHWYYAYGSGALAVSTTTPDGYRVNGNGEWVN"
FT   gene            108382..113952
FT                   /locus_tag="SPAP_0117"
FT   CDS_pept        108382..113952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0117"
FT                   /product="hypothetical protein"
FT                   /note="zinc metalloprotease ZmpC"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83711"
FT                   /protein_id="ADM83711.1"
FT                   /translation="MSRKSIGEKRHSFSMRKLSVGLVSVTVSSFFLMSQGIQSVSADNM
FT                   ESPIHYKYMTEGKLTDEEKSLLVEALPQLAEESDDTYYLVYRSQQFLPNTGFNPTVGTF
FT                   LFTAGLSLLVLLVSKRENGKKRLVHFLLLTSMGVQLLPASAFGLTSQILSAYNSQLSIG
FT                   VGEHLPEPLKIEGYQYIGYIKTKKQDNTELSRTVDGKYSAQRDSQPNSTKTSDVVHSAD
FT                   LEWNQGQGKVSLQGEASGDDGLSEKSSIAADNLSSNDSFASQVEQNPDHKGESVVRPTV
FT                   PEQGNPVSATTVQSAEEEVLATTNDRPEYKLPLETKGTQEPGHEGEAAVREDLPVYTKP
FT                   LETKGTQGPGHEGEAAVREEEPAYTEPLATKGTQEPGHEGKATVREETLEYTEPVATKG
FT                   TQEPEHEGEAAVEEELPALEVTTRNRTEIQNIPYTTEEIQDPTLLKNRRKIERQGQAGT
FT                   RTIQYEDYIVNGNVVETKEVSRTEVAPVNEVVKVGTLVKVKPTVEITNLTKVENKKSIT
FT                   VSYNLIDTTSAYVSAKTQVFHGDKLVKEVDIENPAKEQVISGLDYYTPYTVKTHLTYNL
FT                   GENNEENTETSTQDFQLEYKKIEIKDIDSVELYGKENDRYRRYLSLSEAPTDTAKYFVK
FT                   VKSDRFKEMYLPVKSITENTDGTYKVTVAVDQLVEEGTDGYKDDYTFTVAKSKAEQPGV
FT                   YTSFKQLVTAMQSNLSGVYTLASDMTADEVSLGDKQTSYLTGAFTGSLIGSDGTKSYAI
FT                   YDLKKPLFDTLNGATVRDLDIKTVSADSKENVAALAKAANSANINNVAVEGKISGAKSV
FT                   AGLVASATNTVIENSSFTGKLIANHQDSNKNDTGGIVGNITGNSSRVNKVRVDALISTN
FT                   ARNNNQTAGGIVGRLENGALISNSVATGEIRNGQGYSRVGGIVGSTWQNGRVNNVVSNV
FT                   DVGDGYVITGDQYAAADVKNASTSVDNRKADRFATKLSKDQIDAKVADYGITVTLDDTG
FT                   QDLKRNLREVDYTRLNKAEAERKVAYSNIEKLMPFYNKDLVVHYGNKVATTDKLYTTEL
FT                   LDVVPMKDDEVVTDINNKKNSINKVMLHFKDNTVEYLDVTFKENFINSQVIEYNVTGKE
FT                   YIFTPEAFVSDYTAITNNVLSDLQNVTLNSEATKKVLGAANDAALDNLYLDRQFEEVKA
FT                   NIAEHLRKVLAMDKSINTTGDGVVEYVSEKIKNNKEAFMLGLTYMNRWYDINYGKMNTK
FT                   DLSTYKFDFNGNNETSTLDTIVALGNSGLDNLRASNTVGLYANKLASVKGEDSVFDFVE
FT                   AYRKLFLPNKTNNEWFKENTKAYIVEMKSDIAEVREKQESPTADRKYSLGVYDRISAPS
FT                   WGHKSMLLPLLTLPEESVYISSNMSTLAFGSYERYRDSVDGVILSGDALRTYVRNRVDI
FT                   AAKRHRDHYDIWYNLLDSASKEKLFRSVIVYDGFNVKDETGRTYWARLTDKNIGSIKEF
FT                   FGPVGKWYEYNSSAGAYANGSLTHFVLDRLLDAYGTSVYTHEMVHNSDSAIYFEGNGRR
FT                   EGLGAELYALGLLQSVDSVNSHILALNTLYKAEKDDLNRLHTYNPVERFDSDEALQSYM
FT                   HGSYDVMYTLDAMEAKAILAQNNDVKKKWFRKIENYYVRDTRHNKDTHAGNKVRPLTDE
FT                   EVANLTSLNSLIDNDIINRRSYDDNREYKRNGYYTISMFSPVYAALSNSKGAPGDIMFR
FT                   KIAYELLAEKGYHKGFLPYVSNQYGAEAFASGSKTFSSWHGRDVALVTDDLVFKKVFNG
FT                   EYSSWADFKKAMFKQRIDKQDNLKPITIQYELGNPNSTKEVTITTAAQMQQLINEAAAK
FT                   DITNIDRATSHTPASWVHLLKQKIYNAYLRTTDDFRNSIYK"
FT   gene            114308..115162
FT                   /locus_tag="SPAP_0118"
FT   CDS_pept        114308..115162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0118"
FT                   /product="Predicted ring-cleavage extradiol dioxygenase"
FT                   /note="Operon 43 Gene 1 COG2514 Predicted ring-cleavage
FT                   extradiol dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83712"
FT                   /protein_id="ADM83712.1"
FT                   /translation="MTYEYQSHIYLAEAVLNVKDLVSQTVFYQQIIGLEILSQTDTEVV
FT                   LGLGGKALVHLIQAQEGGEVREHYGLYHLAILLPTRKALADVLKHLTDLQIPLVGGADH
FT                   GYSEALYLEDLEGNGIELYRDKPVSTWDIREDGRIIGVTEVLAAQDIYELGERVEPFIL
FT                   AEGTRMGHIHLSVKDSRKSRQFYQTVLGLEDKFSVPSASWIAAGDYHHHLAVNEWGGKG
FT                   LDPRKQVLPGLAYYVIEVAHKEELLTIAQRAQEVDAPIKWMTSIQLEITDSDGIVTRIR
FT                   LAR"
FT   gene            115268..115825
FT                   /locus_tag="SPAP_0119"
FT   CDS_pept        115268..115825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0119"
FT                   /product="Acetyltransferase (isoleucine patch superfamily)"
FT                   /note="Operon 44 Gene 1 COG0110 Acetyltransferase
FT                   (isoleucine patch superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83713"
FT                   /protein_id="ADM83713.1"
FT                   /translation="MTSEYQKMIAGEFYRPSDPELRALAQASRQKQAAFNKEENPLKGA
FT                   EIIKTWFASTGKNLYINTRLMVDYGVNIHLGENFYSNWNLTMLDICPIRIGDNAMIGPN
FT                   CQFLTPLHPLDPQERNSGIEYGKPITIGDNFWTGGGVIVLPGVTLGNNVVAGAGAVITK
FT                   SFGDNVVLAGNPARVIKEIPVK"
FT   gene            116042..116806
FT                   /locus_tag="SPAP_0120"
FT   CDS_pept        116042..116806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0120"
FT                   /product="Uridine phosphorylase"
FT                   /note="Operon 45 Gene 1 COG2820 Uridine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83714"
FT                   /protein_id="ADM83714.1"
FT                   /translation="MIQKHAIPILEFDDNPQAVIMPNHEGLDLQLPKKCVYAFLGEEID
FT                   RYAREVGANCVGEFVSATKTYPVYVVNYKDEEICLVQAPVGSAPAAQFMDWLIGYGVEQ
FT                   IISTGTCGVLADIEENAFLVPVRALRDEGASYHYVAPSRYMEMQPEAIAAIERVLDDRG
FT                   IPYEEVMTWSTDGFYRETAEKVAYRKEEDCAVVEMECSALAAVAQLRGVLWGELLFTAD
FT                   SLADLDQYDSRDWGSEAFNKALELSLASVHHL"
FT   gene            117419..118798
FT                   /locus_tag="SPAP_0121"
FT   CDS_pept        117419..118798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0121"
FT                   /product="Trk-type K+ transport systems, membrane
FT                   component"
FT                   /note="Operon 46 Gene 1 COG0168 Trk-type K+ transport
FT                   systems, membrane components"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83715"
FT                   /protein_id="ADM83715.1"
FT                   /translation="MLFKLSKEKIELGLSRLSPARRIFLSFALVILLGSLLLSLPFVQV
FT                   ESSRATYFDHLFTAVSAVCVTGLSTLPVAHTYNIWGQIICLLLIQIGGLGLMTFIGVFY
FT                   IQSKQKLSLRSRATIQDSFSYGETRSLRKFVYSIFLTTFLVESLGAILLSFRLIPQLGW
FT                   GRGLFSSIFLAISAFCNAGFDNLGSTSLFAFQTDLLVNLVIAGLIITGGLGFMVWFDLA
FT                   GHVGRKKKGRLHFHTKLVLLLTIGLLLFGTATTLFLEWNNAGTIGNLPVADKVLVSFFQ
FT                   TVTMRTAGFSTIDYTQAHPVTLLIYILQMFLGGAPGGTAGGLKITTFFVLLVFARSELL
FT                   GLPHANVARRTIAPRTVQKSFSVFIIFLMSFLIGLILLGITAKGNPPFIHLIFETISAL
FT                   STVGVTANLTPDLGKLALSVIMPLMFMGRIGPLTLFVSLADYHPEKKDMIHYMKADISI
FT                   G"
FT   gene            118812..119477
FT                   /locus_tag="SPAP_0122"
FT   CDS_pept        118812..119477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0122"
FT                   /product="K+ transport systems, NAD-binding component"
FT                   /note="Operon 46 Gene 2 COG0569 K+ transport systems,
FT                   NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83716"
FT                   /protein_id="ADM83716.1"
FT                   /translation="MSDRTIGILGLGIFGSSVLAALAKQDMNIIAIDDHAERINQFEPV
FT                   LARGVIGDITDEELLRSAGIDTCDTVVVATGENLESSVLAVMHCKSLGVPTVIAKVKSQ
FT                   TAKKVLEKIGADSVISPEYEMGQSLAQTILFHNSVDVFQLDKNVSIVEMKIPQSWAGQS
FT                   LSKLDLRGKYNLNILGFREQENSPLDVEFGPDDLLKADTYILAVINNQYLDTLVALNS"
FT   gene            119612..119815
FT                   /locus_tag="SPAP_0123"
FT   CDS_pept        119612..119815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0123"
FT                   /product="hypothetical protein"
FT                   /note="Operon 47 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83717"
FT                   /protein_id="ADM83717.1"
FT                   /translation="MKIKDQTRKLATGCLKHCFEVVDRTDEVSSKHCFEVVDRTDEVSS
FT                   KHCFEVADRTDEVSNIYTARRC"
FT   gene            119877..120050
FT                   /locus_tag="SPAP_0124"
FT   CDS_pept        119877..120050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0124"
FT                   /product="hypothetical protein"
FT                   /note="Operon 47 Gene 2 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83718"
FT                   /protein_id="ADM83718.1"
FT                   /translation="MKLLSIAISSYNAAAYLHYCVESLVIGWDQVGNFSKGQYIMMHSL
FT                   IYRTDLLRASQF"
FT   gene            120117..120527
FT                   /locus_tag="SPAP_0125"
FT   CDS_pept        120117..120527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0125"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /note="Operon 47 Gene 3 COG0463 Glycosyltransferases
FT                   involved in cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83719"
FT                   /protein_id="ADM83719.1"
FT                   /translation="MYYLPVDFYRYLIGREGQSVNEQVMIKCIDQQLKVNRLLVDQLDL
FT                   SQVSHPKMREYLLNHIEITTVISSTLLNRSETAEHLAKKRQLWTYIQQKNPEVFQAIRK
FT                   TMLSRLTKHSVLPDRKLSNVVYQITKSVYGFN"
FT   gene            120643..122304
FT                   /locus_tag="SPAP_0126"
FT   CDS_pept        120643..122304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0126"
FT                   /product="hypothetical protein"
FT                   /note="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83720"
FT                   /protein_id="ADM83720.1"
FT                   /translation="MKFNPNQRYTRWSIRRLSVGVASVVVASGFFVLVGQPSSVRADVV
FT                   NPTPGQVLPEETSGTKEGDLSEKPGDTVLTQAKPEGVTGNTNSLPTPTERTEVSEETNS
FT                   SSLDTLFEKDEEAQKNPELTDVLKETVDTADVDGTQASPAETTPEQVKGGVKENTKDSI
FT                   DVPAAYLEKAEGKGPFTAGVNQVIPYELFAGDGMLTRLLLKASDNAPWSDNGTAKNPAL
FT                   PPLEGLTKGKYFYEVDLNGNTVGKQGQALIDQLRANGTQTYKATVKVYGNKDGKADLTN
FT                   LVATKNVDININGLVAKETVEKAVKDNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYE
FT                   LFAGDGMLTRLLLKASDKAPWSDNGDAKNPALSPLGENVKTKGQYFYQVALDGNVAGKE
FT                   KQALIDQFRANGTQTYSATVNVYGNKDGKPDLDNIVATKKVTIKINVKETSDTANGSLS
FT                   PSNSGSGVTPMNHNHATGTTDSMPADTMTSSTNTMAGENMAASANKMSDTMMSEDKAML
FT                   PNTGETQTSMASIGFLGLALAGLLGGLGLKNKKEEN"
FT   gene            122471..123169
FT                   /locus_tag="SPAP_0127"
FT   CDS_pept        122471..123169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0127"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /note="Operon 49 Gene 1 COG0745 Response regulators
FT                   consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83721"
FT                   /protein_id="ADM83721.1"
FT                   /translation="MGKTILLVDDEVEITDIHQRYLIQAGYQVLVAHDGLEALELFKKK
FT                   PIDLIITDVMMPRMDGYDLISEVQYLSPEQPFLFITAKTSEQDKIYGLSLGADDFIAKP
FT                   FSPRELVLRVHNILRRLHRGGETELISLGNLKMNHSSHEVQIGEEMLDLTVKSFELLWI
FT                   LASNPERVFSKTDLYEKIWKEDYVDDTNTLNVHIHALRQELAKYSSDQTPTIKTVWGLG
FT                   YKIEKPRGQT"
FT   gene            123166..124218
FT                   /locus_tag="SPAP_0128"
FT   CDS_pept        123166..124218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0128"
FT                   /product="Signal transduction histidine kinase"
FT                   /note="Operon 49 Gene 2 COG0642 Signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83722"
FT                   /protein_id="ADM83722.1"
FT                   /translation="MKLKSYILVGYIISTLLTILVVFWAVQKMLIAKGEIYFLLGMTIV
FT                   ASLVGAGISLFLLLPVFTSLGKLKEHAKRVAAKDFPSNLEVQGPVEFQQLGQTFNEMSH
FT                   DLQVSFDSLEESEREKGLMIAQLSHDIKTPITSIQATVEGILDGIIKESEQAHYLATIG
FT                   RQTERLNKLVEELNFLTLNTARNQVETTSKDSIFLDKLLIECMSEFQFLIEQERRDVHL
FT                   QVIPESARIEGDYAKLSRILVNLVDNAFKYSAPGTKLEVVAKLEKDQLSISVTDEGQGI
FT                   APEDLENIFKRLYRVETSRNMKTGGHGLGLAIARELAHQLGGEITVSSQYGLGSTFTLV
FT                   LNLSGSENKA"
FT   gene            124413..125024
FT                   /locus_tag="SPAP_0129"
FT   CDS_pept        124413..125024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0129"
FT                   /product="hypothetical protein"
FT                   /note="Operon 50 Gene 1 protein supported
FT                   gi|15900029|ref|NP_344633.1| 30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83723"
FT                   /protein_id="ADM83723.1"
FT                   /translation="MSRYTGPSWKQARRLGLSLTGTGKELARRNYVPGQHGPNNRSKLS
FT                   EYGLQLAEKQKLRFTYGVGEKQFRNLFVQATKIKGGILGFNFMLLLERRLDNVVYRLGL
FT                   ATTRRQARQFVNHGHILVDGKRVDIPSYRVTPGQVISVREKSLKVPAILEAVEATLGRP
FT                   AFVSFDAEKLEGSLTRLPERDEINPEINEALVVEFYNKML"
FT   gene            125209..125367
FT                   /locus_tag="SPAP_0130"
FT   CDS_pept        125209..125367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0130"
FT                   /product="Transposase-like protein, IS630"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83724"
FT                   /protein_id="ADM83724.1"
FT                   /translation="MEYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWLKLKEKT
FT                   GELNHQV"
FT   gene            complement(125465..125605)
FT                   /locus_tag="SPAP_0131"
FT   CDS_pept        complement(125465..125605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0131"
FT                   /product="Transposase-like protein, ISSpn2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83725"
FT                   /protein_id="ADM83725.1"
FT                   /translation="MKSTKEEIQTIKTLLKDSRTAKYHKRLQIVLFRLMGKSYKEIIEL
FT                   L"
FT   gene            125685..125945
FT                   /locus_tag="SPAP_0132"
FT   CDS_pept        125685..125945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0132"
FT                   /product="hypothetical protein"
FT                   /note="Operon 53 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83726"
FT                   /protein_id="ADM83726.1"
FT                   /translation="MTGVSNPTTDSARLVLADSKKAFADDSLIEQGLRDILQTVKDAIA
FT                   SLESIKESQSATKDGGQTAGKETAGEDESANQTQEISQGIK"
FT   gene            125860..126120
FT                   /locus_tag="SPAP_0133"
FT   CDS_pept        125860..126120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0133"
FT                   /product="hypothetical protein"
FT                   /note="Operon 53 Gene 2 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83727"
FT                   /protein_id="ADM83727.1"
FT                   /translation="MEDKQRAKKQQEKMSLQIKLKKLAKELSKLLKDSNLETVDKDVLE
FT                   NSQEELQKAVLFLADEKGSEHTAAELIDNLKEVIAKLKANA"
FT   gene            126439..127368
FT                   /locus_tag="SPAP_0134"
FT   CDS_pept        126439..127368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0134"
FT                   /product="ABC-type polysaccharide transport system,
FT                   permease component"
FT                   /note="Operon 54 Gene 1 COG4209 ABC-type polysaccharide
FT                   transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83728"
FT                   /protein_id="ADM83728.1"
FT                   /translation="MKKFSKTLRDNWIFLLMVLPGALWLILFFYIPVFGNVVAFKDYHM
FT                   TSNGFIDSIINSKWVGLDNFRFLFSSRDAFIITRNTVLYNLGFIFLGLVVSVGIAIILS
FT                   ELRSKRMVKIFQTSMLFPYFLSWVIISFFTDAFLNIDKGVFNHLLESLGLKEVNFYADL
FT                   GIWPYLLLFLGIWKGFGYSSVMYYATIMGIDPTYYEAATVDGASKWQRIRNVTIPQLTP
FT                   LVTVLTILAVGNIFRADFGLFYQIPHNAGQLYNVTNVLDVYVFNGLTQTADIGMAAAAG
FT                   LYQSVVGLILVILSNLLARRVDPNSALF"
FT   gene            127382..128305
FT                   /locus_tag="SPAP_0135"
FT   CDS_pept        127382..128305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0135"
FT                   /product="ABC-type sugar transport system, permease
FT                   component"
FT                   /note="Operon 54 Gene 2 COG0395 ABC-type sugar transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83729"
FT                   /protein_id="ADM83729.1"
FT                   /translation="MAKKKIKKEKIDNVGIHSFSKKADIFFSIISGLIALSCILPFVFV
FT                   IIISVTDEKSLLQYGYSFFPSQFGLDGFEFLAQFKDKILQALFISVFVTVVGTLTNVFI
FT                   TTTYAYAISRTTFKYRRFFTIFVLLSMLFNAGLVPGYIMVTRVLQLGDTVWALIVPMLL
FT                   SPFNIILMRSFFKKTIPAAILESARIDGASEARIFFQICLPLSLPGIATITLLTALGFW
FT                   NDWFNALLYIKSDNLYPLQYLLMQIQQNMDYIAKAVGLTGQLGVALPKETGRMAMVVVA
FT                   TLPIAILYPFFQRYFVKGLTIGGVKE"
FT   gene            128409..129884
FT                   /locus_tag="SPAP_0136"
FT   CDS_pept        128409..129884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0136"
FT                   /product="hypothetical protein"
FT                   /note="Operon 54 Gene 3 protein supported
FT                   gi|15900035|ref|NP_344639.1| ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83730"
FT                   /protein_id="ADM83730.1"
FT                   /translation="MKNWKKYAFASASVVALAAGLAACGNLTGNSKKAADSGDKSVIKM
FT                   YQIGDKPDNLDELLANANKIIEEKVGAKLDIQYLGWGDYGKKMSVITSSGENYDIAFAD
FT                   NYIVNAQKGAYADLTELYKKEGKDLYKALDPAYIKGNTVNGKIYAVPVAANVASSQNFA
FT                   FNGTLLAKYGIDISGVTSYETLEPVLKQIKEKAPDVVPFAIGKVFIPSDNFDYPVANGL
FT                   PFVIDLEGDTTKVVNRYEVPRFKEHLKTLHKFYEAGYIPKDVATSDTSFDLQQDTWFVR
FT                   EETVGPADYGNSLLSRVANKDIQIKPITNFIKKNQTTQVANFVISNNSKNKEKSMEILN
FT                   LLNTNPELLNGLVYGPEGKNWEKIEGKENRVRVLDGYKGNTHMGGWNTGNNWILYINEN
FT                   VTDQQIENSKKELAEAKESPALGFIFNTDNVKSEISAIANTMQQFDTAINTGTVDPDKA
FT                   IPELMEKLKSEGAYEKVLNEMQKQYDEFLKNKK"
FT   gene            130156..131142
FT                   /locus_tag="SPAP_0137"
FT   CDS_pept        130156..131142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0137"
FT                   /product="Predicted sulfurtransferase"
FT                   /note="Operon 55 Gene 1 COG1054 Predicted
FT                   sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83731"
FT                   /protein_id="ADM83731.1"
FT                   /translation="MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEG
FT                   INGTVSGDYETTQKYMDYVHSLPGMEELWFKIDEESEQAFKKMFVRYKKEIVHLGLEDN
FT                   DFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTRNDYEYDLGHFRGAIRPDIRNFRE
FT                   LPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVQ
FT                   GELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEENE
FT                   DKYLRGCSHECRVHPRNRYVSKNELTQAEVIERLAAIGESLDQAATV"
FT   gene            131264..132115
FT                   /locus_tag="SPAP_0138"
FT   CDS_pept        131264..132115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0138"
FT                   /product="hypothetical protein"
FT                   /note="Operon 55 Gene 2 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83732"
FT                   /protein_id="ADM83732.1"
FT                   /translation="MAKTFFIPNKQSILGEQEILNAKSILALLDGLESHSYDVVYLRQP
FT                   LNRLEYIECAIVGQSQFLFKVSYADGQKAYRVDVPDLLTKTDWQIIKSFLDALLAYTGT
FT                   DIEGLDGFDFEAYFQASIQAYLADPVARFTICQGIFNPIFFSRENLKSFLEADGLAQFE
FT                   ARVRAVQETDAYFARVSFYQDGEGKVHGVYHLAQGVKTVLPREPFVPAAYIEQLVDKEV
FT                   QWEIDLVQITGDGSKPEDYESIARLDYAKFLEVLPPSFYHQLDANQIEIQPILVQDFKT
FT                   LA"
FT   gene            complement(132196..133260)
FT                   /locus_tag="SPAP_0139"
FT   CDS_pept        complement(132196..133260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0139"
FT                   /product="hypothetical protein"
FT                   /note="Operon 56 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83733"
FT                   /protein_id="ADM83733.1"
FT                   /translation="MKQEWFESNDFVKTTSKNKPEERAQEVADKAEETIANLDTPIGKN
FT                   TQVEEEVSQAEVELESQQEEKIEAPEDSEARTGIEEKKASNSTEEEPDLSKETEKVTIA
FT                   EESQEALPQQKATTKEPLLISKSLESPYIPDQAPKSRDKWKEQVLDFWSWLVEAIKSPT
FT                   SKLETSITHSYTAFLLLILFSASSFFFSIYHIKHAYYGHIASINSRFPEQLAPLTLFSI
FT                   VSILVATTLFFFSFLLGSFVVRRFIHQEKDWTLDKVLQQYSQLLAIPIFLTAIASFFAF
FT                   FDSLRFTALLCVISIGIILLASLHIITRPSQASETDSFYQLFLSVLVNGVIILLFFVAE
FT                   VALIGDYLRILAFL"
FT   gene            complement(133323..134234)
FT                   /locus_tag="SPAP_0140"
FT   CDS_pept        complement(133323..134234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0140"
FT                   /product="hypothetical protein"
FT                   /note="Operon 56 Gene 2 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83734"
FT                   /protein_id="ADM83734.1"
FT                   /translation="MRKWTKGFLIFGVVTTVIGFILLFVGIQSDGIKSLLSMSKEPVYD
FT                   SRTEKLTFGKEVENLEITLHQHALTITDSFDDQIHISYHPSLSANHDLITNQNDRTLSL
FT                   TDKKLSETPFLSSGIGGILHIASSYSSRFEEVILQLPKGRTLKGINISANRGQTTIINA
FT                   SLENATLNTNSYILRIEGSRIKNSKLTTPNIVNIFDTVLTDSQLESTENHFHAENIQVH
FT                   GKVELTAKDYLRIILDQKESQRINWDISSNYGSIFQFTREKPESRGTELSNPYKTEKTD
FT                   VKDQLIARSDDNIDLISTPSRR"
FT   gene            complement(134227..134820)
FT                   /locus_tag="SPAP_0141"
FT   CDS_pept        complement(134227..134820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0141"
FT                   /product="Predicted membrane protein"
FT                   /note="Operon 56 Gene 3 COG4709 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83735"
FT                   /protein_id="ADM83735.1"
FT                   /translation="MTRTEYLTQLELYLKKLPEADRIEAMDYFRELFDDAGVEGEEELI
FT                   ASLGTPKEAAHEVLSNLLDKKINEAPAQKNNRQILHIALLALLAAPIGIPLGIAILVTL
FT                   FAILVAALTVILAFFAVSILGIIGGFLFLVESFTILAQAKSAFILIFGSGLLAIGASSL
FT                   VLLGISYVARFFGLLIVRLVQFVLKKGKRGNQHA"
FT   gene            complement(134807..135133)
FT                   /locus_tag="SPAP_0142"
FT   CDS_pept        complement(134807..135133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0142"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="Operon 56 Gene 4 COG1695 Predicted transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83736"
FT                   /protein_id="ADM83736.1"
FT                   /translation="MYFPTSSALIEFLILAVLEQGDSYGYEISQTIKLIANIKESTLYP
FT                   ILKKLEGNSFLTTYSREFQGRMRKYYSLTNGGIEQLLTLKDEWALYTDTINGIIEGSIR
FT                   HDKN"
FT   gene            complement(135272..136438)
FT                   /locus_tag="SPAP_0143"
FT   CDS_pept        complement(135272..136438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0143"
FT                   /product="Cyanate permease"
FT                   /note="Operon 57 Gene 1 COG2807 Cyanate permease"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83737"
FT                   /protein_id="ADM83737.1"
FT                   /translation="MKKQSLFFVPGIILIGVSLRTPFTVLPIILGNISQGLEVEVSSLG
FT                   VLTSLPLLMFTLFSPFSTQLAQKIGLEHLFTYSLFFLTIGSLIRLINLPLLYLGTLMVG
FT                   ASVAVINVLLPSLIQANQPKKIGFLTTLYVTSMGIATALASYLAVPITQASSWKGLILL
FT                   LTLLCLATFLVWLPNHRYNHRLAPQTKQKSQIKVMRNKQVWAIIIFSGFQSLIFYTVMT
FT                   WLPTMSIHAGLSSHEAGLLTSILSLISIPFSMTIPSLTTSLSTRNRQLMLTLVSLAGVV
FT                   GISMLFFPINNFIYWLAIHLLIGTATSALFPYLMVNFSLKTSAPEKTAQLSGLSQTGGY
FT                   ILAAFGPTLFGYSFDLFHSWVPSVAALLLIDILMTVALFTVDRADKIL"
FT   gene            136496..137656
FT                   /locus_tag="SPAP_0144"
FT   CDS_pept        136496..137656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0144"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /note="Operon 58 Gene 1 COG0463 Glycosyltransferases
FT                   involved in cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83738"
FT                   /protein_id="ADM83738.1"
FT                   /translation="MSSKVSGFQDKNGKVLKIMIEWWKEKFRRVVVTQNVESLLVSIVI
FT                   SAYNEEKYLPGLIEDLKNQTYPKENIEILFINAMSTDGTTAIIQQFIKEDTEFNSIRLY
FT                   NNPKKNQASGFNLGVKHSVGDLILKIDAHSKVTESFVMNNVAIIQQGEFVCGGPRPTIV
FT                   EGKGKWAETLHLVEENMFGSSIANYRNSSEDRYVSSIFHGMYKREVFQKVGLVNEQLGR
FT                   TEDNDIHYRIREHGYKIRYSPSILSYQYIRPTFKKMLHQKYSNGLWIGLTSHVQFKCLS
FT                   LFHYVPCLFVLSLVFSLALLPITFVFITLLLGAYFLLLSLLTLLTLLKHKNGFLIVMPF
FT                   LLFSIHFAYGLGTIVGLIRGFKWKKEYKGTIIYLDKISQINQNMLQ"
FT   gene            137695..139545
FT                   /locus_tag="SPAP_0145"
FT   CDS_pept        137695..139545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0145"
FT                   /product="Predicted nucleoside-diphosphate sugar epimerase"
FT                   /note="Operon 58 Gene 2 COG1086 Predicted
FT                   nucleoside-diphosphate sugar epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83739"
FT                   /protein_id="ADM83739.1"
FT                   /translation="MNKKLTDYVIDLVEILNKQQKQVFWGIFDIFSMVVSIIVSYILFY
FT                   GLINPAPVDYIIYTSLAFLFYQLMIGFWGLNASISRYSKITDFMKIFFGVTASSVLSYS
FT                   ICYAFLPLFSIRFIILFILLSTFLILLPRITWQLIYSRRKKGSGDGEHRRTFLIGAGDG
FT                   GALFMDSYQHPTSELELVGILDKDSKKKGQKLGGIPVLGSYDNLPELAKRHQIERVIVA
FT                   IPSLDPSEYERILQMCNKLGVKCYKMPKVETVVQGLHQAGTGFQKIDITDLLGRQEIRL
FT                   DESRLGAELTGKTILVTGAGGSIGSEICRQVSRFNPERIVLLGHGENSIYLVYHELIRK
FT                   FQGIDYVPVIADIQDYDRLLQVFEQYKPAIVYHAAAHKHVPMMERNPKEAFKNNIRGTY
FT                   NVARAVDEAKVPKMVMISTDKAVNPPNVMGATKRVAELIVTGFNQRSQSTYCAVRFGNV
FT                   LGSRGSVIPVFERQIAEGGPVTVTDFRMTRYFMTIPEASRLVIHAGAYAKDGEVFILDM
FT                   GKPVKIYDLAKKMVLLSGHTESEIPIVEVGIRPGEKLYEELLVSTELVDNQVMDKIFVG
FT                   KVNVMPLESINQKIGEFRTLSGDELKQAIIAFANQTTHIE"
FT   gene            complement(139805..140437)
FT                   /locus_tag="SPAP_0146"
FT   CDS_pept        complement(139805..140437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0146"
FT                   /product="Predicted phosphatase"
FT                   /note="Operon 59 Gene 1 COG0546 Predicted phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83740"
FT                   /protein_id="ADM83740.1"
FT                   /translation="MTSITAIFFDLDGTLVDSSIGIHNAFTYTFKELGVPSPDAKTIRG
FT                   FMGPPLESSFATCLSKDQISEAMQIYRSYYKAKGIYEAQLFPQIIDLLEELSSSYPLYI
FT                   TTTKNTSTAQDMAKNLEIHHFFDGIYGSSPEAPHKADVIHQALQTHQLAPEQAIIIGDT
FT                   KFDMLGARETGIQKLAVTWGFGEQADLLNYQPDYIAHKPLEVLAYFQ"
FT   gene            complement(140459..141331)
FT                   /locus_tag="SPAP_0147"
FT   CDS_pept        complement(140459..141331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0147"
FT                   /product="L-serine deaminase"
FT                   /note="Operon 59 Gene 2 COG1760 L-serine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83741"
FT                   /protein_id="ADM83741.1"
FT                   /translation="MFYSIKELVEQADLDFQGNVAELMITTEFELTGREREEVFLLMER
FT                   NLEVMKASVQLGLNENKSRSGLTGGDAAKLDHYIENGKTLSDYTILSAARNAIAVNEHN
FT                   AKMGLVCATPTAGSAGCLPSVLTAAIEKLDLSHEQQLDFLFAAGAFGLVIANNASISGA
FT                   EGGCQAEVGSASAMSAAALTLAAGGTPYQASQAIAFVIKNMLGLICDPVAGLVEVPCVK
FT                   RNAMGASFAFIAADMALAGIESKIPVDEVIDAMYQVGASMPTAFRETAEGGLATTPTGR
FT                   RLQKEIFGE"
FT   gene            complement(141340..142011)
FT                   /locus_tag="SPAP_0148"
FT   CDS_pept        complement(141340..142011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0148"
FT                   /product="L-serine deaminase"
FT                   /note="Operon 59 Gene 3 COG1760 L-serine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83742"
FT                   /protein_id="ADM83742.1"
FT                   /translation="MKSLRFQSVFDIIGPVMIGPSSSHTAGAVRIGKIVSSIFDDTPTE
FT                   VEFQLFNSFAKTYRGHGTDLALVAGILGMDTDDPEIPNSLEIAHKRGIKIVWTIQKDSN
FT                   APHPNTTKITVKNAHKTISVTGISIGGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGM
FT                   IALVTEALSRYGINIAQMNVTREKAGEKAIMIIEVDSRNCDEAIEEIRKIPHLHNVNFF
FT                   K"
FT   gene            142253..142840
FT                   /locus_tag="SPAP_0149"
FT   CDS_pept        142253..142840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0149"
FT                   /product="hypothetical protein"
FT                   /note="Operon 60 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83743"
FT                   /protein_id="ADM83743.1"
FT                   /translation="MKSITKKIKATLAGVAALFAVFAPSFVSAQESSTYTVKEGDTLSE
FT                   IAETHNTTVEKLAENNHIDNIHLIYVDQELVIDGPVAPVATPAPATYAAPAAQDETVSA
FT                   PVAETPVVSETVVSTVSGSEAEAKEWIAQKESGGSYTATNGRYIGRYQLTDSYLNGDYS
FT                   AENQERVADAYVAGRYGSWTAAKNFWLNNGWY"
FT   gene            complement(142892..143212)
FT                   /locus_tag="SPAP_0150"
FT   CDS_pept        complement(142892..143212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0150"
FT                   /product="hypothetical protein"
FT                   /note="Operon 61 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83744"
FT                   /protein_id="ADM83744.1"
FT                   /translation="MQRLEVYKNYQRLYDLRIAILLNLSTLYLYNQDKNMCKQICYTLL
FT                   EDAKNKKSYDRLAICYVRIGICTDDSKLIQKGFSLLELTEETSMLSHLKKEVEIYYQAK
FT                   ER"
FT   gene            complement(143420..143644)
FT                   /locus_tag="SPAP_0151"
FT   CDS_pept        complement(143420..143644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0151"
FT                   /product="hypothetical protein"
FT                   /note="Operon 62 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83745"
FT                   /protein_id="ADM83745.1"
FT                   /translation="MIYFSYYRELFRKNSYSNLSTSIVVHWTHLPSISFHFLTTNLLLT
FT                   GRMVRFCIRSLNNQSSIKQTLTITQESVQ"
FT   gene            143643..143930
FT                   /locus_tag="SPAP_0152"
FT   CDS_pept        143643..143930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0152"
FT                   /product="hypothetical protein"
FT                   /note="Operon 63 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83746"
FT                   /protein_id="ADM83746.1"
FT                   /translation="MRKLVKIGVASLMVCGILATTNALAVWVEGGQWNYGVGWTGTFGY
FT                   SDYLHSTRYHTATVRHGGRTSKDYAKPEAWARASLTKIPPTGMEYFYGFE"
FT   gene            143982..146090
FT                   /locus_tag="SPAP_0153"
FT   CDS_pept        143982..146090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0153"
FT                   /product="hypothetical protein"
FT                   /note="Operon 63 Gene 2 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83747"
FT                   /protein_id="ADM83747.1"
FT                   /translation="MKKISNFCMLLLLLCTTFFVFNVNYTREVVRIQEMGKTVDSLDLY
FT                   LKDINEPAASVLRFFEDVSKEYKVSIIKTDSGDEVVKSGVFDKDTFPYQEFGISSLDFT
FT                   TDGEGVYSNKEISNKLGTIPTFLKAKPIQLMTFQTYIKDTSRSLNGRYTITSTQEMDKD
FT                   RIVQKWSDFFKIDQATLLEPTYKSAVEVINRDLLLSAIVFVLAILLLVLVTVYQPMMEM
FT                   KRVGVQKLLGFQDRAVLADVVKGNLYLLLGGTLVINLGVFFLLDYKPKDLFPMLWLSHF
FT                   LLLQLYLFISWLTYLLIQKMTISSLLKGFSSFKFGLIFNYVMKIGTTILLTALLIGVGR
FT                   SLEQENKELAYQQQWVSQGNYLTLETFKLNDNLWQEELAGSGKSTDYFYRFYQDLVEKT
FT                   QAGYVQSSSLPVKNFVQSEQIQQYQLTDTVDVYYANRNFLKSKGFKLPNTGIKKVILMP
FT                   ASTKGEEDKNQLLGKLIAFHSMKYEEQQKRTIEEMDVEIAYYEGDWSFFPYSDKRKENL
FT                   SNPIISLVNDSDMMWDEKASLSTTGLNNPIKIENTVQHQKEITELVEKLSDGNYLKFSS
FT                   IQAIQQEKVDSYRDAVRNFNLLFALFGLLSMMISYFLLVTTFLLKRRDIITKKFMGWKL
FT                   VDRYRPLLVLLLLGYSFPLLVLIFFAHAFLPLLLFAGFTCLDILFVLGLASSMEKRSLV
FT                   ELLKGGIL"
FT   gene            146087..146728
FT                   /locus_tag="SPAP_0154"
FT   CDS_pept        146087..146728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0154"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /note="Operon 63 Gene 3 COG1136 ABC-type antimicrobial
FT                   peptide transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83748"
FT                   /protein_id="ADM83748.1"
FT                   /translation="MIELKNITKTIGGKVILDNLSLRIDQGDLVAIVGKSGSGKSTLLN
FT                   LLGLIDGDYSGRYEIFGQTNLAVNSAKSQTIIREHISYLFQNFALIDDETVEYNLMLAL
FT                   KYVKLPKKDKLKKVEEILERVGLSATLHQRVSELSGGEQQRIAVARAILKPSQLILADE
FT                   PTGSLDPENRDLVLKFLLEMNREGKTVIIVTHDAYVAQQCHRVIELGEGK"
FT   gene            146935..147741
FT                   /locus_tag="SPAP_0155"
FT   CDS_pept        146935..147741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0155"
FT                   /product="ABC-type amino acid transport/signal transduction
FT                   systems, periplasmic component/domain protein"
FT                   /note="Operon 64 Gene 1 COG0834 ABC-type amino acid
FT                   transport/signal transduction systems, periplasmic
FT                   component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83749"
FT                   /protein_id="ADM83749.1"
FT                   /translation="MNKMKKVLMTMFGLVMLPLLFACSNNQSAGIEAIKSKGKLVVALN
FT                   PDFAPFEYQKVVDGKNQIVGSDIELAKAIATELGVELELSPMSFDNVLASVQSGKADLA
FT                   ISGVSKTDERSKVFDFSTPYYTAKNKLIVKKSDLATYQSVNDLAQKKVGAQKGSIQETM
FT                   AKDLLQNSSLVSLPKNGNLITDLKSGQVDAVIFEEPVAKGFVENNPDLAIADLNFEKEQ
FT                   DDSYAVAMKKDSKELKEAVDKTIQKLKESGELDKLIEDAFKASIEK"
FT   gene            147758..148954
FT                   /locus_tag="SPAP_0156"
FT   CDS_pept        147758..148954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0156"
FT                   /product="Argininosuccinate synthase"
FT                   /note="Operon 64 Gene 2 COG0137 Argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83750"
FT                   /protein_id="ADM83750.1"
FT                   /translation="MSKEKVILAYSGGLDTSVAITWLKKDYDVVAVCMDVGEGKDLDFI
FT                   HDKALKVGAVESYVIDVKDEFATDYVLVAHQSHAYYEQKYPLVSALSRPLISKKLVEIA
FT                   HQIGATTIAHGCTGKGNDQVRFEVSIAALDLNLKVIAPVREWKWSREEEIYYAKENGVP
FT                   VPADLDNPYSVDQNLWGRANECGILENPWNQAPEEAFGITSSPEAAPDMPEYIDIEFSE
FT                   GVPVSLNGEVLKLADLIQKLNEIAGKHGVGRIDHVENRLVGIKSREIYECPGAVTLLTA
FT                   HKEIEDLTLVREVAHFKPIIENELSNLIYNALWFSPATQALIAYIKETQKVVNGTAKVK
FT                   LYKGSAQVVARKSPNSLYDENLATYTSADTFDQDAAVGFIKLWGLPTKVHSEVQKSAK"
FT   gene            148983..150374
FT                   /locus_tag="SPAP_0157"
FT   CDS_pept        148983..150374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0157"
FT                   /product="Argininosuccinate lyase"
FT                   /note="Operon 64 Gene 3 COG0165 Argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83751"
FT                   /protein_id="ADM83751.1"
FT                   /translation="MAKNTKLWGGRFEGTVEDWVERFGASISFDQKLAKFDLIGSLAHV
FT                   QMLGQTGILSLEESEKIQAGLKELLEELEAGQLDFDIANEDIHMNMEVLLTEKIGPLAG
FT                   KLHTARSRNDQVATDMHLYLKEQLGHVLDKLVHLKGVLLDLAENHVETIMPGYTHLQHA
FT                   QPISFAHHLMAYYNMFQRDSERFEFNQKHTDLCPLGAAALAGTTFPIDRQLSSDLLEFK
FT                   KPYTNSLDAVSDRDFILEFLSNASILMMHMSRFCEEMINWCSFEYQFITLSDTFTTGSS
FT                   IMPQKKNPDMAELIRGKTGRVYGHLFGLLTVMKSLPLAYNKDLQEDKEGMFDTVETILN
FT                   SLDVLAGMLSSLQVNKEKMQESTEKDFSNATELADYLAGKGLPFREAHEVVGRLVLDSI
FT                   KSAKNLQDWTLEELQTYHSLITEDIYVYLQPKTAVQRRNSLGGTGFDQVEYQIAVAKKA
FT                   NEAKK"
FT   gene            complement(150561..151424)
FT                   /locus_tag="SPAP_0158"
FT   CDS_pept        complement(150561..151424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0158"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="Operon 65 Gene 1 COG1396 Predicted transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83752"
FT                   /protein_id="ADM83752.1"
FT                   /translation="MRYDFGKVYKEIRESKGLTQEEVCGGVLSRTSLSKIESGKTTPKY
FT                   ENMEFLLRQINMSFEEFEYICQLYQPSQRTEIMQTYLNMRSIIGTSDLVNLFQKCQDYL
FT                   KTHHDLPIEEIRDMLEVVIYIRQHGAGELSDHAEQVVKKLWRKIEKQDTWYESDLKILN
FT                   TILFSFPIEYLHLITGKILQRLEVYKNYQHLYDLRIAILLNLSTLYLYNQDKNMCKQIC
FT                   YTLLEDAKNKKSYDRLAICYVRIGICTDDSKLIQKGFSLLELTEETSMLSHLKKEVETH
FT                   YQPKKL"
FT   gene            151992..152228
FT                   /locus_tag="SPAP_0159"
FT   CDS_pept        151992..152228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0159"
FT                   /product="hypothetical protein"
FT                   /note="Operon 66 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83753"
FT                   /protein_id="ADM83753.1"
FT                   /translation="MKIREIIGTDMYGTTVSGIVSGLNKLNFTVKAVRVALEDLTPKLT
FT                   FPAILQVKNDLGQNHFVVLHSIKEKINGTRITK"
FT   gene            152206..152700
FT                   /locus_tag="SPAP_0160"
FT   CDS_pept        152206..152700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0160"
FT                   /product="hypothetical protein"
FT                   /note="Operon 66 Gene 2 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83754"
FT                   /protein_id="ADM83754.1"
FT                   /translation="MELVLPNNYVALEQEEMMYLDGGAYLSKSACQGICAALAMSPGTF
FT                   IALTGAAVLTKKLINYIKVGGLGGWLIGAAAGVLALIFLIKICVDTTIKVLLNRIFKAS
FT                   KVMKRRIFSLFVLDLMVYIFLGYVLVIQKDVYLFSILIIFSNFSVPFIREKEYELFKNK
FT                   K"
FT   gene            152854..153066
FT                   /locus_tag="SPAP_0161"
FT   CDS_pept        152854..153066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0161"
FT                   /product="hypothetical protein"
FT                   /note="Operon 67 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83755"
FT                   /protein_id="ADM83755.1"
FT                   /translation="MLIVLISVIVALLYHKITEYVNNRKIDIVIFLSLLISHFIWNYYF
FT                   LPIEILIAISGANLLLSFLKKLQTK"
FT   gene            153440..153565
FT                   /locus_tag="SPAP_0162"
FT   CDS_pept        153440..153565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0162"
FT                   /product="hypothetical protein"
FT                   /note="Operon 68 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83756"
FT                   /protein_id="ADM83756.1"
FT                   /translation="MATITNALNIAATVAEVFSLGGAIAYGLDIVDGKFDGYLWA"
FT   gene            153546..153791
FT                   /locus_tag="SPAP_0163"
FT   CDS_pept        153546..153791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0163"
FT                   /product="hypothetical protein"
FT                   /note="Operon 68 Gene 2 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83757"
FT                   /protein_id="ADM83757.1"
FT                   /translation="MGIYGRKTIAMKHFFAGIGEIHFLLFLLYLSMSASPIIGLVIGYT
FT                   KINLINSIIIALGMILALILVLSRVYRKYFYRDDDD"
FT   gene            153948..155006
FT                   /locus_tag="SPAP_0164"
FT   CDS_pept        153948..155006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0164"
FT                   /product="hypothetical protein"
FT                   /note="Operon 69 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83758"
FT                   /protein_id="ADM83758.1"
FT                   /translation="MKDDQKYLLAGLYSLLVAIFYFPLIESKGIFVSILMAVLLLYLIY
FT                   FIATVIHIVIIKFIRKKSFKYLVLYPFTYDGSWRFQPINLLYFPEMVRDVIPINLVQEY
FT                   CQGQPYGLLKKMLKRIRLSREIALLLATIIVYFFTHRILPLSVFTFMFSYILLFVQSYL
FT                   GSNTAWIGNRRLIIDDEFEKILLSKSYIKEISSARYSEYLTCEYKNLTPIILLAIFENL
FT                   LDSYLLQNQSEVDLDIFYKVLPLLYKEKYTMGFNYFVSLNYLLYKVGFLGIIYDNEALR
FT                   DLSKQYLNKNISELQDGSFEGGIQDAVASKQIVVINEFIACLNSRCMPSQYDRFFYKDR
FT                   PYIFSRKSPIKG"
FT   gene            155321..156298
FT                   /locus_tag="SPAP_0165"
FT   CDS_pept        155321..156298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0165"
FT                   /product="hypothetical protein"
FT                   /note="Operon 70 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83759"
FT                   /protein_id="ADM83759.1"
FT                   /translation="MKNKRYFFDTILMILLLISTIFCVSPVFIKLDILGTPSHAILTFV
FT                   LAIPLFYILSQCLHTLLLLVSSIFCKLRPIYFYFIFVIIIGARKYYRILFHQLMGFSPG
FT                   IAVFYKESQTTKNLFKFYYFLYFTTLISYYFFFTFVYDKPLLLPLIPFSIIIALVQKLY
FT                   RIENQQLFLLKSKVLTILESKRDCEFNLQDYHEIWKLQSKSELPCVALSYISLIKPYLS
FT                   ESVREQIDLLEVKRFKKINHPISLYGMLDVIKLNLYLRHYNEKNKYESMLNKILEVRPD
FT                   FVLIEQNIDDSLNSSQPLSLSLAISEIQLLLEVYMGIKHVSIRR"
FT   gene            156675..157049
FT                   /locus_tag="SPAP_0166"
FT   CDS_pept        156675..157049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0166"
FT                   /product="hypothetical protein"
FT                   /note="Operon 71 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83760"
FT                   /protein_id="ADM83760.1"
FT                   /translation="MELVLPNNYVVLEQEEMMYLDGGFSIPRWPVATAINIAFNGVLGG
FT                   GAISLVRNYIRNYGLRRVTSAIAGAAARYVGVRVANRVAGFALSAINGFAAWMSIGDAI
FT                   TTIWANNDVNRRDPNLNALW"
FT   gene            157287..158159
FT                   /locus_tag="SPAP_0167"
FT   CDS_pept        157287..158159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0167"
FT                   /product="hypothetical protein"
FT                   /note="Operon 72 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83761"
FT                   /protein_id="ADM83761.1"
FT                   /translation="MLPLFVLWLELHLLVSNLQLNLEIPLDFVISMSLAFCSLILSKIV
FT                   LDILYALKDLYKKEALITIFPFIFIRRKKVNVRFSPYFSFHRKSLSPDDLRSRIIWSFI
FT                   LEIAIILVFILKIPFAIIMLTTIFFWTIMDINHLVFNKTEFLFNQNKWEKEDSFESDLT
FT                   NTLKDKIQKSDLSYSDLMSLQLYDAMNQSTFLTDSELFEDILSKIEDSHNTLLCTGLVE
FT                   LLLYEISISNNNNWQEKVDKIRIQLIRINQLDFFYYTSWLRQNFDFCMNREYHKMKSRK
FT                   LLLSNKKIV"
FT   gene            158215..158454
FT                   /locus_tag="SPAP_0168"
FT   CDS_pept        158215..158454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0168"
FT                   /product="hypothetical protein"
FT                   /note="Operon 72 Gene 2 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83762"
FT                   /protein_id="ADM83762.1"
FT                   /translation="MDLVLPNNYVVIDEEEMMYLDGGAYLSKRACQGICAAAGVLATAA
FT                   GKIAYCIGYGALNRGCDINGNPYPWDGFISATVR"
FT   gene            158655..159179
FT                   /locus_tag="SPAP_0169"
FT   CDS_pept        158655..159179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0169"
FT                   /product="hypothetical protein"
FT                   /note="Operon 73 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83763"
FT                   /protein_id="ADM83763.1"
FT                   /translation="MSFPILINKFFPESFLTYTVLISVFILELAIFHLIGEDFATKLTN
FT                   EYKKISQFRSKVSQSPWIKYLEISSFILTIFPSILYGTVDNRVLALIFLIKICVDTTIK
FT                   FLFIRLFDTSTLMKRRIFFLFALDVIAYLFLGYLLVIQKAGYLFSVLLLFSNFSVPFIK
FT                   AKEYELFKNSK"
FT   gene            159658..159855
FT                   /locus_tag="SPAP_0170"
FT   CDS_pept        159658..159855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0170"
FT                   /product="hypothetical protein"
FT                   /note="Operon 74 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83764"
FT                   /protein_id="ADM83764.1"
FT                   /translation="MKHFFAGIGEIKLVGYLLYICVGLAPLFHIYVIGSELSFVKIVLS
FT                   ILGVIFVSMLTIARIYRTFL"
FT   gene            160312..160551
FT                   /locus_tag="SPAP_0171"
FT   CDS_pept        160312..160551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0171"
FT                   /product="hypothetical protein"
FT                   /note="Operon 75 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83765"
FT                   /protein_id="ADM83765.1"
FT                   /translation="MKLLDCILDYQERFNGKTCQVSTNYKYLEIFKVNFCLTDLHHLFD
FT                   LYKITRDYASQTKPAIQAGVFILEDFRNILCTMM"
FT   gene            160536..160814
FT                   /locus_tag="SPAP_0172"
FT   CDS_pept        160536..160814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0172"
FT                   /product="hypothetical protein"
FT                   /note="Operon 75 Gene 2 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83766"
FT                   /protein_id="ADM83766.1"
FT                   /translation="MYNDVIERISLYEFIGDIFYSKIISCCIVARDLSKNTMKLDVIFF
FT                   EDKNKRSAVLGLRRDKSGVFKSVTLHFTSAKKYAKVRKTDVKEMKWL"
FT   gene            161100..163379
FT                   /locus_tag="SPAP_0173"
FT   CDS_pept        161100..163379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0173"
FT                   /product="surface protein pspA precursor"
FT                   /note="Operon 76 Gene 1 COG5263 FOG: surface protein pspA
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83767"
FT                   /protein_id="ADM83767.1"
FT                   /translation="MNKKKMILTSLASVAILGAGFVTSQPTFVRAEEAPQVVEKSSLEK
FT                   KYEEAKAKADTAKKDYETAKKKAEDAQKKYDEDQKKTEDKAKAVKKVDEELQKANLELQ
FT                   KAHVKYQKAQRELSESPDRRKSAARKKLADALSYIGEVELKQKEAEANFNTEQAKVIPK
FT                   ETELAVTKQKAEEAKKEAEVAKKKFDKAAQEVEVAKKEVEAKELEIEKLQDEISTLEQE
FT                   VATAQHQVDNLKKLLAGVDPDDTEAIEAKLKKGEAELNAKQAELAKKQTELEKLLDSLD
FT                   PEGKTQDELDKEAAEAELNKKVESLQNKVADLEKEISNLEILLGGADSEDDTAALQNKL
FT                   AAKQAELAKKQTELEKLLDNLDPEGKTQDELDKEAAEAELDKKADELQNKVADLEKEIS
FT                   NLEILLGGADPEDDTAALQNKLATKKAEFEKTQKELDAALNELGPDGDEEETPAPAPAP
FT                   KPEQPAPAPAPKPEQPAPAPAPKPEQPAPAPAPKPEQPTPAPKTGWKQENGMWYFYNTD
FT                   GSMATGWLQNNGSWYYLNSNGAMATGWLQYNGSWYYLNANGAMATGWAKVNGSWYYLNA
FT                   NGAMATGWLQYNDSWYYLNANGAMATGWAKVNGSWYYLNANGAMATGWLQYNGSWYYLN
FT                   ASGAMATGWLQYNGSWYYLNASGAMATGWAKVNGSWYYLNANGAMATGWAKVNGSWYYL
FT                   NANGSMATGWVKDGDTWYYLEASGAMKASQWFKVSDKWYYVNGLGALAVNTTVDGYTVN
FT                   ENGEWV"
FT   gene            163780..164901
FT                   /locus_tag="SPAP_0174"
FT   CDS_pept        163780..164901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0174"
FT                   /product="Predicted
FT                   tRNA(5-methylaminomethyl-2-thiouridylate)
FT                   methyltransferase, contains the PP-loop ATPase domain"
FT                   /note="Operon 77 Gene 1 COG0482 Predicted
FT                   tRNA(5-methylaminomethyl-2-thiouridylate)
FT                   methyltransferase, contains the PP-loop ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83768"
FT                   /protein_id="ADM83768.1"
FT                   /translation="MSDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDDTD
FT                   ENGVCTATEDYKDVVAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCN
FT                   KEIKFKAFLDYAMTLGADYVATGHYARVARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQ
FT                   LQKTMFPLGHLEKPEVRRLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLPAQPGRM
FT                   MTVDGRDMGEHAGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKALSKNILYVGQGFYHD
FT                   SLMSTSLEASQVHFTRDMPEEFTLECTAKFRYRQPDSKVTVHVKGEKAEVIFAEPQRAI
FT                   TPGQAVVFYDGEECLGGGLIDNAYRDGQVCQYI"
FT   gene            165042..165497
FT                   /locus_tag="SPAP_0175"
FT   CDS_pept        165042..165497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0175"
FT                   /product="NTP pyrophosphohydrolase including oxidative
FT                   damage repair enzymes"
FT                   /note="Operon 78 Gene 1 COG0494 NTP pyrophosphohydrolases
FT                   including oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83769"
FT                   /protein_id="ADM83769.1"
FT                   /translation="MTQQDFRTKVDNTVFGVRATALIVQNHKLLVTKDKGKYYTIGGAI
FT                   QVNESTEDAVVREVREELGVKAQAGQLAFVVENRFEQDGVSYHNIEFHYLVDLLEDAPL
FT                   TMQEDEKRQPCEWIDLDKLEDIQLVPAFLKTALPDWEGQLRHIHLEE"
FT   gene            165507..167420
FT                   /locus_tag="SPAP_0176"
FT   CDS_pept        165507..167420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0176"
FT                   /product="NAD/FAD-utilizing enzyme apparently involved in
FT                   cell division"
FT                   /note="Operon 78 Gene 2 COG0445 NAD/FAD-utilizing enzyme
FT                   apparently involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83770"
FT                   /protein_id="ADM83770.1"
FT                   /translation="MTYHFTEEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLA
FT                   FMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKE
FT                   LYSKEMRKTVENQENLTLRQTMIDEILVEDGKVVGVRTATHQEYAAKAVIVTTGTALRG
FT                   EIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPG
FT                   DEVPNHFSYTSRDEDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCP
FT                   SIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMM
FT                   RTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQ
FT                   GKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREI
FT                   GLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMGFKPLTDAVTAKEFLR
FT                   RPEVSYQDVVAFIGPAAEDLDDKIIELIETEIKYEGYISKAMDQVAKMKRMEEKRIPAN
FT                   IDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNRSISKTLQK
FT                   SK"
FT   gene            complement(167615..169294)
FT                   /locus_tag="SPAP_0177"
FT   CDS_pept        complement(167615..169294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0177"
FT                   /product="Predicted hydrolase of the metallo-beta-lactamase
FT                   superfamily"
FT                   /note="Operon 79 Gene 1 COG0595 Predicted hydrolase of the
FT                   metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83771"
FT                   /protein_id="ADM83771.1"
FT                   /translation="MAYTLKPEEVGVFAIGGLGEIGKNTYGIEYQDEIIIVDAGIKFPE
FT                   DDLLGIDYVIPDYSYIVDNIDRVKAVLITHGHEDHIGGIPFLLKQANVPIYAGPLALAL
FT                   IRGKLEEHGLLRNAKLYEINHNTELTFKNLKATFFRTTHSIPEPLGIVIHTPQGKIVCT
FT                   GDFKFDFTPVGEPADLHRMAALGEEGVLCLLSDSTNAEVPTFTNSEKVVGQSIMKIIQG
FT                   IEGRIIFASFASNIFRLQQATEAAVKTGRKIAVFGRSMEKAIVNGIDLGYIKAPKGTFI
FT                   EPNEIKDYPAGEVLILCTGSQGEPMAALSRIANGTHRQVQLQPGDTVIFSSSPIPGNTT
FT                   SVNKLINIISEAGVEVIHGKVNNIHTSGHGGQQEQKLMLCLIKPKYFMPVHGEYRMQKV
FT                   HAGLAVDTGVEKDNIFIMSNGDVLALTADSARIAGHFNAQDIYVDGNRIGEIGAAVLKD
FT                   RRDLSEDGVVLAVATVDFKSQMILSGPDILSRGFVYMRESGDLIRQSQRILFNAIRIAL
FT                   KNKDASVQSVNGAIVNAIRPFLYENTEREPIIIPMILTPDEE"
FT   gene            complement(169296..169529)
FT                   /locus_tag="SPAP_0178"
FT   CDS_pept        complement(169296..169529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0178"
FT                   /product="Uncharacterized conserved small protein"
FT                   /note="Operon 79 Gene 2 COG5503 Uncharacterized conserved
FT                   small protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83772"
FT                   /protein_id="ADM83772.1"
FT                   /translation="MIYKVFYQETKERSPRRETTRALYLDIDASSELEGRITARQLVEE
FT                   NRPEYNIEYIELLSDKLLDYEKETGAFEITEF"
FT   gene            169809..170132
FT                   /locus_tag="SPAP_0179"
FT   CDS_pept        169809..170132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0179"
FT                   /product="hypothetical protein"
FT                   /note="Operon 80 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83773"
FT                   /protein_id="ADM83773.1"
FT                   /translation="MYNLFAFAIGVRLLAFIVFVLRLWRKSSICQTGTMTNQVLEENYL
FT                   CDSLLAFSPPRDLCRLVCILLWIKCLDALLMLGFFVWGCRDSRFTTRKFHPIYQDEVVF
FT                   AFF"
FT   gene            complement(170154..170351)
FT                   /locus_tag="SPAP_0180"
FT   CDS_pept        complement(170154..170351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0180"
FT                   /product="hypothetical protein"
FT                   /note="Operon 81 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83774"
FT                   /protein_id="ADM83774.1"
FT                   /translation="MLDKKHIFRRINFIVFISYSLLSILNDLNITTIPLPFDLSVCIVL
FT                   FLCFNSIFDQNNDSHKNNKL"
FT   gene            complement(170345..170497)
FT                   /locus_tag="SPAP_0181"
FT   CDS_pept        complement(170345..170497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0181"
FT                   /product="hypothetical protein"
FT                   /note="Operon 81 Gene 2 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83775"
FT                   /protein_id="ADM83775.1"
FT                   /translation="MMKDLNNYREISNKELQEIKGGFGVGVGIALFMAGYTIGKDLRKK
FT                   FGKSC"
FT   gene            complement(170499..170684)
FT                   /locus_tag="SPAP_0182"
FT   CDS_pept        complement(170499..170684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0182"
FT                   /product="hypothetical protein"
FT                   /note="Operon 81 Gene 3 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83776"
FT                   /protein_id="ADM83776.1"
FT                   /translation="MTNFDILDNQFLSLSENELSDIDGGLAPLVIFGVAVSWKAIAGGT
FT                   ALIGSGLAAGYFLGGD"
FT   gene            170862..171545
FT                   /locus_tag="SPAP_0183"
FT   CDS_pept        170862..171545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0183"
FT                   /product="inactive metal-dependent protease-like protein"
FT                   /note="Operon 82 Gene 1 COG1214 Inactive homolog of
FT                   metal-dependent proteases, putative molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83777"
FT                   /protein_id="ADM83777.1"
FT                   /translation="MKVLAFDTSSKALSLAILEDKQVLAETTINIKKNHSITLMPAIDF
FT                   LMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAYTLNIELVGMSSLLALVPHQQ
FT                   EGLFVPLMDARRNNVYAGFYENAKPVMAEAHLSFEEVLEKVKGTSQVTFVGEVGPFVEQ
FT                   IQKHLPRTDYKETLPNAANLALLAWDKEADSLHDFVPNYLKRVEAEENWLKNHTESGES
FT                   YIKRL"
FT   gene            171542..171979
FT                   /locus_tag="SPAP_0184"
FT   CDS_pept        171542..171979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0184"
FT                   /product="hypothetical protein"
FT                   /note="Operon 82 Gene 2 protein supported
FT                   gi|15902174|ref|NP_357724.1| ribosomal protein alanine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83778"
FT                   /protein_id="ADM83778.1"
FT                   /translation="MIEIKRIQQQPDLAQAIYAVMAAVYLVSPWTLEQIQADLSQDQTW
FT                   YALAYDGAEVIGFLAVQENLFEVEVLQIAVKGAYQGQGIASALFAQLPTDKEIFLEVRQ
FT                   SNQRAQAFYKKEKMAVIAERKAYYHDPVEDAIIMKREIDEG"
FT   gene            171969..172979
FT                   /locus_tag="SPAP_0185"
FT   CDS_pept        171969..172979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0185"
FT                   /product="hypothetical protein"
FT                   /note="Operon 82 Gene 3 protein supported
FT                   gi|229232313|ref|ZP_04356740.1| (SSU ribosomal protein
FT                   S18P)-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83779"
FT                   /protein_id="ADM83779.1"
FT                   /translation="MKDRYILAFETSCDETSVAVLKNDDELLSNVIASQIESHKRFGGV
FT                   VPEVASRHHVEVITACIEEALAEAGITEEDVTAVAVTYGPGLVGALLVGLSAAKAFAWA
FT                   HGLPLIPVNHMAGHLMAAQSVEPLEFPLLALLVSGGHTELVYVSEAGDYKIVGETRDDA
FT                   VGEAYDKVGRVMGLTYPAGREIDELAHQGQDIYDFPRAMIKEDNLEFSFSGLKSAFINL
FT                   YHNAEQKGESLSTEDLCASFQAAVMDILMAKTKKALEKYPVKTLVVAGGVAANKGLRER
FT                   LAAEITDVKVIIPPLRLCGDNAGMIAYASVSEWNKENFAGWNLNAKPSLAFDTME"
FT   gene            complement(173019..173405)
FT                   /locus_tag="SPAP_0186"
FT   CDS_pept        complement(173019..173405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0186"
FT                   /product="Transposase-like protein, IS1167"
FT                   /note="Operon 83 Gene 1 COG3464 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83780"
FT                   /protein_id="ADM83780.1"
FT                   /translation="MHLTHREVRDKLLSYSEGLQVHYELYQLLLFHFQEKNADHFFGLI
FT                   EQELPTVHPLFQTIFWTFLRDRDKIINALKLPYSNAKLEATNNLIKVIKCKAFGFRNFN
FT                   NFKKRILMTLNIKKESTNFVLSRL"
FT   gene            complement(173396..174013)
FT                   /locus_tag="SPAP_0187"
FT   CDS_pept        complement(173396..174013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0187"
FT                   /product="Transposase-like protein, IS1167"
FT                   /note="Operon 83 Gene 2 COG3464 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83781"
FT                   /protein_id="ADM83781.1"
FT                   /translation="MVRQKIAQLLLEKQSMTEIAHRLAVSTSTVIRKLREFKFETDWTK
FT                   LPKVMSWDEYSFKKSKMSFIAQDFESKSILAILDGRTHAVIRNHFQRYQREVRELVEVI
FT                   TMDMYSPYYRLAKQLFPKAKIVLDRFHIVQHLSRAMNRVRIQIMNQFDRKSLEYRALKR
FT                   FWNPRFFVSRLGLNQSTGLIYYTRIASSSVRNDSISPRFECT"
FT   gene            complement(175031..175234)
FT                   /locus_tag="SPAP_0188"
FT   CDS_pept        complement(175031..175234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0188"
FT                   /product="hypothetical protein"
FT                   /note="Operon 84 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83782"
FT                   /protein_id="ADM83782.1"
FT                   /translation="MGYSLKKSCTYCEQDPEKVNRFLKELNHLSYLTPIYIYETGVKTY
FT                   FYLEYDRALSRQLVSLEEDIII"
FT   gene            175756..176331
FT                   /locus_tag="SPAP_0190"
FT   CDS_pept        175756..176331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0190"
FT                   /product="hypothetical protein"
FT                   /note="Operon 85 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83783"
FT                   /protein_id="ADM83783.1"
FT                   /translation="MSLYPILIIVSRDSKVIDDYKNLDIAYVDCTQCSNNFETALHVKN
FT                   ILKLLKIQLIHCHGYSTNYFLYMLKKLDKNGFGKVKTVITCHGWVEYNLKKKFLTYFDF
FT                   WTYSMGDAFICVSETMKKRLESIIKNKKIVAINNGINVSNSDLDVVGVQDFKKEFCIPN
FT                   NKKSFVMLEGWIQKKGRIDSLNLQKNYF"
FT   gene            176514..176798
FT                   /locus_tag="SPAP_0191"
FT   CDS_pept        176514..176798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0191"
FT                   /product="Glycosyltransferase"
FT                   /note="Operon 86 Gene 1 COG0438 Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83784"
FT                   /protein_id="ADM83784.1"
FT                   /translation="MCVLESMSQGTPVLASNVGGLSEIIEHRVDGFLFEKEDVEGVCAC
FT                   ANFLLNDSEYLKYIGENSKSKIRKHFSVQKMFVETMKVYDELLEKSSHG"
FT   gene            176791..177744
FT                   /locus_tag="SPAP_0192"
FT   CDS_pept        176791..177744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0192"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /note="Operon 86 Gene 2 COG0463 Glycosyltransferases
FT                   involved in cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83785"
FT                   /protein_id="ADM83785.1"
FT                   /translation="MDRNIDQELVSIIIPTHNRYESLIRAVKSCLHQSYKNIEVIIIDD
FT                   NYSNVNLRNKIIHQFGYTNHRIKLILSNEDLGATNARNIGIKNSRGKYISFLDDDDEYM
FT                   PDRILKLMACVKKSRMKNLALVYSYGIIIYPNGTREEEKTDFVGNPLFVQMVHNIAGTS
FT                   FWLCKKEVLELINGFEKIDSHQDGVVLLKLLAQGYQIDIVREFLVNYYAHSKENGITGV
FT                   TQKTINADEEYYNYCRKYFNLLSFNERILVTKKYYSLNIKRLLLIGDKCKALKVIKKAR
FT                   EEKIFNEFLFLKYMLLYHFGFFYCIYDNYVQLKFRK"
FT   gene            177754..179370
FT                   /locus_tag="SPAP_0193"
FT   CDS_pept        177754..179370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0193"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /note="Operon 86 Gene 3 COG1132 ABC-type multidrug
FT                   transport system, ATPase and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83786"
FT                   /protein_id="ADM83786.1"
FT                   /translation="MYTIIKSNIKKFSLLTIFIVAGQLLLIYAATINALVLNELIAMNL
FT                   ERFLKLSIYQMIVWCGIIFLDWVVKNYQVEVIQEFNLEIRNRVATDISNSTYQEFHSKS
FT                   SGTYLSWLNNDVQTLNDQAFKQLFLVIKGISGTIFAVVTLNHYHWSLTVATLFSLMIML
FT                   LVPKIFASKMREVSLNLTNQNEAFLKSSETILNGFDVLASLNLLYVLPKKIKEAGILLK
FT                   MVIQRKTTVETLAGAISFFLNIFFQISLVFLTGYLAIKGIVKIGTIEAIGALTGVIFTA
FT                   LGELGGQLSSIIGTKPIFLKLYSINPIESNKMNDIEPNEVNRDFPLYEAKNICYKYGDK
FT                   EILKNLNFCFQRNEKYLILGESGSGKSTLLKLLNGFLRDYSGELRFCGDDIKKTSYLNM
FT                   VSNVLYVDQKAYLFEGTIRDNILLEENYTDEEILQSLEQVGLSVKDFPNNILDYYVGDD
FT                   GRLLSGGQKQKITLARGLIRNKKIVLIDEGTSAIDRRTSLAIERKILDREDLTVIIVTH
FT                   APHPELKQYFTKIYQFPKDFI"
FT   gene            179390..179977
FT                   /locus_tag="SPAP_0194"
FT   CDS_pept        179390..179977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0194"
FT                   /product="hypothetical protein"
FT                   /note="Operon 86 Gene 4 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83787"
FT                   /protein_id="ADM83787.1"
FT                   /translation="MRFYCETYEVITEEKKVSFFYVDEKPLRYLLFDYIFLLVLAKKNI
FT                   PILDGVSNKQVAPTLLHHFSLEIEKNFIDFCYKNMDLILKTQSISLCHREELIIVDVSD
FT                   DSKFGVFYKRFRTLVDKNNGKYVCVYNFSRVSDILQNWKNYCNRKFSVTFTESQFELFK
FT                   LLYNQKNFKTISLLFGKKLLLEELSIIAILLI"
FT   gene            180007..180144
FT                   /locus_tag="SPAP_0195"
FT   CDS_pept        180007..180144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0195"
FT                   /product="hypothetical protein"
FT                   /note="Operon 86 Gene 5 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83788"
FT                   /protein_id="ADM83788.1"
FT                   /translation="MFGKDSIGKYVYVEEISRCHFLDRNYSFCYGLQDYKSKLIKYFLE
FT                   "
FT   gene            180173..180499
FT                   /locus_tag="SPAP_0196"
FT   CDS_pept        180173..180499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0196"
FT                   /product="hypothetical protein"
FT                   /note="Operon 86 Gene 6 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83789"
FT                   /protein_id="ADM83789.1"
FT                   /translation="MENTLLNITGSFDMETRNLISYSLTDIFETDKIRIELLGEIYYKN
FT                   IKLELHEFAGLYKIYGISLIKNITGMFLIIIFDTNTKELKIFQDITTSYFNLYYTVYGG
FT                   VFYI"
FT   gene            180519..180635
FT                   /locus_tag="SPAP_0197"
FT   CDS_pept        180519..180635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0197"
FT                   /product="hypothetical protein"
FT                   /note="Operon 86 Gene 7 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83790"
FT                   /protein_id="ADM83790.1"
FT                   /translation="MKLSHVPVILNNKKIQEFMRNGFILDSNTLVTEINKLE"
FT   gene            180738..180965
FT                   /locus_tag="SPAP_0198"
FT   CDS_pept        180738..180965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0198"
FT                   /product="hypothetical protein"
FT                   /note="Operon 87 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83791"
FT                   /protein_id="ADM83791.1"
FT                   /translation="MLRESILRVYSEAGEANITLSSGFDSNYILYTLANYTNSSINAFC
FT                   IGGEKGINEIPEVTKIAKFYGINLLDLFGI"
FT   gene            complement(180962..181339)
FT                   /locus_tag="SPAP_0199"
FT   CDS_pept        complement(180962..181339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0199"
FT                   /product="Transposase-like protein, IS1515"
FT                   /note="Operon 88 Gene 1 COG3293 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83792"
FT                   /protein_id="ADM83792.1"
FT                   /translation="MLDLTTHKVCQMAFSDGHTHDFTLFKESIGQSLPETTLAFVDLGY
FT                   LGILKFHENTFIPAKNSKNRRLSEDDKQLNKEMSAIRIEIEHFNAKFKTFQIMSVPYRN
FT                   RRKRFELRAELICAIINYEVN"
FT   gene            complement(181351..181776)
FT                   /locus_tag="SPAP_0200"
FT   CDS_pept        complement(181351..181776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0200"
FT                   /product="Transposase-like protein, IS1515"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83793"
FT                   /protein_id="ADM83793.1"
FT                   /translation="METVYDKAQKLNSKNFKLLIGVKKETFQLMLEHLNSAYQIQHRKG
FT                   GRPRSLPMEDQLIMTLRYLRYYPTQRLLAFDFGVGVATVNAIITWVEDTLRASGSFDLD
FT                   HLEAPSAAVAIDVTESPIQRPKKTKAKIILVKRNDTP"
FT   gene            182157..182585
FT                   /locus_tag="SPAP_0201"
FT   CDS_pept        182157..182585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0201"
FT                   /product="hypothetical protein"
FT                   /note="Operon 89 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83794"
FT                   /protein_id="ADM83794.1"
FT                   /translation="MSEIVEMSKKISNLNDKKEFHKKNCELRFQDSVLDNINSVPGTTH
FT                   LFSCLNIQTLVKIILYIFRYNSCMKIFNFRDKELIFFNKIVNGLIQNIEENLEDDIERI
FT                   LKYLYICLFNEIFIIKNKVNFFDDVEFNQTLSEFLDKL"
FT   gene            182597..183346
FT                   /locus_tag="SPAP_0202"
FT   CDS_pept        182597..183346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0202"
FT                   /product="hypothetical protein"
FT                   /note="Operon 89 Gene 2 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83795"
FT                   /protein_id="ADM83795.1"
FT                   /translation="MSNNTKYIFLSPHLDDAIFSCGDYISKLTSEGEIVLVITIFSGYP
FT                   LSQQLQPSAKQFHKLCNLGKYPIEERKKEDRLACERLQCDFRHLSYYEYLYRKDRNGNF
FT                   LYRHIYSELKNEDTLKNDIIKELLMHLDDKCVVYCPLSLGDHVDHVFVNSIGRALEFMR
FT                   YKVIYYEDFPCVSDSSMVSYMGKTKELKIYQEELDEKHYIDRISLILCYKSQILIIWKS
FT                   VEKLLNNIKELYLRNGAAYSIRFWIKK"
FT   gene            183359..183496
FT                   /locus_tag="SPAP_0203"
FT   CDS_pept        183359..183496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0203"
FT                   /product="hypothetical protein"
FT                   /note="Operon 89 Gene 3 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83796"
FT                   /protein_id="ADM83796.1"
FT                   /translation="MNIAVIGLGHVGLAYALLFASKYKVVAYDIDSVKINNLKKGHSSI
FT                   "
FT   gene            183510..184532
FT                   /locus_tag="SPAP_0204"
FT   CDS_pept        183510..184532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0204"
FT                   /product="Predicted UDP-glucose 6-dehydrogenase"
FT                   /note="Operon 89 Gene 4 COG1004 Predicted UDP-glucose
FT                   6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83797"
FT                   /protein_id="ADM83797.1"
FT                   /translation="MKFFCENNLNITFFDTFSEIKNNIDYYIIALPTDYDEKIGSFNTY
FT                   EIEQTVSKILRVKPNGKIILKSTVPFGFSNKLKRLFDTKNIIFVPEFLREGCSIYDNLY
FT                   PSRIVVGDETVEGRKIAELFLSISTHSTANIKNVMLVSPTEAEAIKLFSNTFLALRVAF
FT                   FNELDSFAERRSLNAEVVIKGVCLDPRIGNFYNNPSFGFGGYCLPKDTKQLKKEFIEIN
FT                   APVIEAIDISNTNRKQFIVKQILERKPKIVGIYKLGMKYNSDNYKESAILSIINELLIV
FT                   GIKILVYEPNLNVSIDNVIFEKNFELFTKQSDLIVANRWDRGLEAYKDKVYTRGIWIRD
FT                   "
FT   gene            184927..185790
FT                   /locus_tag="SPAP_0205"
FT   CDS_pept        184927..185790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0205"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="Operon 90 Gene 1 COG1396 Predicted transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83798"
FT                   /protein_id="ADM83798.1"
FT                   /translation="MIEKMELGEFYKELRLARKLKQSDVTCAGLTTSQLSKFELGQSML
FT                   SADKLILAIQGINMNFDEFGHKLNNYQESPHMRFGRKVVDRFAHQDIAGLEQLLEEVEQ
FT                   EQMAETYRRLNAIVIKDAIHSLDKSYPLAEEDSEFLTTYLYAIESWTWFELYLFCNTMP
FT                   FLSNQDLIFLSTSLLEKSKEFKELVHNRLYMKQGLLNIISELMERKLFSYIPIFEAELE
FT                   SMLRPYDVFEKLLWQFLKKMSIFLQTKGSNQKEIEHFIQSLQVLENPQLIALFELRLQQ
FT                   YKKLID"
FT   gene            186076..186309
FT                   /locus_tag="SPAP_0206"
FT   CDS_pept        186076..186309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0206"
FT                   /product="hypothetical protein"
FT                   /note="Operon 91 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83799"
FT                   /protein_id="ADM83799.1"
FT                   /translation="MLNLQFAETMELTEAELQDVRGGNLVNSMGGGGRSGISGWGVPGI
FT                   YPGWGNQGMSPNRGAFDWTIDLADGLFGRRRR"
FT   gene            186331..187008
FT                   /locus_tag="SPAP_0207"
FT   CDS_pept        186331..187008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0207"
FT                   /product="Predicted metal-dependent membrane protease"
FT                   /note="Operon 91 Gene 2 COG1266 Predicted metal-dependent
FT                   membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83800"
FT                   /protein_id="ADM83800.1"
FT                   /translation="MKKMKEVKFHLATGLLILTYYLIFNVTSDLDFMVALSDNMYYVFQ
FT                   VLLVLILGTIATIAFVKSEHWKECGRFQFRWFYLGVFLLSFFLLFVWANLTTYIFPRTQ
FT                   NGSTVVEVATNLTGISYFVTRILYTSIIAPVSEEVVCRGLLMTSLSKVKRYYLDVLVSA
FT                   AIFGAMHVLQYGWITTDFIKYFGMGLIFCMMFRYTRSIYWAIALHASWNSFLLIVTLLV
FT                   FGY"
FT   gene            187020..187685
FT                   /locus_tag="SPAP_0208"
FT   CDS_pept        187020..187685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0208"
FT                   /product="Predicted metal-dependent membrane protease"
FT                   /note="Operon 91 Gene 3 COG1266 Predicted metal-dependent
FT                   membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83801"
FT                   /protein_id="ADM83801.1"
FT                   /translation="MKKIISHRYFIIVFLLVIADQKFSVLVLRSDLVTGLSDFAYYLSD
FT                   MMLNFLVVLFALIAMIWSGKWQKINSRKFKGSYLFYSFLALLAFVVWNFVTFFLFPPTR
FT                   NEISYQHAAPTFTGATAFLMYFFYPVIAGPIFEEIIHRGLVMTVLEKGKKWGLDVLGSA
FT                   VLFGVSHISNHGWVLTDFVFYMGGGLIFAVLFRMTKSIYWPIGLHIVYNGIGQLLMLL"
FT   gene            187757..188983
FT                   /locus_tag="SPAP_0209"
FT   CDS_pept        187757..188983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0209"
FT                   /product="Permeases of the major facilitator superfamily"
FT                   /note="Operon 91 Gene 4 COG0477 Permeases of the major
FT                   facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83802"
FT                   /protein_id="ADM83802.1"
FT                   /translation="MKVFLQNRDFRQLTINQWISTLGDTIFYLAFLNYVADASFAPLAI
FT                   LLITISETLPQILQIFLGVLADFQHHRVLKYTVISFAKFLLYSIVSLSLSGQSFSLLLV
FT                   AFICLLNLLSDTLSYFSGAMLTPIFIRIIGQDHLAEAIGFKQSTVSLVKTISNILGGVL
FT                   LGILSIQFISLLNALTFLIAFLGILFIKTDLLKVEKTISYQEGLSVKSFCQHLLQSSKL
FT                   IWNMNKVLLVLFIISTSQAVINVTVPISTLFLRNQPFLNLQTGQSLALLSTFELSALIV
FT                   GSLVSGYLQHTISIKTALYASLVIQLLLLVGFATVRFDWILIFSTLDAFFAGVLSPRLQ
FT                   ELVFKQIPEESMGAVQSSIGAITVVLPSLFTIALVTIATSFGTLAVSFVLLLFLLVAFV
FT                   MLLNIRESI"
FT   gene            complement(189218..189412)
FT                   /locus_tag="SPAP_0210"
FT   CDS_pept        complement(189218..189412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0210"
FT                   /product="hypothetical protein"
FT                   /note="Operon 92 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83803"
FT                   /protein_id="ADM83803.1"
FT                   /translation="MKIKEQTRKLASGCSKHCFEVVDRTDEVSSKHCFEVVDRTDEVSN
FT                   HTYGKVKLTWFEESFEEYK"
FT   gene            189483..190139
FT                   /locus_tag="SPAP_0211"
FT   CDS_pept        189483..190139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0211"
FT                   /product="Predicted branched-chain amino acid permease
FT                   (azaleucine resistance)"
FT                   /note="Operon 93 Gene 1 COG1296 Predicted branched-chain
FT                   amino acid permease (azaleucine resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83804"
FT                   /protein_id="ADM83804.1"
FT                   /translation="MPTALGYVSIGLACGTIGAPYVTPVEMGLMSLFVYAGSAQFAMLA
FT                   LIVVQAPVAAIAMTVFLINLRLFLLSLHASTYFRHTSLWYNIGMSSILTDETYGVLMGE
FT                   LAHTDKVNPMWMHGNNLNSYVAWFVGTVVGTALGGLLPNPEIFGLDFALVGMFIGIFAS
FT                   QFQIMQRRIPVRNLLIILAVVAVSFFLLLTVVSQSLAVLFATLLGCSMGVVLDGQ"
FT   gene            190129..190452
FT                   /locus_tag="SPAP_0212"
FT   CDS_pept        190129..190452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0212"
FT                   /product="Predicted membrane protein"
FT                   /note="Operon 93 Gene 2 COG4392 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83805"
FT                   /protein_id="ADM83805.1"
FT                   /translation="MVSKYLLLAVIFSGLVTWILRMIPFILVKYKGLPAIVERFLKFLP
FT                   VSIIFALILSSVVTGKVGSLPQIKWLDFLAVFPTAWVAFRYRNLVGTVLFGVVLIAILR
FT                   LVF"
FT   gene            190555..191385
FT                   /locus_tag="SPAP_0213"
FT   CDS_pept        190555..191385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0213"
FT                   /product="ABC-type amino acid transport/signal transduction
FT                   systems, periplasmic component/domain protein"
FT                   /note="Operon 94 Gene 1 COG0834 ABC-type amino acid
FT                   transport/signal transduction systems, periplasmic
FT                   component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83806"
FT                   /protein_id="ADM83806.1"
FT                   /translation="MKKIVKYSSLAALGLVAAGVLAACSGGAKKEGEAASKKEIIVATN
FT                   GSPRPFIYEENGELTGYEIEVVRAIFKDSDKYDVKFEKTEWSGVFAGLDADRYNMAVNN
FT                   LSYTKERAEKYLYAAPIAQNPNVLVVKKDDSSIKSLDDIGGKSTEVVQATTSAKQLEAY
FT                   NAEHTDNPTILNYTKADFQQIMVRLSDGQFDYKIFDKIGVETVIKNQGLDNLKVIELPS
FT                   DQQPYVYPLLAQGQDELKSFVDKRIKELYKDGTLEKLSKQFFGDTYLPAEADIK"
FT   gene            191539..192393
FT                   /locus_tag="SPAP_0214"
FT   CDS_pept        191539..192393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0214"
FT                   /product="ABC-type metal ion transport system, periplasmic
FT                   component/surface antigen"
FT                   /note="Operon 95 Gene 1 COG1464 ABC-type metal ion
FT                   transport system, periplasmic component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83807"
FT                   /protein_id="ADM83807.1"
FT                   /translation="MKIKKWLGLVALATVAGLALAACGNSEKKADNATTIKIATVNRSG
FT                   SEEKRWDKIQELVKKDGITLEFTEFTDYSQPNKATADGEVDLNAFQHYNFLNNWNKENG
FT                   KDLVAIADTYISPIRLYSGLNGSANKYTKVEDIPANGEIAVPNDATNESRALYLLQSAG
FT                   LIKLDVSGTALATVANIKENPKNLKITELDASQTARSLSSVDAAVVNNTFVTEAKLDYK
FT                   KALFKEQADENSKQWYNIIVAKKDWETSPKADAIKKVIAAYHTDDVKKVIEESSDGLDQ
FT                   PVW"
FT   gene            192493..193866
FT                   /locus_tag="SPAP_0215"
FT   CDS_pept        192493..193866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0215"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase-like
FT                   deacylases"
FT                   /note="Operon 95 Gene 2 COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83808"
FT                   /protein_id="ADM83808.1"
FT                   /translation="MVFPSEQEQIEKFEKDHVAQHYFEVLRTLISKKSVFAQQVGLKEV
FT                   ANYLGEIFKRVGAEVEIDESYTAPFVMAHFKSSRPDAKTLIFYNHYDTVPADGDQVWTE
FT                   DPFTLSVRNGFMYGRGVDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEESASTD
FT                   LDKYLEKHADKLRGADLLVWEQGTKNALEQLEISGGNKGIVTFDAKVKSADVDIHSSYG
FT                   GVVESAPWYLLQALQSLRAADGRILVEGLYEEVQEPNEREMALLETYGQRNPEEVSRIY
FT                   GLELPLLQEERMAFLKRFFFEPALNIEGIQSGYQGQGVKTILPAEASAKLEVRLVPGLE
FT                   PHDVLEKIRKQLDKNGFDKVELYYTLGEMSYRSDMSAPAILNVIELAKKFYPQGVSVLP
FT                   TTAGTGPMHTVFDALEVPMVAFGLGNANSRDHGGDENVRIADYYTHIELVEELIRSYE"
FT   gene            193859..194920
FT                   /locus_tag="SPAP_0216"
FT   CDS_pept        193859..194920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0216"
FT                   /product="ABC-type metal ion transport system, ATPase
FT                   component"
FT                   /note="Operon 95 Gene 3 COG1135 ABC-type metal ion
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83809"
FT                   /protein_id="ADM83809.1"
FT                   /translation="MSRDIIKLDQIDVTFHQKKRTITAVKDVTIHIQEGDIYGIVGYSG
FT                   AGKSTLVRVINLLQKPSAGKITIDDDVIFDGKVTLTAEQLRRKRQDIGMIFQHFNLMSQ
FT                   KTAEENVAFALKHSGLSKEEKKAKVAKLLDLVGLADRAENYPSQLSGGQKQRVAIARAL
FT                   ANDPKILISDESTSALDPKTTKQILALLQDLNQKLGLTVVLITHEMQIVKDIANRVAVM
FT                   QDGHLIEEGSVLEIFSNPKQPLTQDFISTATGIDEAMVKIEKQEIVEHLSENSLLVQLK
FT                   YAGASTDEPLLNELYKHYQVMANILYGNIEILDGTPVGELVVVLSGEKAALAGAQEAIR
FT                   QAGVQLKVLKGVQ"
FT   gene            194922..195614
FT                   /locus_tag="SPAP_0217"
FT   CDS_pept        194922..195614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0217"
FT                   /product="ABC-type metal ion transport system, permease
FT                   component"
FT                   /note="Operon 95 Gene 4 COG2011 ABC-type metal ion
FT                   transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83810"
FT                   /protein_id="ADM83810.1"
FT                   /translation="MESLIQTYLPNVYKMGWAGQAGWGTAIYLTLYMTVLSFIIGGFLG
FT                   LVAGLFLVLTAPGGVLENKVVFWILDKITSIFRAVPFIILLAILSPLSHLIVKTSIGPN
FT                   AALVPLSFAVFAFFARQVQVVLAELDGGVIEAAQASGATFWDIVGVYLSEGLPDLIRVT
FT                   TVTLISLVGETAMAGAVGAGGIGNVAIAYGFNRYNHDVTILATIIIILIIFAIQFLGDF
FT                   LTKKLSHK"
FT   gene            complement(195644..196213)
FT                   /locus_tag="SPAP_0218"
FT   CDS_pept        complement(195644..196213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0218"
FT                   /product="hypothetical protein"
FT                   /note="Operon 96 Gene 1 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83811"
FT                   /protein_id="ADM83811.1"
FT                   /translation="MKKSILTTLLFAVLYFLCMGIGVLLGNLFDQTGNMFYAPAFTALV
FT                   GGSVYMILVAKVPRFGAITTIGLVIALFFLGTKHGAGSFLPGIICGLLADEVAHLGKYK
FT                   DKTKNFLSFIIFAFSTTGPILLMWIAPKAYMATLLARGKSQEYIDRIMVAPNPGTVLLF
FT                   IASIVIGALVGALIGQALSKKFAQKI"
FT   gene            196348..196962
FT                   /locus_tag="SPAP_0219"
FT   CDS_pept        196348..196962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0219"
FT                   /product="Predicted integral membrane protein"
FT                   /note="Operon 97 Gene 1 COG5578 Predicted integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83812"
FT                   /protein_id="ADM83812.1"
FT                   /translation="MGRFLDFVFNRFFLGMIATAFFWLLTLVGGIILGLAPASATLMSL
FT                   YAEHGYSFREYSLKEAWSLYKQNFVSSNLIFYSFLGVGLVLTYGLYLLVQLPHQTIVHL
FT                   IATLLNVLVVALIFLAYTVSLKLQVYFALSYRNSLKLSLIGIFMSLAAVAKILLGTVLL
FT                   VAIGYYMPALLFFVGIGMWHFFISDMLEPVYEIIHEKLATK"
FT   gene            197012..198610
FT                   /locus_tag="SPAP_0220"
FT   CDS_pept        197012..198610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0220"
FT                   /product="Predicted signal transduction protein with a
FT                   C-terminal ATPase domain"
FT                   /note="Operon 97 Gene 2 COG2972 Predicted signal
FT                   transduction protein with a C-terminal ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83813"
FT                   /protein_id="ADM83813.1"
FT                   /translation="MIIIIASFAILLSYADWDSREKEAQRVAQRVTARTVSEIEYYHRE
FT                   STQIAQALVENQARIEGIYKYFSLSMPDYFYWQLERKASPYISVSLYENVDDLYVRNDF
FT                   VTGVAIAFQDYKEVYVSTKDKRSGEKIRAEDFKPAGNSFAIPVSDPVSDQDLGVIYISL
FT                   DPAVLYHAIDNTRGHTPMAVTVTSPFDTEIFHMGETVDKESENWLVGLTSHGYQVQVAV
FT                   PKNFVLQGTVTSSALIVGLSLLFIVILYLTLRQTFANYQKQVVDLVDSIQAIAQGQEGL
FT                   RIDTLEKDQELLLIAETTNDMLDRLEKNIHDIYQLELSQKDANMRALQAQINPHFMYNT
FT                   LEFLRMYAVMQSQDELADIIYEFSSLLRNNISDERETLLKQELEFCRKYSYLCMVRYPK
FT                   SIAYGFKIDPELENMKIPKFTLQPLVENYFAHGVDHRRTDNVISIKALKQDGFVEILVV
FT                   DNGRGMSAEKLANIREKLSQKYFEHQASYSDQRQSIGIVNVHERFVLYFGDRYAITIES
FT                   AEQAGVQYRITIQDE"
FT   gene            198622..199908
FT                   /locus_tag="SPAP_0221"
FT   CDS_pept        198622..199908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0221"
FT                   /product="Response regulator containing CheY-like receiver
FT                   domain and AraC-type DNA-binding domain"
FT                   /note="Operon 97 Gene 3 COG4753 Response regulator
FT                   containing CheY-like receiver domain and AraC-type
FT                   DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83814"
FT                   /protein_id="ADM83814.1"
FT                   /translation="MYKVLLVDDEYMVTEGLKRLIPFDKWDMEVVATASHADEALEYVQ
FT                   ENPVDVIISDVNMPDKTGLDMIREMKEILPDAAYILLSGYQEFDYVKRAMNLSVVDYLV
FT                   KPVDKVELGNLLEKIAGQLGERGKKSQTLSQELDEAGFVSYLGDKENWWIGLSKEKQGS
FT                   FTIPYYVLGQDWQIFISDQPLDGLVVTPFEAPYQEHFERWKLNAEKTLFYGSVNLQQSE
FT                   SLFAYYEPIYRVIIQGNLNQIVEELNLLEKVVLENTPRVPITKQLFIQFVMDVFHLFEH
FT                   LKADDLTDIVKTIHAIQSFDELVPYIKETLSSFFGQYRMNENVVSVLEVIGRDYQKELS
FT                   LKDISKALFINPVYLGQLIKRETDSTFAELLNKQRIKAAQQLLLSTSDSIEDICYAVGY
FT                   SNLGYFYKVFRKLCGKSPKAYRKQVETIL"
FT   gene            199960..200493
FT                   /locus_tag="SPAP_0222"
FT   CDS_pept        199960..200493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0222"
FT                   /product="hypothetical protein"
FT                   /note="Operon 97 Gene 4 Putative gene predicted by FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83815"
FT                   /protein_id="ADM83815.1"
FT                   /translation="MKKKPIYLWVLLILSALISVPSLFGIVSPLPSKEALRAAQKQVAG
FT                   VNAQQLEDQLNYTYRVAEASHSIFNVALIVLSTILVVVAIVFLVRKNLQYANYTYVGYV
FT                   LLAIIGSIYGYVGLQDAVQLVQDESMRLTVSIGSKAVSIFYIVINVLFLALVFYKMWRQ
FT                   QKALAEEEETEELT"
FT   gene            200559..201041
FT                   /locus_tag="SPAP_0223"
FT   CDS_pept        200559..201041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0223"
FT                   /product="Protein involved in ribonucleotide reduction"
FT                   /note="Operon 98 Gene 1 COG1780 Protein involved in
FT                   ribonucleotide reduction"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83816"
FT                   /protein_id="ADM83816.1"
FT                   /translation="MEVHMKTISLVYISLSGNTESFVTRLKDYLLSQYKGIEVQKIHIK
FT                   DLVKEGKNFYEMDHPYVAFLPTYLEGGNGVDNGDVEILTTPVGDFIAYGNNASKCFGVV
FT                   GSGNRNFNNQYCLTAKQYSQRFGFPVLADFEMRGMLEDIKHVAAIIADLYELEKEN"
FT   gene            complement(201334..202596)
FT                   /locus_tag="SPAP_0224"
FT   CDS_pept        complement(201334..202596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0224"
FT                   /product="Mn2+ and Fe2+ transporters of the NRAMP family"
FT                   /note="Operon 99 Gene 1 COG1914 Mn2+ and Fe2+ transporters
FT                   of the NRAMP family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83817"
FT                   /protein_id="ADM83817.1"
FT                   /translation="MSQAISLNQSTWASKLKAMGPGILMATAAVGGSHIVSSTQAGGSY
FT                   GWSLLLLVILANVFKYPFFRFGAEYTADTGKTLVEGYAEKGKLYLWIFFILNVFSAMVN
FT                   TAGVAILCSAIIASAFPMIGLSITQWSLILVAIIWAMLLFGGYKLLDGMVKWIMSALTI
FT                   ATVLAVIIAAVKHPEYSSDFVEKTPWQMAALPFIVSLLGWMPAPIEISAINSLWSAEKR
FT                   KTVNFNTEDALFDFNTGYIGTAILAVFFVALGALIQYPTGQAVEAASAKYISQFVGMYA
FT                   SVLGEWSRYLITFIAFLCIFGTVITVIDGYSRVNQESLRLLISQKEDNRKSLNIWMTIT
FT                   AIIGIVIIKFFAGQVSTMLRFAMIGSFLTTPFFALLNYALVTRENKNLPSWLKHLAIAG
FT                   LIFLFGFAIFFIYALAIGKAG"
FT   gene            complement(202906..203364)
FT                   /locus_tag="SPAP_0225"
FT   CDS_pept        complement(202906..203364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0225"
FT                   /product="hypothetical protein"
FT                   /note="Operon 100 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83818"
FT                   /protein_id="ADM83818.1"
FT                   /translation="MKKQVFHDAAAGVLIGLILSILFSLIYAPNTYAPLNPYSLIGQVM
FT                   DQHQVHGALVLLYCTLIWAAIGMLFNFGNRLFSRDWSMLRATLTHFFLMLAGFVPLATL
FT                   AGWFPFHWIFYLQLIIEFAIVYLIIWAILYKREAKKVDHINQLLEHRK"
FT   gene            complement(203361..203801)
FT                   /locus_tag="SPAP_0226"
FT   CDS_pept        complement(203361..203801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0226"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /note="Operon 100 Gene 2 COG3279 Response regulator of the
FT                   LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83819"
FT                   /protein_id="ADM83819.1"
FT                   /translation="MKVELQISETYEEEKLIVQAPQETEKVQKVIEFAENLDQREKIKG
FT                   KIDDQVYLVEIGKIQRFYIENRKVLAETASQTYSIDLRLYQVLKLLPTNFIQISQSEII
FT                   NIDSISHLKLTPNGLVEIFLKNESFTYSSRRYLKTIKEKLEL"
FT   gene            204157..206106
FT                   /locus_tag="SPAP_0227"
FT   CDS_pept        204157..206106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0227"
FT                   /product="DNA mismatch repair enzyme (predicted ATPase)"
FT                   /note="Operon 101 Gene 1 COG0323 DNA mismatch repair enzyme
FT                   (predicted ATPase)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83820"
FT                   /protein_id="ADM83820.1"
FT                   /translation="MSHIIELPEMLANQIAAGEVIERPASVVKELVENAIDAGSSQIII
FT                   EIEEAGLKKVQITDNGHGIAHDEVELALRRHATSKIKNQADLFRIRTLGFRGEALPSIA
FT                   SVSVLTLLTAVDGASHGTKLVARGGEVEEVIPATSPVGTKVCVEDLFFNTPARLKYMKS
FT                   QQAELSHIIDIVNRLGLAHPEISFSLISDGKEMTRTAGTGQLRQAIAGIYGLVSAKKMI
FT                   EIENSDLDFEISGFVSLPELTRANRNYISLFINGRYIKNFLLNRAILDGFGSKLMVGRF
FT                   PLAVIHIHIDPYLADVNVHPTKQEVRISKEKELMTLVSEAIANSLKEQTLIPDALENLA
FT                   KSTVRNREKVEQTILPLKENTLYYEKTEPSRPSQTEVADYQVELTDEGQDLTLFAKETL
FT                   DRLTKPAKLHFAERKPANYDQLDHPELDLASIDKAYDKLEREEASSFPELEFFGQMHGT
FT                   YLFAQGRDGLYIIDQHAAQERVKYEEYRESIGNVDQSQQQLLVPYIFEFPADDALRLKE
FT                   RMPLLEEVGVFLAEYGENQFILREHPIWMAEEEIESGIYEMCDMLLLTKEVSIKKYRAE
FT                   LAIMMSCKRSIKANHRIDDHSARQLLYQLSQCDNPYNCPHGRPVLVHFTKSDMEKMFRR
FT                   IQENHTSLRELGKY"
FT   gene            complement(206431..206898)
FT                   /locus_tag="SPAP_0228"
FT   CDS_pept        complement(206431..206898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0228"
FT                   /product="Riboflavin synthase beta-chain"
FT                   /note="Operon 102 Gene 1 COG0054 Riboflavin synthase
FT                   beta-chain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83821"
FT                   /protein_id="ADM83821.1"
FT                   /translation="MNTYEGNLVANNIKIGIVVARFNEFITSKLLSGALDNLKRENVNE
FT                   KDIEVAWVPGAFEIPLIASKMAKSKKYDAIICLGAVIRGNTSHYDYVCSEVSKGIAQIS
FT                   LNSEIPVMFGVLTTDTIEQAIERAGTKAGNKGSECAQGAIEMVNLIRTLDA"
FT   gene            complement(206899..208104)
FT                   /locus_tag="SPAP_0229"
FT   CDS_pept        complement(206899..208104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0229"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="Operon 102 Gene 2 COG0108 3,4-dihydroxy-2-butanone
FT                   4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83822"
FT                   /protein_id="ADM83822.1"
FT                   /translation="MEYRKIQEALEALQKGRLVLVIDDKDRENEGDLICSAQAATTENV
FT                   NFMATYAKGLICMPMSESLANQLMLSPMVENNTDNHKTAFTVSIDYKETTTGISAEERG
FT                   LTARMCVAEDITPSDFRRPGHMFPLIAKKGGVLERNGHTEATVDLLKLAGLKECGLCCE
FT                   IMNHDGKMMRTDDLIQFSKKHNIPLITIKELQEYRKVYDQLVERVSTVNMPTRYDNFKA
FT                   ISYIDKLNGEHHLALIMGNIEDEANVLCRVHSECLTGDVLGSLRCDCGQQFDKAMKMIV
FT                   ENGSGVLLYLRQEGRGIGLINKLKAYHLQDQGMDTLDANLALGFEGDLREYHIGAQMLK
FT                   DLGLQSLHLLTNNPDKVEQLEKYGITISSRISIEIEANPYDSFYLETKKNRMGHILNME
FT                   EK"
FT   gene            complement(208124..208759)
FT                   /locus_tag="SPAP_0230"
FT   CDS_pept        complement(208124..208759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0230"
FT                   /product="Riboflavin synthase alpha chain"
FT                   /note="Operon 102 Gene 3 COG0307 Riboflavin synthase alpha
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83823"
FT                   /protein_id="ADM83823.1"
FT                   /translation="MFTGIIEEIGKVERIQKDSRNCKLSIKASKILTDIHLGDSIAVNG
FT                   ICLTVTHFNHQSFTVDVMNETWSRTALTLLKHGSEVNLERALSVNGRLGGHVVTGHIDG
FT                   TGKISSIKKDDNAVWYQINTQKEILDLIVEKGSITIDGISLTVAKVSKVNFSVSVIPHT
FT                   LEQTILKSKQVGSTVNLENDILGKYVQKLMDNSPKSEISKKLLYQNGF"
FT   gene            complement(208744..209844)
FT                   /locus_tag="SPAP_0231"
FT   CDS_pept        complement(208744..209844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0231"
FT                   /product="Pyrimidine reductase, riboflavin biosynthesis"
FT                   /note="Operon 102 Gene 4 COG1985 Pyrimidine reductase,
FT                   riboflavin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83824"
FT                   /protein_id="ADM83824.1"
FT                   /translation="MSDSKYMKLAIKLAQKGAGYVNPNPMVGAVIVKDNHIIGQGYHEF
FT                   FGGPHAERNALKNCRESPVGATLYVTLEPCCHFGKTPPCIDAIIDSGITRVVIGSLDCN
FT                   PIVSGKGVKILEENNLQVTVGILENECLNLIKSFRKYITQHVPYVFMKYAMSMDGKIAT
FT                   KTNQSKWITEEEARKHVHQLRHYVSAIMVGVNTVIQDDPLLTCRLEEGKNPIRIICDTH
FT                   LRTPLTSKIVKTANDIKTYIATSSEDKNKMKLYQNHGCEILSIKKKGNHIDLSSLMQHL
FT                   GNMQIDSLVLEGGSLMNWSALEQQIVDELKIYIAPKIFGGSAKFPVGGEGISLPNDAIR
FT                   LKPYAFSQIGNDYLIESEVIYPCSQE"
FT   gene            209935..210144
FT                   /locus_tag="SPAP_0232"
FT   CDS_pept        209935..210144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0232"
FT                   /product="hypothetical protein"
FT                   /note="Operon 103 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83825"
FT                   /protein_id="ADM83825.1"
FT                   /translation="MTSNHFRARKKHKYTFIFFHPDYTVGFGISPNHAFRLVGYTTGRE
FT                   LHPALKIVIQLQMIIVLNFEYVNR"
FT   gene            210250..210843
FT                   /locus_tag="SPAP_0233"
FT   CDS_pept        210250..210843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0233"
FT                   /product="Holliday junction resolvasome, DNA-binding
FT                   subunit"
FT                   /note="Operon 104 Gene 1 COG0632 Holliday junction
FT                   resolvasome, DNA-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83826"
FT                   /protein_id="ADM83826.1"
FT                   /translation="MYAYLKGIITKITAKYIVLETNGIGYILHVANPYAYSGQVNQEAQ
FT                   IYVHQVVREDAHLLYGFRSEDEKKLFLSLISVSGIGPVSALAIIAADDNAGLVQAIETK
FT                   NITYLTKFPKIGKKTAQQMVLDLEGKVVVAGDGLPAKVAVQASAENQELEEAMEAMLAL
FT                   GYKATELKKIKKFFEGTTDTAENYIKSALKMLVK"
FT   gene            210853..211416
FT                   /locus_tag="SPAP_0234"
FT   CDS_pept        210853..211416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0234"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /note="Operon 104 Gene 2 COG2818 3-methyladenine DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83827"
FT                   /protein_id="ADM83827.1"
FT                   /translation="MTKRCSWVKMTNPLYIAYHDEEWGQPLHDDQALFELLCMETYQAG
FT                   LSWETVLNKRQAFREAFHSYQIHSVAEMTETELEAMLENPAIIRNRAKLFATRANAQAF
FT                   LQLQAEYGSFDAYLWSFVEGKTVVNDVPDYRQAPAKTPLSEKLAKDLKKRGFKFTGPVA
FT                   VLSFLQAAGLVDDHENDCEWKGLK"
FT   gene            211416..212090
FT                   /locus_tag="SPAP_0235"
FT   CDS_pept        211416..212090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0235"
FT                   /product="Predicted metal-dependent membrane protease"
FT                   /note="Operon 104 Gene 3 COG1266 Predicted metal-dependent
FT                   membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83828"
FT                   /protein_id="ADM83828.1"
FT                   /translation="MSNKNKEILIFAILYTVLFMFDGVKLLASLMPSAIANYLVYVVLA
FT                   LYGSFLFKDRLIQQWKEIRKTKRKFFFGVLTGWLFLILMTVVFEFVSEMLKQFVGLDGQ
FT                   GLNQSNIQSTFQEQPLLIAVFACVIGPLVEELFFRQVLLHYLQERLPGLLSIILVGLVF
FT                   ALTHMHSLALSEWIGAVGYLGGGLAFSIIYVKEKENIYYPLLVHMLSNSLSLIILAISI
FT                   VK"
FT   gene            complement(212245..213276)
FT                   /locus_tag="SPAP_0236"
FT   CDS_pept        complement(212245..213276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0236"
FT                   /product="uncharacterized protein"
FT                   /note="Operon 105 Gene 1 COG1619 Uncharacterized proteins,
FT                   homologs of microcin C7 resistance protein MccF"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83829"
FT                   /protein_id="ADM83829.1"
FT                   /translation="MVSTIGIVSLSSGIIGEDFVKHEVDLGIQRLKDLGLNPIFLPHSL
FT                   KGLDFIKDHPEARAEDLIHAFSDDSIDMILCAIGGDDTYRLLPYLFENDQLQKVIKQKI
FT                   FLGFSDTTMNHLMLHKLGIKTFYGQSFLADICELDKEMLAYSLHYFKELIETGRISEIR
FT                   PSDVWYEERTDFSPTALGTPRVSHTNTGFDLLQGRAQFEGKILGGCLESLYDIFDNSRY
FT                   ADSTELCQKYKLFPDLSDWEGKILLLETSEEKPKPEDFKKMLLTLKDTGIFAVINGLLV
FT                   GKPMDETFHDDYKEALLDIIDSNIPIVYNLNVGHATPRAIVPFGVHAHVDAQEQVIRFD
FT                   YNK"
FT   gene            complement(213531..214214)
FT                   /locus_tag="SPAP_0237"
FT   CDS_pept        complement(213531..214214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0237"
FT                   /product="uncharacterized membrane-bound protein"
FT                   /note="Operon 106 Gene 1 COG4858 Uncharacterized
FT                   membrane-bound protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83830"
FT                   /protein_id="ADM83830.1"
FT                   /translation="MSQIDLQKLTKKNQEFVHIATQQFIKDGKTDAEIQTIFEEVIPQI
FT                   LEEQSKGTTARSLYGAPTHWAHSFTVKEQYEKEHPKENDDPKLMIMDSALFITSLFALV
FT                   SALTTFFAADQAFGYGLITLLLVGLVGGFAFYLMYYFVYQYYGPDMDRSQRPPFWKSVL
FT                   VILASMFLWLLVFFATSFLPASLNPVLDPLPLAIIGAALLALRFYLKKRLNIRSASAGP
FT                   TRYQE"
FT   gene            complement(214226..215170)
FT                   /locus_tag="SPAP_0238"
FT   CDS_pept        complement(214226..215170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0238"
FT                   /product="Mg2+ and Co2+ transporter"
FT                   /note="Operon 106 Gene 2 COG0598 Mg2+ and Co2+
FT                   transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83831"
FT                   /protein_id="ADM83831.1"
FT                   /translation="MKQVFLSTTTEFKEIDTLEPGTWINLVNPTQNESLEIANTFDIDI
FT                   ADLRAPLDAEEMSRITIEDEYTLIIVDVPVTEERNNRTYYVTIPLGIIITEETIITTCL
FT                   EPLPVLDVFINRRLRNFYTFMRSRFIFQILYRNAELYLTALRSIDRKSEQIESQLHQST
FT                   RNEELIELMELEKTIVYFKASLKTNERVIKKLTSSTSNIKKYLEDEDLLEDTLIETQQA
FT                   IEMADIYGNVLHSMTETFASIISNNQNNIMKTLALVTIVMSIPTMVFSAYGMNFKDNEI
FT                   PLNGEPNAFWLIVFIAFAMSVSLTLYLIHKKWF"
FT   gene            215302..218133
FT                   /locus_tag="SPAP_0239"
FT   CDS_pept        215302..218133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0239"
FT                   /product="Excinuclease ATPase subunit"
FT                   /note="Operon 107 Gene 1 COG0178 Excinuclease ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83832"
FT                   /protein_id="ADM83832.1"
FT                   /translation="MQDKIVIHGARAHNLKNIDVEIPRDKLVVVTGLSGSGKSSLAFDT
FT                   LYAEGQRRYVESLSAYARQFLGNMEKPDVDAIDGLSPAISIDQKTTSKNPRSTVGTTTE
FT                   INDYLRLLYARVGTPYCINGHGAINASSVEQIVDKVLELPEGQRLQILAPVIRKKKGQH
FT                   KSVIEKVQKDGYVRVRVDGEVYDVTEVPELSKSKQHNIDVVVDRIVIKEGIRSRLFDSI
FT                   EAALRIAEGYVIIDTMDDSELLFSEHYACPVCGFTVPELEPRLFSFNAPFGSCSECDGL
FT                   GIKLEVDTDLVVPDASKTLREGALAPWNPISSNYYPNMLEQAMKVFGVAMDKPFEDLSE
FT                   EDKNLILYGSDGKEFHFHYENEFGGVRDIDIPFEGVINNIKRRYHETNSDYTRTQMRLY
FT                   MNELTCGTCQGYRLNDQALSVRVGGQQGPHIGEISDLSIADHLDLVSQLTLSENEAIIA
FT                   RPILKEIKDRLTFLNNVGLNYLTLSRSAGTLSGGESQRIRLATQIGSNLSGVLYILDEP
FT                   SIGLHQRDNDRLIASLKKMRDLGNTLIVVEHDEDTMREADYLIDVGPGAGVFGGEIVAA
FT                   GTPKQVARNSKSITGQYLSGKRVIPVSEERRVGNGRFIEVIGARENNLQNVTARFPLGK
FT                   FIAVTGVSGSGKSTLINSILKKAIAQKLNRNSDKPGKFKTITGIEHVDRLIDIDQSPIG
FT                   RTPRSNPATYTGVFDDIRDLFAQTNEAKIRGYKKGRFSFNVKGGRCEACSGDGIIKIEM
FT                   HFLPDVYVACEVCHGTRYNSETLEVHYKEKNISQVLDMTVNDAVEFFQHIPKIQRKLQT
FT                   IKDVGLGYVTLGQPATTLSGGEAQRMKLASELHKRSTGKSFYILDEPTTGLHTEDIARL
FT                   LKVLARFVDDGNTVLVIEHNLDVIKTADHIIDLGPEGGVGGGTIIVTGTPEEVAANEAS
FT                   YTGHYLKGKLHHE"
FT   gene            218126..219187
FT                   /locus_tag="SPAP_0240"
FT   CDS_pept        218126..219187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0240"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /note="Operon 107 Gene 2 COG0006 Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83833"
FT                   /protein_id="ADM83833.1"
FT                   /translation="MNKRVQAFLAKMQEKELDGIIINNLKNVYYLTGFWGSNGTVFISR
FT                   DRQVLVTDSRYIIAAKQETSGFEIVADRDELAVIAGIVKDMGLTRIGFEDEISVSYYHR
FT                   MQAAFAGLDLLPQTQFVEGLRMIKDEAEIAAIRKACSISDQAFRDALDFIKPGKTEIEI
FT                   ANFLDFRMRELGASGLSFDTILASGINSSKPHAHPMHKPVELGEAITMDFGCLYDHYVS
FT                   DMTRTIYLGHVSDEQAEIYNTVLKANQALIDQAKAGLGFRDFDKIPRDIIIEAGYGDYF
FT                   THGIGHGIGLDIHEEPYFSQTSTETIKTGMALTDEPGIYIEGKYGVRIEDDILITETGC
FT                   ELLTLAPKELIVI"
FT   gene            219319..219717
FT                   /locus_tag="SPAP_0241"
FT   CDS_pept        219319..219717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0241"
FT                   /product="Arsenate reductase-like glutaredoxin family
FT                   protein"
FT                   /note="Operon 108 Gene 1 COG1393 Arsenate reductase and
FT                   related proteins, glutaredoxin family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83834"
FT                   /protein_id="ADM83834.1"
FT                   /translation="MIKIYTVSSCTSCKKAKTWLNAHQLSYKEQNLGKEGITREELLDI
FT                   LTKTDNGIASIVSSKNRYAKALGVDIEDLSVNEVLNLIMETPRILKSPILVDEKRLQVG
FT                   YKEDDIRAFLPRSVRNVENAEARLRAAL"
FT   gene            219783..220352
FT                   /locus_tag="SPAP_0242"
FT   CDS_pept        219783..220352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0242"
FT                   /product="hypothetical protein"
FT                   /note="Operon 108 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83835"
FT                   /protein_id="ADM83835.1"
FT                   /translation="MKKIVLVSLAFLFVLVGCGQKKETGPATKTEKDTLQSALPVIENA
FT                   EKNTVVTKTLVLPKSDDGSQQTQTITYKDKTFLSLTIQQKRPVSDELKTYIDQHGVEET
FT                   QKALLEAEEKDKSIIEARKLAGFKLETKLLSATELQTTTSFDFQVLDVKKASQLEHLKN
FT                   IGLENLLKNEPSKYISDRLANGATEQ"
FT   gene            220439..220705
FT                   /locus_tag="SPAP_0243"
FT   CDS_pept        220439..220705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0243"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 109 Gene 1 COG4472 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83836"
FT                   /protein_id="ADM83836.1"
FT                   /translation="MGFTEETVRFKLDDSNKKEISETLTDVYASLNDKGYNPINQIVGY
FT                   VLSGDPAYVPRYNNARNQIRKYERDEIVEELVRYYLKGQGVDL"
FT   gene            220709..221128
FT                   /locus_tag="SPAP_0244"
FT   CDS_pept        220709..221128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0244"
FT                   /product="predicted endonuclease"
FT                   /note="Operon 109 Gene 2 COG0816 Predicted endonuclease
FT                   involved in recombination (possible Holliday junction
FT                   resolvase in Mycoplasmas and B. subtilis)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83837"
FT                   /protein_id="ADM83837.1"
FT                   /translation="MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRV
FT                   KELVDTYKVERFVVGLPKNMNNTSGPRVEASQAYGAKLEEFFGLPVDYQDERLTTVAAE
FT                   RMLIEQADISRNKRKKVIDKLAAQLILQNYLDRKF"
FT   gene            221144..221449
FT                   /locus_tag="SPAP_0245"
FT   CDS_pept        221144..221449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0245"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 109 Gene 3 COG3906 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83838"
FT                   /protein_id="ADM83838.1"
FT                   /translation="MSHDHNHDHEERELITLVDEQGNETLFEILLTIDGKEEFGKNYVL
FT                   LVPVNAEEDEDGQVEIQAYSFIENEDGTEGELQPIPEDSEDEWNMIEEVFNSFMEE"
FT   gene            221707..222957
FT                   /locus_tag="SPAP_0246"
FT   CDS_pept        221707..222957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0246"
FT                   /product="Folylpolyglutamate synthase"
FT                   /note="Operon 110 Gene 1 COG0285 Folylpolyglutamate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83839"
FT                   /protein_id="ADM83839.1"
FT                   /translation="MFEVEEWLHSRIGLNFRSGLGRMQQAVDLLGNPEQSYPIIHVTGT
FT                   NGKGSTIAFMRELFMGHGKKVATFTSPHIVSINDRICINGQPIADADFIRLTDQVKEME
FT                   KTLLQTPAQLSFFELLTLVAFLYFREQEVDLVLLEVGIGGLLDTTNVVTGELAVITSIG
FT                   LDHQETLGDSLEAIAEQKAGIFKAGKKAVIAKLPPEARLVCQKKAESLAVNLYQAGQDF
FT                   LMLNGDFSSSLLNLSQLNIGLEGVYQQENAALALQTFLLFMGEGKEAVDEQAVRKALEQ
FT                   THWAGRLERIRPQIYLDGAHNLPALTRLVEFIKEKEQEGYRPQILFGALKRKDYQGMLG
FT                   YLTEKLPQVELKVTGFDYQGALDERDVTGYDIVSSYREFISDFEERADAQDLLFVTGSL
FT                   YFISEVRGYLLDREQIN"
FT   gene            223041..223499
FT                   /locus_tag="SPAP_0247"
FT   CDS_pept        223041..223499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0247"
FT                   /product="hypothetical protein"
FT                   /note="Operon 110 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83840"
FT                   /protein_id="ADM83840.1"
FT                   /translation="MKLKRFTLSLASLASFSLLVACSQRAQQVQQPVAQQQVQQPAQQN
FT                   TNTANAGGNQNQAAPVQNQPVAQPTDIDGTYTGQDDGDRITLVVTGTTGTWTELESDGD
FT                   QKVKQVTFDSANQRMIIGDDVKIYTVNGNQIVVDDMDRDPSDQIVLTK"
FT   gene            223672..225177
FT                   /locus_tag="SPAP_0248"
FT   CDS_pept        223672..225177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0248"
FT                   /product="Phosphatidylserine/
FT                   phosphatidylglycerophosphate/cardioli pin synthases-like
FT                   enzyme"
FT                   /note="Operon 111 Gene 1 COG1502
FT                   Phosphatidylserine/phosphatidylglycerophosphate/cardioli
FT                   pin synthases and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83841"
FT                   /protein_id="ADM83841.1"
FT                   /translation="MSKYGFSLSIMLLELCLVFGLFLYLGRMAPILWITVLILLSIITI
FT                   ISIVNRNTTPENKVTWLLVAFVPVFGPLLYLMFGERRLSKKEIKQLKKLGSMHFQEANS
FT                   QLLKEKLKESDKAAYGVIKSLLSMDTNADIYDQTASTFFPNGEAMWKKMVEDLKKAEKF
FT                   IFLEYYIIEEGLMWNRILDILEQKVAQGVEVKMLYDDIGCMATLTGDYAHRLRQLGIEA
FT                   HKFNKVIPRLTVAYNNRDHRKILIVDGQIAYTGGVNLADEYINHVERFGYWKDSGIRLD
FT                   GLAVKALTRLFLTTWYINRGEISDFDQYHLENHSIPSDGLTIPYGSGPKPIFRAQVGKK
FT                   VYQSLINQATESVYITTPYLIIDYDLTETIKNAAMRGVDVRIITPYIPDKKFIQLVTRG
FT                   AYPDLLSAGVRIYEYSPGFIHSKQMLVDEDFAVVGTINLDYRSLVHHYENAVLLYKTPS
FT                   IREIARDFRNIFADSQEVYPHSIKTSWYQKLVKEIAQLFAPIL"
FT   gene            225255..225398
FT                   /locus_tag="SPAP_0249"
FT   CDS_pept        225255..225398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0249"
FT                   /product="hypothetical protein"
FT                   /note="Operon 111 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83842"
FT                   /protein_id="ADM83842.1"
FT                   /translation="MLTKEEVNDMIEFKQTHLHRFREIETFVKLCKKSLKQPSQADNPR
FT                   TF"
FT   gene            225435..226973
FT                   /locus_tag="SPAP_0250"
FT   CDS_pept        225435..226973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0250"
FT                   /product="hypothetical protein"
FT                   /note="Operon 111 Gene 3 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83843"
FT                   /protein_id="ADM83843.1"
FT                   /translation="MSVYGRVEEVHKENREPLEYQIEQESHHRESSRLPLVKILLWSTL
FT                   VTGITLGVPLLLDLMSAQEVQDFYAGWALHQTGKIYSDYYGSQGLLYYLLTYVSQGGFF
FT                   FAIFEWLALVAGGFFLFRSADTLTEQGDQAGHLVTIFYMLVTGLAFGGGYATLLALPFL
FT                   FAAFSLVAAYLSNPSHDKGFVRIGLALAGGFFFAPLSSLLFIAVVSLGLLVFNLGHRRF
FT                   AHGFYQFLAVALGFSLVFYPTAYYSAATGSFGDAISGIRYPIDSIRFDFTSKILENMFF
FT                   YGLLSLGLGFVVCIFLGLFQSKPFKLYVISVPASLVVILGLILLFFSQEPLHASYLMVV
FT                   FPVFLLLLVTNIKSQQRGRSARRSRRETPVSLWSRFFKGNLYLLVFGFVYLLSVPFLMK
FT                   FVLYPVPYQERNRLADLVKEETNTEDAIYAWDDTATLYRKSERLSPSAILSPLHYTATE
FT                   ENRNKLLNDLKEKQPKVIVVNDKVVVWSEVETLLKENYQQVKTDYSEFKVYKIK"
FT   gene            227093..229300
FT                   /locus_tag="SPAP_0251"
FT   CDS_pept        227093..229300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0251"
FT                   /product="Oxygen-sensitive ribonucleoside-triphosphate
FT                   reductase"
FT                   /note="Operon 112 Gene 1 COG1328 Oxygen-sensitive
FT                   ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83844"
FT                   /protein_id="ADM83844.1"
FT                   /translation="MIALEEKITILPTLFVEKRDGRRVVFDVDKIDKALHKAADKVMDV
FT                   TPLVEKRLNDLTERIITEIHSRFPQGIKIYEIQNIVEHELLEAKEYALAEEYITYRTQR
FT                   DFERSKATDINFSIHKLLNKDQTVVNENANKDSDVFNTQRDLTAGIVGKSIGLQMLPKH
FT                   VANAHQKGDIHYHDLDYSPYTPMTNCCLIDFKGMLENGFKIGNAEVESPKSIQTATAQI
FT                   SQIIANVASSQYGGCSADRIDEILAPYAEKNYQKHLKDAEEWVLPEKQEDYAWKKAQKD
FT                   IYDAMQSLEYEINTLFTSNGQTPFTSLGFGLGTSRFEREIQKAILNIRIKGLGSEHRTA
FT                   IFPKLIFTLKRGLNLEEGTPNYDIKQLALECATKRMYPDVLSYDKIVDLTGSFKVPMGC
FT                   RSFLQGWKDENGVEVNSGRMNLGVVTVNLPRIALESEGDMNKFWEIFNERMNIAEDALV
FT                   YRVERTKEATPANAPILYQYGAFGHRLGKEESVDQLFKNRRATVSLGYIGLYEVATVFF
FT                   GNSWESNPDAKEFTLDIIHDMKRRVEEWSDQYGYHFSIYSTPSESLTDRFCRLDIDKFG
FT                   SIPDITDKEYYTNSFHYDVRKNPTPFEKLDFEKVYPEAGASGGFIHYCEYPVLQQNPKA
FT                   LEAVWDYAYDRVGYLGTNTPIDRCYKCDFEGDFEPTERGFACPNCGNSDPKTVDVVKRT
FT                   CGYLGNPQARPMVNGRHKEIAARVKHMNGSTIKIAGHQVTN"
FT   gene            229312..229452
FT                   /locus_tag="SPAP_0252"
FT   CDS_pept        229312..229452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0252"
FT                   /product="hypothetical protein"
FT                   /note="Operon 112 Gene 2 protein supported
FT                   gi|15900139|ref|NP_344743.1| hypothetical protein SP_0203"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83845"
FT                   /protein_id="ADM83845.1"
FT                   /translation="MGKYQLDDKGRAQVTRYHEKHSKGGAGKKERLLSFREQFLNKNKK
FT                   K"
FT   gene            229496..230002
FT                   /locus_tag="SPAP_0253"
FT   CDS_pept        229496..230002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0253"
FT                   /product="Predicted acetyltransferase"
FT                   /note="Operon 112 Gene 3 COG3981 Predicted
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83846"
FT                   /protein_id="ADM83846.1"
FT                   /translation="MELRRPRLADKKAVLDMMTEFEKFQSPHDGGFWDTENFVYEDWLE
FT                   SNQEQEMGINLPEGWVPAIQLVAFSEKGQAVGFLNLRLRLSNFLLEEGGHIGYSIRPSE
FT                   RGKGYAKETLRQGLQVAKEKNIKKALVTCSVNNPASRAVILANGGIFEDARNGVERYWI
FT                   EVANE"
FT   gene            229995..230585
FT                   /locus_tag="SPAP_0254"
FT   CDS_pept        229995..230585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0254"
FT                   /product="Organic radical activating enzyme"
FT                   /note="Operon 112 Gene 4 COG0602 Organic radical activating
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83847"
FT                   /protein_id="ADM83847.1"
FT                   /translation="MNNPKPQEWKSEELSQGRIIDYKAFNFVDGEGVRNSLYVSGCMFH
FT                   CEGCYNVATWSFNAGIPYTAELEEQIMADLAQPYVQGLTLLGGEPFLNTGILLPLVKRI
FT                   RKELPDKDIWSWTGYTWEEMMLETPDKLELLSLIDILVDGRYDRTKRNLMLQFRGSSNQ
FT                   RIIDVQKSLKSGQVVIWDKLNDGKESYEQVKRE"
FT   gene            230582..231166
FT                   /locus_tag="SPAP_0255"
FT   CDS_pept        230582..231166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0255"
FT                   /product="hypothetical protein"
FT                   /note="Operon 112 Gene 5 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83848"
FT                   /protein_id="ADM83848.1"
FT                   /translation="MKKKDLVDQLVSAIETGKVRTLGIYGHGASGKSTFAQELYQALDS
FT                   TTVNLLETDPYITSGRHLVVPKDAPNQKVTASLPVAHELESLQRDILALQAGMDVLTIE
FT                   EPWKASEVLSGAKPILIVEGMSVGFLPKELFEKTICFYTDEETELKRRLARDTTVRNRD
FT                   ASFILASHQMRREQYLRYYKETESKADILVD"
FT   gene            231466..231774
FT                   /locus_tag="SPAP_0256"
FT   CDS_pept        231466..231774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0256"
FT                   /product="hypothetical protein"
FT                   /note="Operon 113 Gene 1 protein supported
FT                   gi|15900144|ref|NP_344748.1| 30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83849"
FT                   /protein_id="ADM83849.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL"
FT   gene            231991..232617
FT                   /locus_tag="SPAP_0257"
FT   CDS_pept        231991..232617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0257"
FT                   /product="hypothetical protein"
FT                   /note="Operon 113 Gene 2 protein supported
FT                   gi|15900145|ref|NP_344749.1| 50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83850"
FT                   /protein_id="ADM83850.1"
FT                   /translation="MTKGILGKKVGMTQIFTEAGELIPVTVIEATPNVVLQVKTVETDG
FT                   YNAIQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNVEGLEVGAEITVETFAAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKNLAGRMG
FT                   GDRVTIQNLEVVQVVPEKNVILIKGNVPGAKKSLITIKSAVKAGK"
FT   gene            232642..233265
FT                   /locus_tag="SPAP_0258"
FT   CDS_pept        232642..233265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0258"
FT                   /product="hypothetical protein"
FT                   /note="Operon 113 Gene 3 protein supported
FT                   gi|15900146|ref|NP_344750.1| 50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83851"
FT                   /protein_id="ADM83851.1"
FT                   /translation="MANVTLFDQTGKEAGQVVLSDAVFGIEPNESVVFDVIISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQK
FT                   VRRLALKSVYSEKVAENKFVAVDALSFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFA
FT                   ALSARNLPNVKVATATTASVLDIANSDKLLVTQAAISKIEEVLA"
FT   gene            233265..233561
FT                   /locus_tag="SPAP_0259"
FT   CDS_pept        233265..233561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0259"
FT                   /product="hypothetical protein"
FT                   /note="Operon 113 Gene 4 protein supported
FT                   gi|15900147|ref|NP_344751.1| 50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83852"
FT                   /protein_id="ADM83852.1"
FT                   /translation="MNLYDVIKKPVITESSMAQLEAGKYVFEVDTRAHKLLIKQAVEAA
FT                   FEGVKVANVNTINVKPKAKRVGRYTGFTNKTKKAIITLTADSKAIELFAAEAE"
FT   gene            233579..234412
FT                   /locus_tag="SPAP_0260"
FT   CDS_pept        233579..234412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0260"
FT                   /product="hypothetical protein"
FT                   /note="Operon 113 Gene 5 protein supported
FT                   gi|15900148|ref|NP_344752.1| 50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83853"
FT                   /protein_id="ADM83853.1"
FT                   /translation="MGIRVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVALKSKAGRNN
FT                   NGRITVRHQGGGHKRFYRLVDFKRNKDNVEAVVKTIEYDPNRSANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPEADIKVGNALPLANIPVGTLIHNIELKPGRGGELVRAAGASAQ
FT                   VLGSEGKYVLVRLQSGEVRMILGTCRATVGVVGNEQHGLVNLGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK"
FT   gene            234516..234797
FT                   /locus_tag="SPAP_0261"
FT   CDS_pept        234516..234797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0261"
FT                   /product="hypothetical protein"
FT                   /note="Operon 113 Gene 6 protein supported
FT                   gi|15900149|ref|NP_344753.1| 30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83854"
FT                   /protein_id="ADM83854.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRRK"
FT   gene            complement(234658..235113)
FT                   /locus_tag="SPAP_0262"
FT   CDS_pept        complement(234658..235113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0262"
FT                   /product="hypothetical protein"
FT                   /note="Operon 114 Gene 1 protein supported
FT                   gi|15902237|ref|NP_357787.1| hypothetical protein spr0193"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83855"
FT                   /protein_id="ADM83855.1"
FT                   /translation="MLIGEAEPFARGRKRFIVGPSFANASDTTKLALSKPKLFSALATA
FT                   EFKTFKMISAALFGVNVKIAIASATLLPRMLSRTRRDLRGETRTVRAIALAEVISAIYV
FT                   LLIFYVFSCRLQRDLCKYELVQIHQVCGLPCLLGCKQVRVYVRHKLQ"
FT   gene            234809..235153
FT                   /locus_tag="SPAP_0263"
FT   CDS_pept        234809..235153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0263"
FT                   /product="Ribosomal protein L22"
FT                   /note="Operon 115 Gene 1 COG0091 Ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83856"
FT                   /protein_id="ADM83856.1"
FT                   /translation="MAEITSAKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTPN
FT                   KAAEIILKVLNSAVANAENNFGLDKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRT
FT                   AHITVAVAEK"
FT   gene            235166..235819
FT                   /locus_tag="SPAP_0264"
FT   CDS_pept        235166..235819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0264"
FT                   /product="hypothetical protein"
FT                   /note="Operon 115 Gene 2 protein supported
FT                   gi|15900151|ref|NP_344755.1| 30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83857"
FT                   /protein_id="ADM83857.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFVQKE
FT                   LADAAVSTIEIERAVNKVNVSLHTAKPGMVIGKGGANVDALRAKLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGEGIARQLEQRVAFRRAQKQAIQRAMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   gene            235823..236236
FT                   /locus_tag="SPAP_0265"
FT   CDS_pept        235823..236236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0265"
FT                   /product="hypothetical protein"
FT                   /note="Operon 115 Gene 3 protein supported
FT                   gi|15900152|ref|NP_344756.1| 50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83858"
FT                   /protein_id="ADM83858.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EIAGVSEEIAREALRLASHKLPVKCKFVKREAE"
FT   gene            236246..236452
FT                   /locus_tag="SPAP_0266"
FT   CDS_pept        236246..236452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0266"
FT                   /product="hypothetical protein"
FT                   /note="Operon 115 Gene 4 protein supported
FT                   gi|15900153|ref|NP_344757.1| 50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83859"
FT                   /protein_id="ADM83859.1"
FT                   /translation="MKLNEVKEFVKELRGLSQEELAKRENELKKELFELRFQAATGQLE
FT                   QTARLKEVKKQIARIKTVQSEAK"
FT   gene            236477..236737
FT                   /locus_tag="SPAP_0267"
FT   CDS_pept        236477..236737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0267"
FT                   /product="hypothetical protein"
FT                   /note="Operon 115 Gene 5 protein supported
FT                   gi|15900154|ref|NP_344758.1| 30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83860"
FT                   /protein_id="ADM83860.1"
FT                   /translation="MERNNRKVLVGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEEAVII"
FT   gene            236763..237131
FT                   /locus_tag="SPAP_0268"
FT   CDS_pept        236763..237131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0268"
FT                   /product="hypothetical protein"
FT                   /note="Operon 115 Gene 6 protein supported
FT                   gi|15900155|ref|NP_344759.1| 50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83861"
FT                   /protein_id="ADM83861.1"
FT                   /translation="MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKSGARRADGSYIKFDENAAVIIREDKTPRGTRIFGPVAR
FT                   ELREGGFMKIVSLAPEVL"
FT   gene            237209..237514
FT                   /locus_tag="SPAP_0269"
FT   CDS_pept        237209..237514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0269"
FT                   /product="hypothetical protein"
FT                   /note="Operon 115 Gene 7 protein supported
FT                   gi|15900156|ref|NP_344760.1| 50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83862"
FT                   /protein_id="ADM83862.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGTEAVVLTALPKVNKVIVEGVNIVKKHQ
FT                   RPTNELPQGGIIEKEAAIHVSNVQVLDKNGVAGRVGYKFVDGKKVRYNKKSGEVLD"
FT   gene            237538..238080
FT                   /locus_tag="SPAP_0270"
FT   CDS_pept        237538..238080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0270"
FT                   /product="hypothetical protein"
FT                   /note="Operon 115 Gene 8 protein supported
FT                   gi|15900157|ref|NP_344761.1| 50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83863"
FT                   /protein_id="ADM83863.1"
FT                   /translation="MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAV
FT                   SNAKSLEKAAEELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKTRGLDIVIVTTANT
FT                   DEESRALLTGLGMPFAK"
FT   gene            238098..238367
FT                   /locus_tag="SPAP_0271"
FT   CDS_pept        238098..238367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0271"
FT                   /product="hypothetical protein"
FT                   /note="Operon 115 Gene 9 protein supported
FT                   gi|15900158|ref|NP_344762.1| 30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83864"
FT                   /protein_id="ADM83864.1"
FT                   /translation="MAKKSMVAREAKRQKIVDRYAEKRAALKAAGDYEGLSKLPRNASP
FT                   TRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW"
FT   gene            238653..239051
FT                   /locus_tag="SPAP_0272"
FT   CDS_pept        238653..239051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0272"
FT                   /product="hypothetical protein"
FT                   /note="Operon 115 Gene 10 protein supported
FT                   gi|15900160|ref|NP_344764.1| 30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83865"
FT                   /protein_id="ADM83865.1"
FT                   /translation="MVMTDPIADFLTRIRNANQAKHEVLEVPASNIKKGIAEILKREGF
FT                   VKNVEIIEDDKQGVIRVFLKYGPNGEKVITNLKRVSKPGLRVYKKREDLPKVLNGLGIA
FT                   ILSTSEGLLTDKEARQKNVGGEVIAYVW"
FT   gene            239243..239779
FT                   /locus_tag="SPAP_0273"
FT   CDS_pept        239243..239779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0273"
FT                   /product="hypothetical protein"
FT                   /note="Operon 115 Gene 11 protein supported
FT                   gi|148996647|ref|ZP_01824365.1| 50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83866"
FT                   /protein_id="ADM83866.1"
FT                   /translation="MSRIGNKVIVLPAGVELTNNDNVVTVKGPKGELTREFSKDIEIRV
FT                   EGTEVTLHRPNDSKEMKTIHGTTRALLNNMVVGVSEGFKKELEMRGVGYRAQLQGSKLV
FT                   LAVGKSHPDEVEAPEGITFELPNPTTIVVSGISKEVVGQTAAYVRSLRSPEPYKGKGIR
FT                   YVGEFVRRKEGKTGK"
FT   gene            239824..240219
FT                   /locus_tag="SPAP_0274"
FT   CDS_pept        239824..240219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0274"
FT                   /product="hypothetical protein"
FT                   /note="Operon 115 Gene 12 protein supported
FT                   gi|182683204|ref|YP_001834951.1| 50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83867"
FT                   /protein_id="ADM83867.1"
FT                   /translation="MHSTRFKTKEVKTVISKPDKNKLRQKRHRRVRGKLSGTADRPRLN
FT                   VFRSNTGIYAQVIDDVAGVTLASASTLDKEVSKGTKTEQAVAVGKLVAERANAKGISEV
FT                   VFDRGGYLYHGRVKALADAARENGLKF"
FT   gene            240237..240731
FT                   /locus_tag="SPAP_0275"
FT   CDS_pept        240237..240731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0275"
FT                   /product="hypothetical protein"
FT                   /note="Operon 115 Gene 13 protein supported
FT                   gi|15900163|ref|NP_344767.1| 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83868"
FT                   /protein_id="ADM83868.1"
FT                   /translation="MAFKDNAVELEERVVAVNRVTKVVKGGRRLRFAALVVVGDHNGRV
FT                   GFGTGKAQEVPEAIRKAVDDAKKNLIEVPMVGTTIPHEVLSEFGGAKVLLKPAVEGSGV
FT                   AAGGAVRAVVELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEIAALRGISVSDL
FT                   A"
FT   gene            240703..240927
FT                   /locus_tag="SPAP_0276"
FT   CDS_pept        240703..240927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0276"
FT                   /product="hypothetical protein"
FT                   /note="Operon 115 Gene 14 protein supported
FT                   gi|182683206|ref|YP_001834953.1| 50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83869"
FT                   /protein_id="ADM83869.1"
FT                   /translation="MVFQFLIWHKKGDKMAQIKITLTKSPIGRIPSQRKTVVALGLGKL
FT                   NSFVIKEDNAAIRGMITAVSHLVTVEEVN"
FT   gene            241072..241512
FT                   /locus_tag="SPAP_0277"
FT   CDS_pept        241072..241512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0277"
FT                   /product="hypothetical protein"
FT                   /note="Operon 115 Gene 15 protein supported
FT                   gi|15900165|ref|NP_344769.1| 50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83870"
FT                   /protein_id="ADM83870.1"
FT                   /translation="MKLHELKPAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINAKEYAIVNLDQLNVFEDGAEVTPVVLIEAGIVKA
FT                   EKSGIKILGNGELTKKLTVKAAKFSKSAEEAITAKGGSVEVI"
FT   gene            241525..242835
FT                   /locus_tag="SPAP_0278"
FT   CDS_pept        241525..242835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0278"
FT                   /product="Preprotein translocase subunit SecY"
FT                   /note="Operon 115 Gene 16 COG0201 Preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83871"
FT                   /protein_id="ADM83871.1"
FT                   /translation="MFFKLLREALKVKQVRSKILFTIFIVLVFRIGTSITVPGVNANSL
FT                   NALSGLSFLNMLSLVSGNALKNFSIFALGVSPYITASIVVQLLQMDILPKFVEWGKQGE
FT                   VGRRKLNQATRYIALVLAFVQSIGITAGFNTLAGAQLIKTALTPQVFLTIGIILTAGSM
FT                   IVTWLGEQITDKGYGNGVSMIIFAGIVSSIPEMIQGIYVDYFVNVPSSRITSSIIFVII
FT                   LIITVLLIIYFTTYVQQAEYKIPIQYTKVAQGAPSSSYLPLKVNPAGVIPVIFASSITA
FT                   APAAILQFLSATGHDWAWVRVAQEMLATTSPTGIAMYALLIILFTFFYTFVQINPEKAA
FT                   ESLQKSGAYIHGVRPGKGTEEYMSKLLRRLATVGSLFLGVISILPIAAKDVFGLSDVVA
FT                   FGGTSLLIIISTGIEGIKQLEGYLLKRKYVGFMDRTE"
FT   gene            242986..243624
FT                   /locus_tag="SPAP_0279"
FT   CDS_pept        242986..243624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0279"
FT                   /product="Adenylate kinase-like kinase"
FT                   /note="Operon 115 Gene 17 COG0563 Adenylate kinase and
FT                   related kinases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83872"
FT                   /protein_id="ADM83872.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEQFHVAHISTGDMFRAAMANQTEM
FT                   GVLAKSYIDKGELVPDEVTNGIVKERLSQDDIKETGFLLDGYPRTIEQAQALDKTLAEL
FT                   GIELEGVINIEVNPNSLLERLSGRIIHRVTGETFHKVFNPPVDYKEEDYYQREDDKPET
FT                   VKRRLDVNIAQGEPIIAHYRAKGLVHDIEGNQDINDVFSDIEKVLTNLK"
FT   gene            243741..243959
FT                   /locus_tag="SPAP_0280"
FT   CDS_pept        243741..243959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0280"
FT                   /product="hypothetical protein"
FT                   /note="Operon 116 Gene 1 protein supported
FT                   gi|15900168|ref|NP_344772.1| translation initiation factor
FT                   IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83873"
FT                   /protein_id="ADM83873.1"
FT                   /translation="MAKDDVIEVEGKVVDTMPNAMFTVELENGHQILATVSGKIRKNYI
FT                   RILAGDRVTVEMSPYDLTRGRITYRFK"
FT   gene            243984..244100
FT                   /locus_tag="SPAP_0281"
FT   CDS_pept        243984..244100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0281"
FT                   /product="Ribosomal protein L36"
FT                   /note="Operon 116 Gene 2 COG0257 Ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83874"
FT                   /protein_id="ADM83874.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG"
FT   gene            244118..244483
FT                   /locus_tag="SPAP_0282"
FT   CDS_pept        244118..244483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0282"
FT                   /product="hypothetical protein"
FT                   /note="Operon 116 Gene 3 protein supported
FT                   gi|15900170|ref|NP_344774.1| 30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83875"
FT                   /protein_id="ADM83875.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDVRV
FT                   RDLTSDQEDAIRREVDAIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   gene            244501..244884
FT                   /locus_tag="SPAP_0283"
FT   CDS_pept        244501..244884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0283"
FT                   /product="hypothetical protein"
FT                   /note="Operon 116 Gene 4 protein supported
FT                   gi|15900171|ref|NP_344775.1| 30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83876"
FT                   /protein_id="ADM83876.1"
FT                   /translation="MAKPTRKRRVKKNIESGIAHIHATFNNTIVMITDVHGNAIAWSSA
FT                   GALGFKGSRKSTPFAAQMASEAAAKSAQEHGLKSVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   gene            244927..245862
FT                   /locus_tag="SPAP_0284"
FT   CDS_pept        244927..245862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0284"
FT                   /product="DNA-directed RNA polymerase, alpha subunit/40 kD
FT                   subunit"
FT                   /note="Operon 116 Gene 5 COG0202 DNA-directed RNA
FT                   polymerase, alpha subunit/40 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83877"
FT                   /protein_id="ADM83877.1"
FT                   /translation="MIEFEKPNITKIDENKDYGKFVIEPLERGYGTTLGNSLRRVLLAS
FT                   LPGAAVTSINIDGVLHEFDTVPGVREDVMQIILNIKGIAVKSYVEDEKIIELDVEGPAE
FT                   VTAGDILTDSDIEIVNPDHYLFTIGEGSSLKATMTVNSGRGYVPADENKKDNAPVGTLA
FT                   VDSIYTPVTKVNYQVEPARVGSNDGFDKLTLEILTNGTIIPEDALGLSARILTEHLDLF
FT                   TNLTEIAKSTEVMKEADTESDDRILDRTIEELDLSVRSYNCLKRAGINTVHDLTEKSEA
FT                   EMMKVRNLGRKSLEEVKLKLIDLGLGLKDK"
FT   gene            245874..246260
FT                   /locus_tag="SPAP_0285"
FT   CDS_pept        245874..246260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0285"
FT                   /product="hypothetical protein"
FT                   /note="Operon 116 Gene 6 protein supported
FT                   gi|15902260|ref|NP_357810.1| 50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83878"
FT                   /protein_id="ADM83878.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAFVRNEIASENYDEATDKYTSTTALQKLFSEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   gene            246525..246791
FT                   /locus_tag="SPAP_0286"
FT   CDS_pept        246525..246791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0286"
FT                   /product="ACT domain-containing protein"
FT                   /note="Operon 117 Gene 1 COG3830 ACT domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83879"
FT                   /protein_id="ADM83879.1"
FT                   /translation="MKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTMM
FT                   AIVSSDEKQDFTYLRNEFEAFGQALNVKINIQSAAIFEAMYNI"
FT   gene            246801..248138
FT                   /locus_tag="SPAP_0287"
FT   CDS_pept        246801..248138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0287"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="Operon 117 Gene 2 COG2848 Uncharacterized conserved
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83880"
FT                   /protein_id="ADM83880.1"
FT                   /translation="MDIRQVTETIAMIEEQNFDIRTITMGISLLDCIDPDINRAAEKIY
FT                   QKITTKAANLVAVGDEIAAELGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAK
FT                   EIGVDFIGGFSALVQKGYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINMTAVAD
FT                   MGRIIKETANLSDMGVAKLVVFANAVEDNPFMAGAFHGVGEADVIINVGVSGPGVVKRA
FT                   LEKVRGQSFDVVAETVKKTAFKITRIGQLVGQMASERLGVEFGIVDLSLAPTPAVGDSV
FT                   ARVLEEMGLETVGTHGTTAALALLNDQVKKGGVMACNQVGGLSGAFIPVSEDEGMIDAV
FT                   QNGSLNLEKLEAMTAICSVGLDMIAIPEDTPAETIAAMIADEAAIGVINMKTTAVRIIP
FT                   KGREGDMIEFGGLLGTAPVMKVNGASSVDFISRGGQIPAPIHSFKN"
FT   gene            248382..249074
FT                   /locus_tag="SPAP_0288"
FT   CDS_pept        248382..249074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0288"
FT                   /product="Fructose-2,6-bisphosphatase"
FT                   /note="Operon 118 Gene 1 COG0406
FT                   Fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83881"
FT                   /protein_id="ADM83881.1"
FT                   /translation="MVKVRLYLVRHGKTMFNTIGRAQGWSDTPLTAEGERGIQELGIGL
FT                   RESDLQFERAYSSDSGRTIQTMGIILEELGLQGKIPYRMDKRIREWCFGSFDGAYDGDL
FT                   FMGIIPRIFNVDHVHQLSYAELAEGLVEVDTAGWAEGWEKLSGRIKEGFEMIAKEMEDQ
FT                   GGGNALVVSHGMTIGTIVYLINGMHPHGLDNGSVTILEYEDGQFRVEVVGDRSYRELGR
FT                   EKMEEGSI"
FT   gene            complement(249177..250199)
FT                   /locus_tag="SPAP_0289"
FT   CDS_pept        complement(249177..250199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0289"
FT                   /product="ABC-type Fe3+ transport system, permease
FT                   component"
FT                   /note="Operon 119 Gene 1 COG1178 ABC-type Fe3+ transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83882"
FT                   /protein_id="ADM83882.1"
FT                   /translation="MRAFSDFGTPMLIGEGYRTFPVLIYTQFISEVGGNSAFAIMAIII
FT                   ALAIFLIQKHIANRYSFSMNLLHPIEPKKTTKGKIAAIYATVYGIIFISVLPQIYLIYT
FT                   SFLKTSGMVSVKGYSPNSYKVAFHRMGSAIFNTIRIPLIALVLVVLFATFISYLAVRKR
FT                   NLFTNLIDSLSMVPYIVPGTVLGIAFISSFNTGLFGSGFLMITGTAFILIMSLSVRRLP
FT                   YTIRSSVASLQQIAPSIEEAAESLGSSRLNTFAKITTPMMLSGIISGAILSWVTMISKL
FT                   STSILLYNVKTRTMTVAIYTEVLRGNYGVAAALSTILTVLTVGSLLLFMKISKSNSITL
FT                   "
FT   gene            complement(250196..250564)
FT                   /locus_tag="SPAP_0290"
FT   CDS_pept        complement(250196..250564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0290"
FT                   /product="ABC-type Fe3+ transport system, permease
FT                   component"
FT                   /note="Operon 119 Gene 2 COG1178 ABC-type Fe3+ transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83883"
FT                   /protein_id="ADM83883.1"
FT                   /translation="MYDFKGEKFLQILIIIASMSAPFVGAYSWVLLLGRNGVITKFLTN
FT                   ALHLPAIDIYGFKGIVLVFTLQLFPLVFLYVAGTMNSIDNSLLEAAESMGSFGFKPIVT
FT                   VVLPLLVPTLLAAPCLYL"
FT   gene            complement(250812..251762)
FT                   /locus_tag="SPAP_0291"
FT   CDS_pept        complement(250812..251762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0291"
FT                   /product="ABC-type spermidine/putrescine transport systems,
FT                   ATPase component"
FT                   /note="Operon 119 Gene 3 COG3842 ABC-type
FT                   spermidine/putrescine transport systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83884"
FT                   /protein_id="ADM83884.1"
FT                   /translation="MIAGFNSIKDGEFYFDDTKINNMEPSKRNIGMVFQNYAIFPHLTV
FT                   RDNVAFGLMQKKVPKEELIQQTNKYLELMQIAQYADRKPDKLSGGQQQRVTLACALAVN
FT                   PSVLLMDEPLSNLEAKLRLDMRQAIREIQHEVGITTVYVTHDQEEAMAISDQIAVMKDG
FT                   VIQQIGRPKELYHKPANEFVATFIGRTNIIPANLEKRSDGAYIVFSDGYALRMPALDQV
FT                   EEQAIHVSIRPEEFIKDESGDIEGTISDSVYLGLNTEYFIETGFASKIQVSEESTFEED
FT                   LQKGNRIRLRINTQKLNIFSADGSQNLIKGVNHGT"
FT   gene            complement(251915..252931)
FT                   /locus_tag="SPAP_0292"
FT   CDS_pept        complement(251915..252931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0292"
FT                   /product="ABC-type Fe3+ transport system, periplasmic
FT                   component"
FT                   /note="Operon 119 Gene 4 COG1840 ABC-type Fe3+ transport
FT                   system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83885"
FT                   /protein_id="ADM83885.1"
FT                   /translation="MKKKWMYYAACSSNESADDSSSDKGDGGSLVVYSPNSEGLIGATI
FT                   PAFEEKYGIKVELIQAGTGELFKKLESEKEVPVADVIFGGSYTQYTTHGELFENYTSKE
FT                   NDNVIKEYQNTTGYSTPYTLDGSVLIVNPDLTKGMNIEGYNDLFKPELKGKIATADPAN
FT                   SSSAFAQLTNMLQAQGGYKDDKAWSYVKDLFTLIDGKIGLSSSGVYKAVADGEMTVGLS
FT                   YEDPAVKLLNDGANIKVVYPKEGTVFLPASAAIVKKSKNMENAKKFIDFIISQEVQDTL
FT                   GTTTTNRPVRKNAKTSENMKPIDKIKTLTEDYDYVIKNKSDIVKKYNEVFTDIQSKQ"
FT   gene            complement(253148..253345)
FT                   /locus_tag="SPAP_0293"
FT   CDS_pept        complement(253148..253345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0293"
FT                   /product="hypothetical protein"
FT                   /note="Operon 120 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83886"
FT                   /protein_id="ADM83886.1"
FT                   /translation="MTLNEYILQYRLKQAIDKMAESPNSPLSAISDQVGFSDYKYFAKV
FT                   FKKYLHISPKKLKSLGRIVK"
FT   gene            complement(253420..254196)
FT                   /locus_tag="SPAP_0294"
FT   CDS_pept        complement(253420..254196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0294"
FT                   /product="Pyruvate-formate lyase-activating enzyme"
FT                   /note="Operon 120 Gene 2 COG1180 Pyruvate-formate
FT                   lyase-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83887"
FT                   /protein_id="ADM83887.1"
FT                   /translation="MEISKGIIFNIQHFSIHDGPGIRTTVFLKGCPLRCPWCSNPESQR
FT                   MKPEKMKDAQREKFTLVGEEKTVEEIITEVLKDKEFYEESGGGLTLSGGEIFAQFEFAK
FT                   AILKSAKEHHIHTAIETTAFVDHEKFIDLIQYVDFIYTDLKHYNSIKHKKVTGVFNQMI
FT                   IKNIHYAFSQNKTIVLRIPVIPNFNNSLEDAEKFATLFNSLNIDQVQLLPFHQFGENKY
FT                   RLLNRKYEMDGVNALHPEDLIDYQKVFLNHHINCYF"
FT   gene            254318..255064
FT                   /locus_tag="SPAP_0295"
FT   CDS_pept        254318..255064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0295"
FT                   /product="Transcriptional regulators of sugar metabolism"
FT                   /note="Operon 121 Gene 1 COG1349 Transcriptional regulators
FT                   of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83888"
FT                   /protein_id="ADM83888.1"
FT                   /translation="MKRLEQIIKLVSEYEKIDVNTLSEKLNVSKVTIRKDLDKLESKGL
FT                   LHREHGYAVLNSGDDLNVRLSINYEIKRKIVQEAVKLVSDNETIMIESGSTCALLAEEI
FT                   CKQKRNVTIVTNSFFIANFVRAYDSCRIIVLGGEFQKDSQVTVGPLLKEMIQTFHVRQA
FT                   FVGTDGYDKEMGFTGKDLMRSEVVQYISAASDKVIVLTDSSKFDKRGTVRRFALSQVYE
FT                   VITDEKLSKQNIATLENAGIMVKVVS"
FT   gene            255077..256057
FT                   /locus_tag="SPAP_0296"
FT   CDS_pept        255077..256057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0296"
FT                   /product="Transcriptional regulator, contains sigma
FT                   factor-related N-terminal domain"
FT                   /note="Operon 121 Gene 2 COG2390 Transcriptional regulator,
FT                   contains sigma factor-related N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83889"
FT                   /protein_id="ADM83889.1"
FT                   /translation="MNQDRNKLLSKIAYLYYIENLNQSQIAAKLGIYRTSISRMLTEAR
FT                   NAGIVKIEIENFDTNMFKLENYVKEKYGLESLEIIPNEFDDNPTILSERISQVAVGVLR
FT                   NLIDDNMKIGFSWGKSLSNLVDLIHSKSVRNVHFYPLAGGPSHIHAKYHVNTLIYEMSR
FT                   KFHGECTFMNATIVQENKLLADGILQSRYFENLKNSWKDLDIAVVGIGDFSNKGKHQWL
FT                   DMLTEDDFKELTKVKTVGEICCRFFDSKGKEVYENLQERTIAISLEDLKNIPQSLAVAY
FT                   GDTKVSSILSVLRANLVNHLITDKNTILKVLEEDGDLTFREILGE"
FT   gene            256252..256572
FT                   /locus_tag="SPAP_0297"
FT   CDS_pept        256252..256572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0297"
FT                   /product="Phosphotransferase system cellobiose-specific
FT                   component IIA"
FT                   /note="Operon 122 Gene 1 COG1447 Phosphotransferase system
FT                   cellobiose-specific component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83890"
FT                   /protein_id="ADM83890.1"
FT                   /translation="MEIIVPDQIIMGLILYAGDAKQHIYKALDYIKNGTCERCEEEIQL
FT                   ADAALLEAHNLQTKFLAQEASGTKTEITALFVHSQDHLMTSMTEINLIKEIISLRKELH
FT                   KK"
FT   gene            256618..256926
FT                   /locus_tag="SPAP_0298"
FT   CDS_pept        256618..256926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0298"
FT                   /product="Phosphotransferase system cellobiose-specific
FT                   component IIB"
FT                   /note="Operon 122 Gene 2 COG1440 Phosphotransferase system
FT                   cellobiose-specific component IIB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83891"
FT                   /protein_id="ADM83891.1"
FT                   /translation="MVKIGLFCAAGFSTGMLVNNMKIAAQSSGVEAEIEAFSQSKLADY
FT                   APNIDVALLGPQVAYTLDKSKEICDKCDVPIAVIPMMDYGMLDGKKVLDLALSLISG"
FT   gene            256943..258241
FT                   /locus_tag="SPAP_0299"
FT   CDS_pept        256943..258241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0299"
FT                   /product="Phosphotransferase system cellobiose-specific
FT                   component IIC"
FT                   /note="Operon 122 Gene 3 COG1455 Phosphotransferase system
FT                   cellobiose-specific component IIC"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83892"
FT                   /protein_id="ADM83892.1"
FT                   /translation="MAKMDVQKIIAPMMKFVNMRGIIALKDGMLAILPLTVVGSLFLIM
FT                   GQLPFEGLNKSIASVFGANWTEPFMQVYSGTFAIMGLISCFSIAYSYAKNSGVEALPAG
FT                   VLSVSAFFILLRSSYIPKQGEAIGDAISKVWFGGQGIIGAIIIGLVVGSIYTFFIKRKI
FT                   VIKMPEQVPQAIAKQFEAMIPAFVIFLSSMIVYILAKSMTNGGTFIEMIYSAIQVPLQG
FT                   LTGSLYGAIGIAFFISFLWWFGVHGQSVVNGVVTALLLSNLDANKAMLASGNLSLENGA
FT                   HIVTQQFLDSFLILSGSGITFGLVVAMLFVAKSKQYQALGKVAAFPAIFNVNEPVVFGF
FT                   PIVMNPVMFVPFILVPVLAAVIVYGAIATGFMQPFSGVTLPWSTPAILSGFLVGGWQGV
FT                   VTQLLVLAMSTMVYFPFFKIQDRLAYQNEIKQS"
FT   gene            258392..260830
FT                   /locus_tag="SPAP_0300"
FT   CDS_pept        258392..260830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0300"
FT                   /product="Pyruvate-formate lyase"
FT                   /note="Operon 123 Gene 1 COG1882 Pyruvate-formate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83893"
FT                   /protein_id="ADM83893.1"
FT                   /translation="MVNTEVARTTIKTEYFGSLTERMNKYREDVLNKKPYIDAERAVLA
FT                   TRTYERYKEQPNVLKRAYMLKEILENMTIYIEEESMIAGNQASSNKDAPIFPEYTLEFV
FT                   LNELDLFEKRDGDVFYITEETKEQLRSIAPFWENNNLRARAGALLPEEVSVYMETGFFG
FT                   MEGKMNSGDAHLAVNYQKLLQFGLRGFEERARKAKAALDLTDPASIDKYHFYDSIFIVI
FT                   DAIKVYAKRFVALAKSLAENANPKRKKELLEIADICSRVPYEPATTFAEAIQSVWFIQC
FT                   ILQIESNGHSLSYGRFDQYMYPYMKADLESGKETEDSIVERLTNLWIKTITINKVRSQS
FT                   HTFSSAGSPLYQNVTIGGQTRDKKDAVNPLSYLVLKSVAQTHLPQPNLTVRYHAGLDAR
FT                   FMNECIEVMKLGFGMPAFNNDEIIIPSFIAKGVLEDDAYDYSAIGCVETAVPGKWGYRC
FT                   TGMSYMNFPKVLLITMNDGIDPASGKRFAPSFGHFKDMKNFSELENAWDKTLRYLTRMS
FT                   VIVENSIDLSLEREVPDILCSALTDDCIGRGKHLKEGGAVYDYISGLQVGIANLSDSLA
FT                   AIKKLVFEEERISPSQLWHALETDYAGEEGKVIQEMLIHDAPKYGNDDDYADKLVTAAY
FT                   DIYVDEIAKYPNTRYGRGPIGGIRYSGTSSISANVGQGRGTLATPDGRNAGTPLAEGCS
FT                   PSHNMDQHGPTSVLKSVSKLPTDEIVGGVLLNQKVNPQTLAKEEDKLKLIALLRTFFNR
FT                   LHGYHIQYNVVSRETLIDAQKHPEKHRDLIVRVAGYSAFFNVLSKATQDDIIGRTEHTL
FT                   "
FT   gene            260849..261517
FT                   /locus_tag="SPAP_0301"
FT   CDS_pept        260849..261517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0301"
FT                   /product="Transaldolase"
FT                   /note="Operon 123 Gene 2 COG0176 Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83894"
FT                   /protein_id="ADM83894.1"
FT                   /translation="MEFMLDTLNLDEIKKWSEILPLAGVTSNPTIAKREGSINFFERIK
FT                   DVRELIGSTPSIHVQVISQDFEGILKDAHEIRRQAGDDIFIKVPVTPAGLRAIKVLKKE
FT                   GYHITATAIYTVIQGLLAIEAGADYLAPYYNRMENLNIDSNSVIRQLVLAIDRQNSPSK
FT                   ILAASFKNVAQVNNALAAGAHAVTAGADVFESAFAMPSIQKAVDDFSDDWFVTQNSRSI
FT                   "
FT   gene            261535..262623
FT                   /locus_tag="SPAP_0302"
FT   CDS_pept        261535..262623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0302"
FT                   /product="Glycerol dehydrogenase-like enzyme"
FT                   /note="Operon 123 Gene 3 COG0371 Glycerol dehydrogenase and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83895"
FT                   /protein_id="ADM83895.1"
FT                   /translation="MRIFASPSRYIQGENALFENAKSILDLGNYPILLCDQLVYDIVGK
FT                   RFEDYLHRYGFHIVLALFNGEASDNEINRVVALAEKENCDSIIGLGGGKTIDSAKAIAD
FT                   LIEKPVIIAPTIASTDAPVSALSVIYTDEGAFDHYLFYSKNPDLVLVDTKVISQAPKRL
FT                   LASGIADGLATWVEARAVMQANGKTMLGQQQTLAGVAIAKKCEETLFADGLQAMAACEA
FT                   KVVTPALENIVEANTLLSGLGFESGGLAAAHAIHNGFTALTGDIHHLTHGEKVAYGTLV
FT                   QLLLENRPKEELDKYIEFYKKIGMPTTLKEMHLDQVGYDDLIKVGKQATMEGETIHQMP
FT                   FKISPSDVAQAIIAVDAYVNSK"
FT   gene            263078..265579
FT                   /locus_tag="SPAP_0303"
FT   CDS_pept        263078..265579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0303"
FT                   /product="Leucyl-tRNA synthetase"
FT                   /note="Operon 124 Gene 1 COG0495 Leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83896"
FT                   /protein_id="ADM83896.1"
FT                   /translation="MSFYNHKEIEPKWQGYWAEHHTFKTGTDASKPKFYALDMFPYPSG
FT                   AGLHVGHPEGYTATDILSRYKRAQGYNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTSEN
FT                   IANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYEKGLAYEAEVPVNWVEELG
FT                   TAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITAYAERLLNDLDELDWSESIKDMQRN
FT                   WIGKSTGANVTFKVKGTDKEFTVFTTRPDTLFGATFTVLAPEHELVDAITSSEQAEAVV
FT                   DYKHQASLKSDLARTDLAKEKTGVWTGAYAINPVNGKEMPIWIADYVLASYGTGAVMAV
FT                   PAHDQRDWEFAKQFDLPIVEVLEGGNVEEAAYTEDGLHVNSDFLDGLNKEDAIAKIVAC
FT                   LEEKGCGQEKVTYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPETELPLVLPVTKDIR
FT                   PSGTGESPLANLTDWLEVTREDGVKGRRETNTMPQWAGSSWYYLRYIDPHNTEKLADED
FT                   LLKQWLPVDIYVGGAEHAVLHLLYARFWHKFLYDLGVVPTKEPFQKLFNQGMILGTSYR
FT                   DHRGALVATDKVEKRDGSFFHVETGEELEQAPAKMSKSLKNVVNPDDVVEQYGADTLRV
FT                   YEMFMGPLDASIAWSEEGLEGSRKFLDRVYRLITSKEILAENNGALDKAYNETVKAVTE
FT                   QIESLKFNTAIAQLMVFVNAANKEDKLYVDYAKGFIQLIAPFAPHLAEELWQTVAETGE
FT                   SISYVAWPTWDESKLVEDEIEIVVQIKGKVRAKLMVAKDLSREELQEIALADEKVKAEI
FT                   DGKEIVKVISVPNKLVNIVVK"
FT   gene            265773..266468
FT                   /locus_tag="SPAP_0304"
FT   CDS_pept        265773..266468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0304"
FT                   /product="hypothetical protein"
FT                   /note="Operon 125 Gene 1 protein supported
FT                   gi|116627318|ref|YP_819937.1| acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83897"
FT                   /protein_id="ADM83897.1"
FT                   /translation="MPVNEYGQMIGESMEGYTPGELPSIDFLEGRYARIEALSVEKHAE
FT                   DLLAVYGPDTPQEMWTYLFQEPVADMGELVSLLHQMLARKDRFYYAIIDKATGKALGSF
FT                   SLMRIDQNNRVIEVGAVTFSPELRGTRIGTEAQYLLARYVFEELNYRRYEWKCDALNLP
FT                   SRRAAERLSFIYEGTFRQAVVYKGRTRDTDWLSMIDKDWPQVKDRLETWLRPENFDKNG
FT                   QQYKSLREL"
FT   gene            266480..266896
FT                   /locus_tag="SPAP_0305"
FT   CDS_pept        266480..266896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0305"
FT                   /product="Histone acetyltransferase HPA2-like
FT                   acetyltransferase"
FT                   /note="Operon 125 Gene 2 COG0454 Histone acetyltransferase
FT                   HPA2 and related acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83898"
FT                   /protein_id="ADM83898.1"
FT                   /translation="MITIKKQEIVKLEDVLHLYQAVGWTNYTHQPEMLEQALSHSLVIY
FT                   LALDGDAVVGLIRLVGDGFSSVLVQDLIVLPIYQRQGIGSALMKEALEDYKDAYQVQLV
FT                   TEETERTLGFYRSMGFEILSTYNCIGMTWMNRKK"
FT   gene            complement(267711..267803)
FT                   /locus_tag="SPAP_0306"
FT   CDS_pept        complement(267711..267803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0306"
FT                   /product="hypothetical protein"
FT                   /note="Operon 126 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83899"
FT                   /protein_id="ADM83899.1"
FT                   /translation="MMELVLKTIIGPIVVGVVLRIVDKWLNKDK"
FT   gene            267937..268935
FT                   /locus_tag="SPAP_0307"
FT   CDS_pept        267937..268935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0307"
FT                   /product="Holliday junction resolvasome, helicase subunit"
FT                   /note="Operon 127 Gene 1 COG2255 Holliday junction
FT                   resolvasome, helicase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83900"
FT                   /protein_id="ADM83900.1"
FT                   /translation="MSRILDNEMMGDEELVERTLRPQYLREYIGQDKVKDQLQIFIEAA
FT                   KMRDEALDHVLLFGPPGLGKTTMAFVIANELGVNLKQTSGPVIEKAGDLVAILNELEPG
FT                   DVLFIDEIHRLPMSVEEVLYSAMEDFYIDIMIGAGEGSRSVHLELPPFTLIGATTRAGM
FT                   LSNPLRARFGITGHMEYYAHADLTEIVERTADIFEMEITHEAASELALRSRGTPRIANR
FT                   LLKRVRDFAQIMGNGVIDDIITDKALTMLDVDHEGLDYVDQKILRTMIEMYSGGPVGLG
FT                   TLSVNIAEERETVEDMYEPYLIQKGFIMRTRSGRVATAKAYEHLGYEYSEK"
FT   gene            268916..269023
FT                   /locus_tag="SPAP_0308"
FT   CDS_pept        268916..269023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0308"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 127 Gene 2 COG3575 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83901"
FT                   /protein_id="ADM83901.1"
FT                   /translation="MNTVKNKQEILEAFRENPDMMAILTIIRDLGLKDS"
FT   gene            269024..269488
FT                   /locus_tag="SPAP_0309"
FT   CDS_pept        269024..269488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0309"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 127 Gene 3 COG3575 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83902"
FT                   /protein_id="ADM83902.1"
FT                   /translation="MAAGSVRNFIWNLLSDKSPFDHETDIDVIFFDPDFSYEETLLLEK
FT                   KLREDFPQYQWELKNQVYMHQHSPHTASYTSSRDAMSKYPERCTAVGLRLNEESDFELY
FT                   APYGLEDILNFQVRPTPHFLENEDRMELYQTRLSKKNWQEKWKNLIFKNT"
FT   gene            269719..270477
FT                   /locus_tag="SPAP_0310"
FT   CDS_pept        269719..270477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0310"
FT                   /product="Undecaprenyl pyrophosphate synthase"
FT                   /note="Operon 128 Gene 1 COG0020 Undecaprenyl pyrophosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83903"
FT                   /protein_id="ADM83903.1"
FT                   /translation="MFGFFKKDKAVEVEVPTQVPAHIGIIMDGNGRWAKKRMQPRVFGH
FT                   KAGMEALQTVTKAANKLGVKVITVYAFSTENWTRPDQEVKFIMNLPVEFYDNYVPELHA
FT                   NNVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQALKLISQD
FT                   VLDAKINPGDITEELIGNYLFTQHLPKDLRDPDLIIRTSGELRLSNFLPWQGAYSELYF
FT                   TDTLWPDFDEAALQEAILAYNRRHRRFGGV"
FT   gene            270486..271289
FT                   /locus_tag="SPAP_0311"
FT   CDS_pept        270486..271289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0311"
FT                   /product="CDP-diglyceride synthetase"
FT                   /note="Operon 128 Gene 2 COG0575 CDP-diglyceride
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83904"
FT                   /protein_id="ADM83904.1"
FT                   /translation="MTQDLQKRTLFAGIALAIFLPILMIGGLLLQIAIGIIAMLAMHEL
FT                   LKMRGLETMTMEGLLTLFATFALTIPLENYLTFLPVDGNVVAYSVLISIMLGTTVFSKS
FT                   YTIEDAVFPLAMSFYVGFGFNALLDARVAGLDKALLALCIVWATDSGAYLVGMNYGKRK
FT                   LAPRVSPNKTLEGALGGILGAILVTIIFMIVDSTVALPYGIYKMSVFAIFFSIAGQFGD
FT                   LLESSIKRHFGVKDSGKFIPGHGGVLDRFDSMLLVFPIMHLFGLF"
FT   gene            271311..272570
FT                   /locus_tag="SPAP_0312"
FT   CDS_pept        271311..272570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0312"
FT                   /product="Predicted membrane-associated Zn-dependent
FT                   proteases 1"
FT                   /note="Operon 128 Gene 3 COG0750 Predicted
FT                   membrane-associated Zn-dependent proteases 1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83905"
FT                   /protein_id="ADM83905.1"
FT                   /translation="MLGILTFILVFGIIVVVHEFGHFYFAKKSGILVREFAIGMGPKIF
FT                   AHIGKDGTAYTIRILPLGGYVRMAGWGDDTTEIKTGTPVSLTLADDGKVKRINLSGKKL
FT                   DQTALPMQVTQFDFEDKLFIKGLVLEEEKTFAVDHDATVVEADGTEVRIAPLDVQYQNA
FT                   TIWGKLITNFAGPMNNFILGVVVFWVLIFMQGGVRDVDTNQFHIMPQGALAKVGVPETA
FT                   QITKIGSHEVSNWESLIQAVETETKDKTAPTLDVTISEKGSDKQVTVTPEDSQGRYLLG
FT                   VQPGVKSDFLSMFVGGFTTAADSALRILSALKNLIFQPDLNKLGGPVAIFKASSDAAKN
FT                   GIENILYFLAMISINIGIFNLIPIPALDGGKIVLNILEAIRRKPLKQEIETYVTLAGVV
FT                   IMVVLMIAVTWNDIMRLFFR"
FT   gene            272583..274436
FT                   /locus_tag="SPAP_0313"
FT   CDS_pept        272583..274436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0313"
FT                   /product="Prolyl-tRNA synthetase"
FT                   /note="Operon 128 Gene 4 COG0442 Prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83906"
FT                   /protein_id="ADM83906.1"
FT                   /translation="MKQSKMPIPTLREMPSDAQVISHALMLRAGYVRQVSAGVYSYLPL
FT                   ANRVIEKAKNIMRQEFEKIGAVEMLAPALLSAELWRESGRYETYGEDLYKLKNREKSDF
FT                   ILGPTHEETFTAIVRDSVKSYKQLPLNLYQIQPKYRDEKRPRNGLLRTREFIMKDAYSF
FT                   HANYDSLDSVYDEYKAAYERIFTRSGLDFKAIIGDGGAMGGKDSQEFMAITSARTDLDR
FT                   WVVLDKSVASFDEIPAEVQEEIKAELLKWIVSGEDTIAYSSESSYAANLEMATNEYKPS
FT                   NRVVAEEEVTRVATPDVKSIDEVAAFLNVPEEQTIKTLFYIADGELVAALLVGNDQLNE
FT                   VKLKNHLGADFFDVASEEEVANVVQAGFGSLGPVGLPENIKIIADRKVQDVRNAVVGAN
FT                   EDGYHLTGVNPGRDFTAEYVDIREVREGEISPDGQGVLNFARGIEIGHIFKLGTRYSAS
FT                   MGADVLDENGRAVPIIMGCYGIGVSRLLSAVMEQHARLFVNKTPKGEYRYAWGINFPKE
FT                   LAPFDVHLITVNVKDEEAQALTEKLEASLMGAGYEVLTDDRNERVGVKFSDSDLIGLPI
FT                   RITVGKKAADGIVEVKIKATGDTIEVHADNVLETLEILSKK"
FT   gene            274536..275915
FT                   /locus_tag="SPAP_0314"
FT   CDS_pept        274536..275915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0314"
FT                   /product="Beta-glucosidase/6-phospho-beta-glucosidase/
FT                   beta-galactosidase"
FT                   /note="Operon 129 Gene 1 COG2723
FT                   Beta-glucosidase/6-phospho-beta-glucosidase/beta-
FT                   galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83907"
FT                   /protein_id="ADM83907.1"
FT                   /translation="MLRFPKDFVWGSSTSGPQTEGRVAGDGKGDNLWDYWFQVEPNRYY
FT                   NGIGSDKTSTFYENWERDIELLLETGHTVFRTSIQWSRIFPQGCGKVNPQGVDFYRKVF
FT                   EAIKAKGIRLLVNLYHFDLPFALQEDGDGWENKATVSAYEDYARFCFETYGDLVDQWIT
FT                   FNEPIVPVEFGYFYDAHYPHKVDAEAAVKVAYHTQLASSRAVKACHELLPDSKIGIVLN
FT                   LTPAYPRSQHPADVKAARIAALFQAQSFLDPSVLGTYPQELVEILHEHGLLPDATEEEL
FT                   ELIHDNTVDFLGVNYYQPLRVMAPRFAKHPESPLLPEHFYEPYVMPGRKINSHRGWEIY
FT                   EQGIYDIAQNIKENYGNIEWMLTENGMGVEGEEKFRQDGMIQDDYRIDFVKGHLRELHR
FT                   AIEDGANCKGYLIWTFIDCWSWLNSYKNRYGLVELDLETQERRLKKSGHWFKKLSDNNG
FT                   F"
FT   gene            276107..277915
FT                   /locus_tag="SPAP_0315"
FT   CDS_pept        276107..277915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0315"
FT                   /product="Glucosamine 6-phosphate synthetase, contains
FT                   amidotransferase and phosphosugar isomerase domains"
FT                   /note="Operon 130 Gene 1 COG0449 Glucosamine 6-phosphate
FT                   synthetase, contains amidotransferase and phosphosugar
FT                   isomerase domains"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83908"
FT                   /protein_id="ADM83908.1"
FT                   /translation="MCGIVGVVGNTNATDILIQGLEKLEYRGYDSAGIFVLDGADNHLV
FT                   KAVGRIAELSAKTAGVEGTTGIGHTRWATHGKPTEDNAHPHRSETERFVLVHNGVIENY
FT                   LEIKEEYLAGHHFKGQTDTEIAVHLIGKFAEEDGLSVLEAFKKALHIIRGSYAFALIDS
FT                   ENPDVIYVAKNKSPLLIGLGEGYNMVCSDAMAMIRETNQYMEIHDQELVIVKADSVEVQ
FT                   DYDGNRRERASYTAELDLSDIGKGTYPYYMLKEIDEQPTVMRKLIQAYTDEAGQVVVDP
FT                   DIIKAVQDADRIYILAAGTSYHAGFASKKMLEELTDTPVELGISSEWGYGMPLLSKKPL
FT                   FIFISQSGETADSRQVLVKANEMGIPSLTVTNVPGSTLSREANYTMLLHAGPEIAVAST
FT                   KAYTAQIAALAFLAKAVGEANGNAKAQAFDLVHELSIVAQSIESTLSEKETIEAKVREL
FT                   LETTRNAFYIGRGQDYYVAMEASLKLKEISYIQCEGFAAGELKHGTIALIEEGTPVLAL
FT                   LSDPVLANHTRGNIQEVAARGAKVLTIAEENVAKDTDDIVLTTVHPYLSPISMVVPTQL
FT                   VAYFATLHRGLDVDKPRNLAKSVTVE"
FT   gene            278186..279235
FT                   /locus_tag="SPAP_0316"
FT   CDS_pept        278186..279235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0316"
FT                   /product="hypothetical protein"
FT                   /note="Operon 131 Gene 1 protein supported
FT                   gi|15900201|ref|NP_344805.1| hypothetical protein SP_0267"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83909"
FT                   /protein_id="ADM83909.1"
FT                   /translation="MVELGISTFGEITELEGTGQTYSHAERIRQLVAEIELADKVGLDV
FT                   YGIGEHHRADFAVSAPEIVLAAGAVNTKKIRLTSAVSILSSMDPIRLFQQYATIDALSN
FT                   GRAEIMAGRGSFTESFPLFGYDLKDYDSLFDEKLDLLQLVNEKTKLDWQGRLTQTIAGK
FT                   EVYPRPVQDKLPLWIATGGHVESTVKIAQAGLPIVYAIIGGNPRYFKKLIQAYREIGSE
FT                   AVHADKDLKVGAHSWGWIAEDGEQAVKDYFHPTKQVVDAISKDRPHWQELRYEQYLEQV
FT                   GSNGAMFVGNPDQVAEKLIRMIEDLGLDRFMLHLPLGSMPHDQVLRAIELFGTQVAPKV
FT                   RAYFAMKEA"
FT   gene            complement(279335..283177)
FT                   /locus_tag="SPAP_0317"
FT   CDS_pept        complement(279335..283177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0317"
FT                   /product="Type II secretory pathway, pullulanase PulA-like
FT                   glycosidase"
FT                   /note="Operon 132 Gene 1 COG1523 Type II secretory pathway,
FT                   pullulanase PulA and related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83910"
FT                   /protein_id="ADM83910.1"
FT                   /translation="MRKTPSHTEKKMVYSIRSLKNGTGSVLIGASLVLLAMATPTISSD
FT                   ESTPTTNEPNNRNTTTLAQPLTDTAAGSGKNESDISSPGNANASLEKTEEKPAASPADP
FT                   APQTGQDRSSEPTTSTSPVTTETKAEEPIEDNYFRIHVKKLPEENKDAQGLWTWDDVEK
FT                   PSENWPNGALSFKDAKKDDYGYYLDVKLKGEQAKKISFLINNTAGKNLTGDKSVEKLVP
FT                   KMNEAWLDQDYKVFSYEPQPAGTVRVNYYRTDGNYDKKSLWYWGDVKNPSSAQWPDGTD
FT                   FTATGKYGRYIDIPLNEAAREFGFLLLDESKQGDDVKIRKENYKFTDLKNHSQIFLKDD
FT                   DESIYTNPYYVHDIRMTGAQHVGTSSIESSFSTLVGAKKEDILKHSNITNHLGNKVTIT
FT                   DVAIDEAGKKVTYSGDFSDTKHPYTVSYNSDQFTTKTSWRLKDETYSYDGKLGADLKEE
FT                   GKQVDLTLWSPSADKVSVVVYDKNDPDKVVGTVALEKGERGTWKQTLDSTNKLGITDFT
FT                   GYYYQYQIERQGKTVLALDPYAKSLAAWNSDDSKIDDAHKVAKAAFVDPAKLGPQDLTY
FT                   GKIHNFKTREDAVIYEAHVRDFTSDPAIAKDLTKPFGTFEAFIEKLDYLKDLGVTHIQL
FT                   LPVLSYYFVNELKNHERLSDYASSNSNYNWGYDPQNYFSLTGMYSSDPKNPEKRIAEFK
FT                   NLINEIHKRGMGAILDVVYNHTAKVDLFEDLEPNYYHFMDADGTPRTSFGGGRLGTTHH
FT                   MTKRLLIDSIKYLVDTYKVDGFRFDMMGDHDAASIEEAYKAARALNPNLIMLGEGWRTY
FT                   AGDENMPTKAADQDWMKHTDTVAVFSDDIRNNLKSGYPNEGQPAFITGGKRDVNTIFKN
FT                   LIAQPTNFEADSPGDVIQYIAAHDNLTLFDIIAQSIKKDPSKAENYAEIHRRLRLGNLM
FT                   VLTAQGTPFIHSGQEYGRTKQFRDPAYKTPVAEDKVPNKSHLLRDKDGNPFDYPYFIHD
FT                   SYDSSDAVNKFDWTKATDGKAYPENVKSRDYMKGLIALRQSTDAFRLKSLQDIKDRVHL
FT                   ITVPGQNGVEKEDVVIGYQITAPNGDIYAVFVNADEKAREFNLGTAFAHLRNAEVLADE
FT                   NQAGSVGIANPKGLEWTEKGLKLNALTATVLRVSQNGTSHESTAEEKPDSTPSKPEHQN
FT                   EASHPEHQDPAPEARPDSTKPDTKVADAENKPSQATADSQAEQPAQEAQASSVKEAVRN
FT                   ESVENSSKKNIPATPDRQAELPNTGIKNENKLLFAGISLLALLGLGFLLKNKKEN"
FT   gene            283594..284007
FT                   /locus_tag="SPAP_0318"
FT   CDS_pept        283594..284007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0318"
FT                   /product="hypothetical protein"
FT                   /note="Operon 133 Gene 1 protein supported
FT                   gi|15900205|ref|NP_344809.1| 30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83911"
FT                   /protein_id="ADM83911.1"
FT                   /translation="MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLP
FT                   GVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA"
FT   gene            284027..284497
FT                   /locus_tag="SPAP_0319"
FT   CDS_pept        284027..284497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0319"
FT                   /product="hypothetical protein"
FT                   /note="Operon 133 Gene 2 protein supported
FT                   gi|15902293|ref|NP_357843.1| 30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83912"
FT                   /protein_id="ADM83912.1"
FT                   /translation="MSRKNRAPKRDVLPDPLYNSQLVTRLINRVMLDGKRGTAASIVYG
FT                   AFEQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VTIARLRGEHTMQDRLAKEILDAANNTGAAVKKREDTHRMAEANRAFAHFRW"
FT   gene            284922..287003
FT                   /locus_tag="SPAP_0320"
FT   CDS_pept        284922..287003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0320"
FT                   /product="translation elongation factor"
FT                   /note="Operon 133 Gene 3 COG0480 Translation elongation
FT                   factors (GTPases)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83913"
FT                   /protein_id="ADM83913.1"
FT                   /translation="MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHDRLQANAHPIQ
FT                   LPIGSEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLDQAQEYREKLIEAVAETD
FT                   EELMMKYLEGEEITNEELKAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSP
FT                   LDIPAIKGINPDTDAEEIRPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLQSGSYV
FT                   LNTSKGKRERIGRILQMHANSRQEIDTVYSGDIAAAVGLKDTTTGDSLTDEKAKIILES
FT                   INVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVISGMGELHLD
FT                   VLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPMVDVKAKLYDGSYHDVDSS
FT                   ETAFKIAASLSLKEAAKSAQPAILEPMMLVTITVPEENLGDVMGHVTARRGRVDGMEAH
FT                   GNSQIVRAYVPLAEMFGYATVLRSASQGRGTFMMVFDHYEDVPKSVQEEIIKKNKGED"
FT   gene            287107..291498
FT                   /locus_tag="SPAP_0321"
FT   CDS_pept        287107..291498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0321"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /note="Operon 134 Gene 1 COG2176 DNA polymerase III, alpha
FT                   subunit (gram-positive type)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83914"
FT                   /protein_id="ADM83914.1"
FT                   /translation="MSNSFEILMNQLGMPAEMRQAPALAQANIERVVVHKISKVWEFHF
FT                   VFSNILPIEIFLELKKGLSEEFSKTGNKAVFEIKARSQEFSNQLLQSYYREAFSEGPCA
FT                   SQGFKSLYQNLQVRAEGNQLFIEGSEAIDKEHFKKNHLPNLAKQLEKFGFPTFNCQVEK
FT                   NDVLTQEQEEAFHAENEQIVQAANEEALRAMEQLEQMAPPPAEEKPAFDFQAKKAAAKP
FT                   KLDKAEITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVK
FT                   NEEEAQKFDLIKKNSWLRVRGNVEMNNFTRDLTMNVQDLQEVVHYERKDLMPEGERRVE
FT                   FHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKKAGIQLIYG
FT                   MEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAE
FT                   FDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNATFDVGF
FT                   MNANYERHDLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALEHHHMANYDAEA
FT                   TGRLLFIFIKEVAEKHGVTDLARLNIDLISPDSYKKARIKHATIYVKNQVGLKNIFKLV
FT                   SLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAKYYDFI
FT                   EVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYRE
FT                   IIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEELARKLVIENTN
FT                   ALAEIFESVEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSI
FT                   LGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQ
FT                   YSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGED
FT                   QPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKFYRDAEVERLAQGAA
FT                   GVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVL
FT                   GHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVLGVTPEQIGTPTGMLGIPEFG
FT                   TNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMV
FT                   YLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMF
FT                   PKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEVIKRRMEEISE
FT                   KRKNNEASNVEIDLYTTLEIVNEMWERGFKFGKLDLYRSQATEFLIDGDTLIPPFVAMD
FT                   GLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFDE
FT                   LF"
FT   gene            291600..291863
FT                   /locus_tag="SPAP_0322"
FT   CDS_pept        291600..291863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0322"
FT                   /product="DNA-damage-inducible protein J"
FT                   /note="Operon 135 Gene 1 COG3077 DNA-damage-inducible
FT                   protein J"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83915"
FT                   /protein_id="ADM83915.1"
FT                   /translation="MSKMSISIRLDSEVKEQAQQVFSNLGMDMTTAINIFLRQAIQYQG
FT                   LPFDVRLDENRKLLQALTDLDQNRNMSQSFESVSDLMEDLRA"
FT   gene            291856..292134
FT                   /locus_tag="SPAP_0323"
FT   CDS_pept        291856..292134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0323"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 135 Gene 2 COG3041 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83916"
FT                   /protein_id="ADM83916.1"
FT                   /translation="MLKIRYHKQFKKDFKLAMKRGLKAELLEEVLNFLVQEKEHPARYR
FT                   DHSLTASKHFQGVRECHTQPDWLLVYKVDKSELILNLLRTGSHSDLF"
FT   gene            292155..292307
FT                   /locus_tag="SPAP_0324"
FT   CDS_pept        292155..292307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0324"
FT                   /product="hypothetical protein"
FT                   /note="Operon 135 Gene 3 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83917"
FT                   /protein_id="ADM83917.1"
FT                   /translation="MKLRIFAEDKPAKKVFEYQLELADRTILLSTALLSGAIALAGIFS
FT                   ALKEK"
FT   gene            292329..293570
FT                   /locus_tag="SPAP_0325"
FT   CDS_pept        292329..293570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0325"
FT                   /product="Leucyl aminopeptidase (aminopeptidase T)"
FT                   /note="Operon 135 Gene 4 COG2309 Leucyl aminopeptidase
FT                   (aminopeptidase T)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83918"
FT                   /protein_id="ADM83918.1"
FT                   /translation="MVLPNFKENLGKYAKLLVANGINVQPGHTLALSIDVEQRELAHLI
FT                   VKEAYALGAHEVIVQWTDDVINREKFLHAPMERLDNVPEYKIAEMNYLLENKASRLGVR
FT                   SSDPGALNGVDADKLSASAKAMGLAMKPMRIATQSNKVSWTVAAAAGLEWAKKVFPNAA
FT                   SDEEAVDFLWDQIFKTCRVYEADPVKAWEEHAAILKSKADMLNKEQFSALHYTAPGTDL
FT                   TLGLPKNHVWESAGAVNAQGEEFLPNMPTEEVFTAPDFRRADGYVTSTKPLSYNGNIIE
FT                   GIKVTFKDGQIVDITAEKGDQVMKDLVFKNAGARALGECALVPDPSPISQSGITFFNTL
FT                   FDENASNHLAIGAAYATSVVDGAEMSEEELEAAGLNRSDVHVDFMIGSNQMDIDGIRED
FT                   GTRVPLFRNGNWAN"
FT   gene            293580..293810
FT                   /locus_tag="SPAP_0326"
FT   CDS_pept        293580..293810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0326"
FT                   /product="Predicted membrane protein"
FT                   /note="Operon 135 Gene 5 COG2261 Predicted membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83919"
FT                   /protein_id="ADM83919.1"
FT                   /translation="MLGSMFVGLLVGFLAGAMTNRGERMGCFGKMFLGWIGAFLGHLLF
FT                   GTWGPVLSGTAIIPAILGAMIVLAIFWRRGS"
FT   gene            294078..294800
FT                   /locus_tag="SPAP_0327"
FT   CDS_pept        294078..294800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0327"
FT                   /product="16S rRNA uridine-516 pseudouridylate
FT                   synthase-like pseudouridylate synthase"
FT                   /note="Operon 136 Gene 1 COG1187 16S rRNA uridine-516
FT                   pseudouridylate synthase and related pseudouridylate
FT                   synthases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83920"
FT                   /protein_id="ADM83920.1"
FT                   /translation="MRLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEKI
FT                   DEIRFDGQVLEYEEFVYYMMNKPKGVISATEDPKHRTVLDLLDDLARSKEVFPVGRLDI
FT                   DTHGLLLLTNNGQLAHVLLSPKRHVDKTYQAQVKGIMTQEDVETFIKGIPLKDFTCQPA
FT                   RLEILSTDAEKNQSQIRVTIAEGKFHQIKRMVGYCGKEVVDLQRLTMGTLVLDENLERG
FT                   EWRRLTKEELEILRANII"
FT   gene            295017..296351
FT                   /locus_tag="SPAP_0328"
FT   CDS_pept        295017..296351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0328"
FT                   /product="Aminopeptidase C"
FT                   /note="Operon 137 Gene 1 COG3579 Aminopeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83921"
FT                   /protein_id="ADM83921.1"
FT                   /translation="MNAIQESFTDKLFANYEANVKYQAIENAASHNGIFAALECRQSHV
FT                   DNTPVFSLDLTKDKVTNQKASGRCWMFAALNTFRHKLISQYKLENFELSQAHTFFWDKY
FT                   EKSNWFLEQVIATSDQELTSRKVSFLLQTPQQDGGQWDMVVSLFEKYGVVPKSVYPESV
FT                   SSSSSRELNAILNKLLRQDAQILRDLLVSGADQATVQAKKEDLLQEIFNFLAMSLGLPP
FT                   RKFDFAYRDKDNNYKSEKGITPQEFYKKYVNLPLEDYVSVINAPTADKPYGKSYTVEML
FT                   GNVVGSRAVRYINVPMERLKELAIAQMQAGETVWFGSDVGQLSNRKAGILATDVYDFES
FT                   SMDIKLTQDKAGRLDYSESLMTHAMVLTGVDLDENGKSTKWKVENSWGDKVGTDGYFVA
FT                   SDAWMDEYTYQIVVRKELLTAEEQAAYGAEPIVLAPWDPMGALAE"
FT   gene            complement(296407..297318)
FT                   /locus_tag="SPAP_0329"
FT   CDS_pept        complement(296407..297318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0329"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /note="Operon 138 Gene 1 COG3716 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83922"
FT                   /protein_id="ADM83922.1"
FT                   /translation="MTEKLQLTKSDRKKVWWRSTFLQGSWNFERMQNLGWAYTLIPAIK
FT                   KLYTKKEDQIAALERHLEFFNTHPYVAAPVMGVTLALEEERANGVEIDDAAIQGVKIGM
FT                   MGPLAGIGDPVFWFTVRPILGSLGASLALTGNILGPLLFFVAWNLIRMSFLWYVQEIGY
FT                   KAGSEITKDMSGGILQDITKGASILGMFILAVLVQRWVNIKFAFDVSKVQLDEKAYIHW
FT                   DKLPEGSKGIQEAFAQVGQGLSQTPEKVTTFQQNLDMLIPGLSGLLLTLLCMYLLKKKV
FT                   SPITIILALFAVGIVAHVLHIM"
FT   gene            complement(297342..298145)
FT                   /locus_tag="SPAP_0330"
FT   CDS_pept        complement(297342..298145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0330"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /note="Operon 138 Gene 2 COG3715 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83923"
FT                   /protein_id="ADM83923.1"
FT                   /translation="MSIISMVLVVVVAFFAGLEGILDQFQFHQPLVACTLIGLVTGHLE
FT                   AGIILGGSLQMIALGWSNIGAAIAPDAALASVAAAIIMVLGGDFTKTGIGVAQAVAIPL
FT                   AVAGLFLTMIVRTISVGLVHTADAAAKKGDFGAVERAHFIALLFQGLRIALPAALLLMV
FT                   PTETVQSILSAMPDWLKDGMAIGGGMVVAVGYAMVINMMATREVWPFFALGFVLAAVSD
FT                   ITLIGFGAIGVAIALIYLHLSKTGGNGGGGAATSNDPIGDILEDY"
FT   gene            complement(298173..299162)
FT                   /locus_tag="SPAP_0331"
FT   CDS_pept        complement(298173..299162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0331"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /note="Operon 138 Gene 3 COG3444 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83924"
FT                   /protein_id="ADM83924.1"
FT                   /translation="MSIGIIIASHGEFAAGIHQSGSMIFGEQEKVQVVTFMPNEGPDDL
FT                   YAKFNNAVAAFDAEDEVLVLADLWSGSPFNQASRVMGENPERKFAIITGLNLPMLIQAY
FT                   TERLMDAAAGVEKVAANIIKEAKDGIKALPEELNPVEEVASAAAAPVAQTAIPEGTVIG
FT                   DGKLKINLARLDTRLLHGQVATAWTPDSKANRIIVASDNVAKDDLRKELIKQAAPGNVK
FT                   ANVVPIQKLIEISKDPRFGETHALILFETPQDALRAIEGGVPIKTLNVGSMAHSTGKTL
FT                   VNTVLSMDKEDVATFEKMRDLGVEFDVRKVPNDSKKDLFDLINKANVK"
FT   gene            complement(299394..300413)
FT                   /locus_tag="SPAP_0332"
FT   CDS_pept        complement(299394..300413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0332"
FT                   /product="Zn-dependent alcohol dehydrogenase"
FT                   /note="Operon 139 Gene 1 COG1064 Zn-dependent alcohol
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83925"
FT                   /protein_id="ADM83925.1"
FT                   /translation="MKAVVVNPESTGVAIEEKVLRPLETGEALVEVEYCGVCHTDLHVA
FT                   HGDFGQVPGRVLGHEGIGIVKEIAPDVKSLKVGDRVSVAWFFEGCGTCEYCTTGRETLC
FT                   RTVKNAGYSVDGGMAEQCIVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAKVEPG
FT                   QWVVLYGAGGLGNLAVQYAKKVFNAHVIAVDINNDKLTLAKEVGADIVINGLEVEDVAG
FT                   LIKEKTDGGAHSAVVTAVSKVAFNQAVDSIRAGGRVVAVGLPSEMMELSIVKTVLDGIQ
FT                   VIGSLVGTRKDLEEAFQFGAEGLVVPVVQKRPVEDAVAIFDEMEKGQIQGRMVLDFTH"
FT   gene            complement(300752..301564)
FT                   /locus_tag="SPAP_0333"
FT   CDS_pept        complement(300752..301564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0333"
FT                   /product="Predicted hydrolases of the HAD superfamily"
FT                   /note="Operon 140 Gene 1 COG0561 Predicted hydrolases of
FT                   the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83926"
FT                   /protein_id="ADM83926.1"
FT                   /translation="MTKKIIAVDLDGTLLNSDSQISDFTKRTIKKVAEKGHQVIITTGR
FT                   PYRMSKDFYRELGLDTPMINFNGSLTHLPDQVWDFEKCLTVDKKYLLDMVQRSEDIQAD
FT                   FIAGEYRKKFYITNPNEEIANPKLFGVEAFQPEDQFQPELVTKDPNCILLQTRASDKYA
FT                   LAKEMNAFYQHQLSINTWGGPLNILECTPKGVNKAFALDYLLKIMNRDKKDLIAFGDEH
FT                   NDTEMLAFAGKGYAMKNANPELLPYADEQISLTNDQDGVAKTLQDLFL"
FT   gene            301754..303172
FT                   /locus_tag="SPAP_0334"
FT   CDS_pept        301754..303172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0334"
FT                   /product="Permease"
FT                   /note="Operon 141 Gene 1 COG2252 Permeases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83927"
FT                   /protein_id="ADM83927.1"
FT                   /translation="MDKLFKLKENGTDVRTEVLAGLTTFFAMSYILFVNPQILSQTGMP
FT                   AQGVFLATIIGAVAGTLMMAFYANLPYAQAPGMGLNAFFTFTVVFGLGYSWQEALAMVF
FT                   ICGIISLVITLTKVRKMIIESIPNALRSAISAGIGVFLAYVGIKNAGLLKFTIDPGNYT
FT                   VVGEGADKAQATIAANSSAVPGLVSFNNPAVLVALAGLAITIFFVIKGIKGGIILSILT
FT                   TTVLAIAVGLVDLSSIDFANNHVGAAFEDLKTIFGAALGSEGLGALVSDTARLPETLMA
FT                   ILAFSLTDIFDTIGTLIGTGEKVGIVATNGENHQSAKLDKALYSDLIGTTVGAIAGTSN
FT                   VTTYVESAAGIGAGGRTGLTALVVAICFAISSFFSPLLAIVPTAATAPILIIVGIMMLG
FT                   SLKNIHWDDMSEAVPAFFTSIFMGFSYSITQGIAVGFLTYTLTKLVKGQVKDVHAMIWI
FT                   LDALFILNYISMAL"
FT   gene            303225..303932
FT                   /locus_tag="SPAP_0335"
FT   CDS_pept        303225..303932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0335"
FT                   /product="Predicted metal-dependent membrane protease"
FT                   /note="Operon 141 Gene 2 COG1266 Predicted metal-dependent
FT                   membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83928"
FT                   /protein_id="ADM83928.1"
FT                   /translation="MKEKNMWKELLNRAGWILVFLLAVLLYQVPLVVTSILTLKEVALL
FT                   QSGLIVAGLSIVVLALFIMGARKTKLASFNFSFFRAKDLARLGLSYLVIVGSNILGSIL
FT                   LQLSNETTTANQSQINDMVQNSSLISSFFLLALLAPICEEILCRGLVPKKIFRGKENLG
FT                   FVVGTIVFALLHQPSNLPSLLIYGGMSTVLSWTAYKTQRLEMSILLHMIVNGIAFCLLA
FT                   LVVIMSRTLGISV"
FT   gene            304030..305001
FT                   /locus_tag="SPAP_0336"
FT   CDS_pept        304030..305001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0336"
FT                   /product="Dihydropteroate synthase-like enzyme"
FT                   /note="Operon 142 Gene 1 COG0294 Dihydropteroate synthase
FT                   and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83929"
FT                   /protein_id="ADM83929.1"
FT                   /translation="MKILEGVTDMSSKANHAKTVICGIINVTPDSFSDGGQFFALEQAL
FT                   QQARKLIAEGASMLDIGGESTRPGSSYVEIEEEIQRVVPVIKAIRKESDVLISIDTWKS
FT                   QVAEAALAAGADLVNDITGLMGDEKMAHVVAEARAKVVIMFNPVMARPQHPSSLIFPHF
FT                   GFGQTFTEKELADFETLPIEDLMVAFFERALARAAEAGIAPENILLDPGIGFGLTKKEN
FT                   LLLLRDLDKLHQKGYPIFLGVSRKRFVINILEENGFEVNPETELGFRNRDTASAHVTSI
FT                   AARQGVEVVRVHDVASHRMAVEIASTIRLADEAENLDLKQYK"
FT   gene            305003..306325
FT                   /locus_tag="SPAP_0337"
FT   CDS_pept        305003..306325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0337"
FT                   /product="Folylpolyglutamate synthase"
FT                   /note="Operon 142 Gene 2 COG0285 Folylpolyglutamate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83930"
FT                   /protein_id="ADM83930.1"
FT                   /translation="MKEIENNQWIANYRTDQPHFGLERMVELLALRGNPHLKLKVLHIG
FT                   GTNGKGSTIAFLKKMLEKLGLRVGVFSSPYLIHYTDQISINGESISEARLEALMADYQS
FT                   LMGGEAVANLQGTTEFEIITALAYDYFASEQVDVAIMEVGMGGLLDSTNVCQPILTGIT
FT                   TIGLDHVALLGDTLEAIAEQKAGIIKQGMPLVTGRIAPEALAVIDRIAEGKDAPRLAYG
FT                   TDYQVRHQESVVTGEVFDYTSAVRQGRFQTSLLGLYQIENAGMAIALLDTFCQEDGREL
FT                   ASNDFLGQALEEISWPGRLEIVSRDPLMILDGAHNPHAIKALLVTLQERFADYHKEILF
FT                   TCIKTKALEDMLDLLGAMPDTELTLTHFADSRATDESVLKEAAKSRNLSYQDWHDFLEQ
FT                   NLTDKKEEKQTVRIVTGSLYFLSQVRAYLMERKNENGYTKD"
FT   gene            306306..306860
FT                   /locus_tag="SPAP_0338"
FT   CDS_pept        306306..306860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0338"
FT                   /product="GTP cyclohydrolase I"
FT                   /note="Operon 142 Gene 3 COG0302 GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83931"
FT                   /protein_id="ADM83931.1"
FT                   /translation="MDTQKIEAAVKMIIEAVGENANREGLQETPARVARMYQEIFSGLG
FT                   QTAEEHLSKSFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLAR
FT                   TVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTV
FT                   ARGLFETDKDLRDQAYRLMGL"
FT   gene            306903..307715
FT                   /locus_tag="SPAP_0339"
FT   CDS_pept        306903..307715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0339"
FT                   /product="hypothetical protein"
FT                   /note="Operon 142 Gene 4 protein supported
FT                   gi|148994682|ref|ZP_01823786.1| 50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83932"
FT                   /protein_id="ADM83932.1"
FT                   /translation="MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDL
FT                   DLTASVHYGELCQQWTTWFQETSEDLIETVAYKLVERTFESYPLVQEMKLELKKPWAPV
FT                   HLSLDTCSVTIHRRKQRAFIALGSNMGDKQANLKQAIDKLRARGIHILKESSVLATEPW
FT                   GGVEQDSFANQVVEVETWLPAQDLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQI
FT                   LYTDDLILPHPYIAERLFVLESLQEIAPHFIHPILKQPIRNLYDALKK"
FT   gene            complement(307865..308182)
FT                   /locus_tag="SPAP_0340"
FT   CDS_pept        complement(307865..308182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0340"
FT                   /product="hypothetical protein"
FT                   /note="Operon 143 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83933"
FT                   /protein_id="ADM83933.1"
FT                   /translation="MAFTNTHMRSASFGIVTSLPDDIIDSFWYIIDHFLKNVFELEEEL
FT                   EFQLLNNQGKITFHFSSQHLPTAIDFDFNHPFDPRYPPRVLVLDMDGRETILLPEENDL
FT                   F"
FT   gene            308539..308985
FT                   /locus_tag="SPAP_0341"
FT   CDS_pept        308539..308985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0341"
FT                   /product="hypothetical protein"
FT                   /note="Operon 144 Gene 1 protein supported
FT                   gi|15900228|ref|NP_344832.1| 50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83934"
FT                   /protein_id="ADM83934.1"
FT                   /translation="MNKTTFMAKPGQVERKWYVVDATDVPLGRLSAVVASVLRGKNKPT
FT                   FTPHTDTGDFVIVINAEKVKLTGKKATDKIYYTHSNHPGGLKQISAGELRSKNAVRLIE
FT                   KSVKGMLPHNTLGRAQGMKLKVFVGAEHTHAAQQPEVLDISGLI"
FT   gene            309004..309396
FT                   /locus_tag="SPAP_0342"
FT   CDS_pept        309004..309396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0342"
FT                   /product="hypothetical protein"
FT                   /note="Operon 144 Gene 2 protein supported
FT                   gi|15902316|ref|NP_357866.1| 30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83935"
FT                   /protein_id="ADM83935.1"
FT                   /translation="MSQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLR
FT                   LVINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLL
FT                   TRDSRKVERKKPGLKKARKASQFSKR"
FT   gene            complement(309657..310079)
FT                   /locus_tag="SPAP_0343"
FT   CDS_pept        complement(309657..310079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0343"
FT                   /product="hypothetical protein"
FT                   /note="Operon 145 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83936"
FT                   /protein_id="ADM83936.1"
FT                   /translation="MRFIVETFPIFSISNDLLQLLTSWKKQQKYELAKFGIISNPEQFI
FT                   FTYIDTKGNINKPLHSDYLNNKMKTIRKRHPELTHATPHKLRHTGATLAKQAGMSLEAI
FT                   SEALIHSDTGTTQIYVNTSNVVPMAVGEFALQSLKQ"
FT   gene            310226..310402
FT                   /locus_tag="SPAP_0344"
FT   CDS_pept        310226..310402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0344"
FT                   /product="hypothetical protein"
FT                   /note="Operon 146 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83937"
FT                   /protein_id="ADM83937.1"
FT                   /translation="MSLDIDKEKMTIMGIAFENRSVFKSVWYALSTNMIEGWRPTVSDV
FT                   EKLRDEALALGMT"
FT   gene            310803..313016
FT                   /locus_tag="SPAP_0345"
FT   CDS_pept        310803..313016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0345"
FT                   /product="Alpha-glucosidase, family 31 of glycosyl
FT                   hydrolases"
FT                   /note="Operon 147 Gene 1 COG1501 Alpha-glucosidases, family
FT                   31 of glycosyl hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83938"
FT                   /protein_id="ADM83938.1"
FT                   /translation="MKIFKGEFYRISVLTDKLVRLEYSRTGNFEDRTTQLIYNRDFGQV
FT                   SLDYIETSNVLDIMTDYFHLHFNKGEFNAENLFIELKGNFAVYGSRWYFGESIETLKGT
FT                   ARTLDKADGAISLEDGIISRNGIALLDDSQGFIWDEQSGYIERENQIDLYFFAYGHDYR
FT                   GAIRDFYHLTGSIPLLPRYALGNWWSRYWPYTSDEYLDLIDRFETEKIPLSIGVLDMDW
FT                   HITDIPARFGSGWTGYSWNRNLIPNPEQLLQQLHDRKLKLSLNVHPADGIRAYEEAYPQ
FT                   IAKRLGLNVELEEPAIFDFFNPSFREAYFKDVHYELEKQGVDFWWIDWQQGTQGMLDPL
FT                   WLLNHYHYQDSCKNAEGGLILSRYAGPGSHRYPVGFSGDTIISWNSLRFQPYFTATASN
FT                   IGYSWWSHDIGGHMLGDYDEELQTRWLQFGVFSPITRLHSSRSPFNSKEPWFFSETTSK
FT                   IMKKYLRLRHQMIPYLYTMNVKTHEEGAPLISPIYYFYPENDESYNVPNQYFFGTELMV
FT                   APIVEKMDLTFQSAKVDVWFPEGEWYDFFSEKKYTGGVKLSVYRDISTTPVFAKSGAII
FT                   PLVGSEIGMGVDLPEVVDWYVFPGKQHSFEMLEDQNGQRYKTRLSIDWEMGMVELALQG
FT                   DSSIVPSNRKHRIHFKGTNVSIIELPNKNDTAKFEWKDNKRTSLNDEVFRLLKTASLPY
FT                   ELKDRLLNQFINAKNSHDLMNILHHQDKELRGRLLEMIFTSQN"
FT   gene            complement(313238..313714)
FT                   /locus_tag="SPAP_0346"
FT   CDS_pept        complement(313238..313714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0346"
FT                   /product="Glutathione peroxidase"
FT                   /note="Operon 148 Gene 1 COG0386 Glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83939"
FT                   /protein_id="ADM83939.1"
FT                   /translation="MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTATGCGLTPQYQGL
FT                   QELYERYQAQGFEILDFPCNQFMGQAPGSAEEINAFCSLHFQTTFPRFAKIKVNGKEAD
FT                   PLYVWLKDQKSGPLGKRIEWNFSKFLIGRDGQVFERFSSKTDPKQIEEAIQTLL"
FT   gene            313937..317140
FT                   /locus_tag="SPAP_0347"
FT   CDS_pept        313937..317140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0347"
FT                   /product="hypothetical protein"
FT                   /note="hyaluronidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83940"
FT                   /protein_id="ADM83940.1"
FT                   /translation="MQTKTKKLIVSLSSLVLSGFLLNHYMTVGAEETTTNTIQQSQKEV
FT                   QYQQRDTKNLVENGDFGQTEDGSSPWTGSKAQGWSAWVDQKNSSADASTRVIEAKGGAI
FT                   TISSHEKLRAAVHRMVPIEAKKKYKLRFKIKTDHKVGIAKVRIIEESGKDKRLWNSATT
FT                   SGTKDWQTIEADYSPTLDVDKIKLELFYETGTGTVSFKDIELVEVADQLSEDSQTDKQL
FT                   EEKIDLPIGKKHVFSLADYTYKVENPDVASVKNGILEPLKEGTTNVIVSKDGKEVKKIP
FT                   LKILASVKDAYTARLDDWNGIIAGNQYYDSKNEQMAKLNQELEGKVADSLSSISSQADR
FT                   TYLWEKFSNYKMSANLTATYRKLEEMAKQVTNPSSRYYQDETVVRTVRDSMEWMHKHVY
FT                   NSEKSIVGNWWDYEIGTPRAINNTLSLMKEYFSDEEIKKYTDVIEKFVPDPEHFRKTTD
FT                   NPFKALGGNLVDMGRVKVIAGLLRKDDQEISSTIRSIEQVFKLVDQGEGFYQDGSYIDH
FT                   TNVAYTGAYGNVLIDGLSQLLPVIQKTKNPIDKDKMQTMYYWIDKSFAPLLVNGELMDM
FT                   SRGRSISRANSEGHVAAVEVLRGIHRIADMSEGETKQRLQSLVKTIVQSDSYYDVFKNL
FT                   KTYKDISLMQSLLSDAGVASVPRTSYLSAFNKMDKTAMYNAEKGFGFGLSLFSSRTLNY
FT                   EHMNKENKRGWYTSDGMFYLYNGDLSHYSDGYWPTVNPYKMPGTTETDAKRADSDTGKV
FT                   LPSAFVGTSKLDDANATATMDFTNWNQTLTAHKSWFMLKDKIAFLGSNIQNTSTDTAAT
FT                   TIDQRKLESSNPYKVYVNDKEASLTEQEKDYPETQSVFLESSDSKKNIGYFFFKKSSIS
FT                   MSKALQKGAWKDINEGQSDKEVENEFLTISQAHKQNGDSYGYMLIPNVGRATFNQMIKE
FT                   LESSLIENNETLQSVYDAKQGVWGIVKYDDSVSTISNQFQVLKRGVYTIRKEGDEYKIA
FT                   YYNPETQESAPDQEVFKKLEQAAQPQVQNSKEKEKSEEEKNHSDQKNLPQTGEGQSILA
FT                   SLGFLLLGAFYLFRRGKNN"
FT   gene            317679..317912
FT                   /locus_tag="SPAP_0348"
FT   CDS_pept        317679..317912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0348"
FT                   /product="hypothetical protein"
FT                   /note="Operon 150 Gene 1 protein supported
FT                   gi|148996730|ref|ZP_01824448.1| 30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83941"
FT                   /protein_id="ADM83941.1"
FT                   /translation="MIEGHLMPDHVHMLVSIPLRLSVSSFMGYLKGKSALMMFDKHANL
FT                   KYKFGNRHFWAEGYFVSTVGLNKATIKKYSQD"
FT   gene            complement(318288..318917)
FT                   /locus_tag="SPAP_0349"
FT   CDS_pept        complement(318288..318917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0349"
FT                   /product="2-keto-3-deoxy-6-phosphogluconate aldolase"
FT                   /note="Operon 151 Gene 1 COG0800
FT                   2-keto-3-deoxy-6-phosphogluconate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83942"
FT                   /protein_id="ADM83942.1"
FT                   /translation="MTKSDTIIELKKQKIVAVIRGNTKEEGLQASIACIKGGIKAIEIA
FT                   YTNQYAGQIIKELVDLYQDDQSVCIGAGTVLDAVTARDAILAGANYVVSPSFHTETAKM
FT                   CNLYSTPYIPGCITLTEITTALEAGSEIIKLFPGSTLSPAYISAVKAPIPQVSVMVTGG
FT                   VGLNNIPQWFAAGADAVGIGGELNKLASQGNFDRISEIAQQYVTLR"
FT   gene            complement(318927..319928)
FT                   /locus_tag="SPAP_0350"
FT   CDS_pept        complement(318927..319928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0350"
FT                   /product="Sugar kinase, ribokinase family"
FT                   /note="Operon 151 Gene 2 COG0524 Sugar kinases, ribokinase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83943"
FT                   /protein_id="ADM83943.1"
FT                   /translation="MTKILLFGEPLIRISPLDATSIGDHVASSTYFGGSEINIACNLQA
FT                   LGISTKVFTALPANEIGDRFLTFLKQHQIDTSSICRLGDRIGLYYLENGFGCRQSEVFY
FT                   DRKHTSISQIRPNMLDMDSLFQGISHFHFSGITVAIGQEVRAILLLLLEEAKRRGIVVS
FT                   MDLNLRTKMISVLEAKYEFSKFARFTDYCFGIDPLMIDDQNLEMFPRDSASLEKVENRM
FT                   RLLKEAYGFKAIFHTLRSSDEQDKNVYQAYALEERFEESVQLKTAVYQRIGSGDAFISG
FT                   ALYQLLHHSSLKTTIDFAVASATLKCTLPGDHLSTSATSIENLLANAQDIIR"
FT   gene            complement(319959..320600)
FT                   /locus_tag="SPAP_0351"
FT   CDS_pept        complement(319959..320600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0351"
FT                   /product="Ribose 5-phosphate isomerase RpiB"
FT                   /note="Operon 151 Gene 3 COG0698 Ribose 5-phosphate
FT                   isomerase RpiB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83944"
FT                   /protein_id="ADM83944.1"
FT                   /translation="MKIALINENSQASKNHIIYDSLKEATDKKDYQLFNYGMRREEGES
FT                   QLTYVQNGLMAAILLNTKAVDFVVTGCGTGVGAMLALNSFPGVVCGLAVDPTDAYLYSQ
FT                   INGGNALSIPYAKGFGWGAELTLKLMFERLFAEEMGGGYPRERVIPEQRNARILNEVKQ
FT                   ITHNDLMTILKTIDQDFLKDTISGKYFQEYFFENCQDDEVAAYLKEVLAK"
FT   gene            complement(320619..321434)
FT                   /locus_tag="SPAP_0352"
FT   CDS_pept        complement(320619..321434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0352"
FT                   /product="dehydrogenase"
FT                   /note="Operon 151 Gene 4 COG1028 Dehydrogenases with
FT                   different specificities (related to short-chain alcohol
FT                   dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83945"
FT                   /protein_id="ADM83945.1"
FT                   /translation="MTNTSFSIEQFSLKGKIALITGASYGIGFAIAKSYAEAGATIVFN
FT                   DINQDLVNKGIEAYREVGIEAHGYVCDVTDEDGIQAMVKQIEQEVGVIDILVNNAGIIR
FT                   RVPMCEMSAADFRKVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSA
FT                   YAAAKGGLKMLTRNIASEYGGANIQCNGIGPGYIATPQTAPLRELQEDGSRHPFDQFII
FT                   AKTPAARWGNPEDLMGPAVFLASDASNFVNGHILYVDGGILAYIGKQPE"
FT   gene            321706..322140
FT                   /locus_tag="SPAP_0353"
FT   CDS_pept        321706..322140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0353"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /note="Operon 152 Gene 1 COG2893 Phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83946"
FT                   /protein_id="ADM83946.1"
FT                   /translation="MKIVLVGHGHFATGIYSSLQLIAGNQENVEAIDFVEGMSADELKQ
FT                   KILLAISNEEEVLILSDLLGGSPFKVSSTIMGENPAKTMNVLSGLNLAMLMEAVFARMA
FT                   HSFDEVVNKSVVAAQGGVVNGKELFSTDAEEEEEDFESGI"
FT   gene            322152..323342
FT                   /locus_tag="SPAP_0354"
FT   CDS_pept        322152..323342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0354"
FT                   /product="hypothetical protein"
FT                   /note="Operon 152 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83947"
FT                   /protein_id="ADM83947.1"
FT                   /translation="MIKKVTIEKIKSPERFLEVPLLTKEEVGQAIDKVIRQLELNLDYF
FT                   KEDFPTPATFDNVYPIMDNTEWTNGFWTGELWLAYEYSQQDAFKNIAHKNVLSFLDRVN
FT                   KRVELAHHDLGFLYTPSCMAEYKINGDGEAREAALKAADKLIERYQEKGGFIQAWGDLG
FT                   KKEHYRLIIDCLLNIQLLFFAYQETGDQKYYDIAESHFYASANNVIRDDASSFHTFYFD
FT                   PETGQPFKGVTRQGYSDDSCWARGQSWGVYGIPLTYRHLKDESCFDLFKGVTNYFLNRL
FT                   PKDHVSYWDLIFNDGSDQSRDSSATAIAVCGIHEMLKHLPEVDADKDIYKHAMHAMLRS
FT                   LIEHYANDQFTPGGTSLLHGVYSWHSGKGVDEGNIWGDYYYLEALIRFYKDWNLYW"
FT   gene            323353..323844
FT                   /locus_tag="SPAP_0355"
FT   CDS_pept        323353..323844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0355"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /note="Operon 152 Gene 3 COG3444 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83948"
FT                   /protein_id="ADM83948.1"
FT                   /translation="MTMPNIIMTRIDERLIHGQGQLWVKYLGCNTVIVANDEVSTDKMQ
FT                   QTLMKTVVPDSVAMRFFPLQKVIDIIHKANPAQTIFIVVKDVKDALTLVEGGVPIKEIN
FT                   IGNIHNATGKEQVTRSIFLGEEDKAALKELSQTHQVTFNTKTTPTGNDGAVQVNIMDYI
FT                   "
FT   gene            323859..324638
FT                   /locus_tag="SPAP_0356"
FT   CDS_pept        323859..324638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0356"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /note="Operon 152 Gene 4 COG3715 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83949"
FT                   /protein_id="ADM83949.1"
FT                   /translation="MSINVFQAILIGLWTAFCFSGMLLGIYTNRCIVLSFGVGIILGDL
FT                   PTALAMGAIGELAYMGFGVGAGGTVPPNPIGPGIFGTLMAITSAGKVSPEAALALSTPI
FT                   AVAIQFLQTFAYTVRAGAPETAMKHLKNHNLKKFKFTLNATIWLFAFIGFTLGCLGALS
FT                   MDTLLKLVDYIPPVLLTGLTVAGKMLPAIGFAMILSVMAKKELIPFVLLGYVCAAYLNI
FT                   PTIGIAIVGTIFALIEFYNKPKTADHVVEEEAHDDWI"
FT   gene            324625..325443
FT                   /locus_tag="SPAP_0357"
FT   CDS_pept        324625..325443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0357"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /note="Operon 152 Gene 5 COG3716 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83950"
FT                   /protein_id="ADM83950.1"
FT                   /translation="MTGSNKLTKRDYLKTSLRAFFCQNGFNYSNYQGLGYANVMYPALK
FT                   KHYGEDQEGFYQALEENCEFYNTNPHFLPFITSLHLVMLENGRPAKETRSIKMALMGPL
FT                   AGIGDSLSQFCLAPLFSTIAASFAQEGLVVGPILFFLAMNTILTAIKLSTGLYGYKLGT
FT                   TVIDKLSEQMATISRIANIIGVTVIAGLAATSVKIMVPITFAAGEVKADAKQSIVSIQG
FT                   MLDKVAPALLPALFTLLVYYLIKEKKWTTYKLVILTVIIGIIGSWLKIIA"
FT   gene            325455..325736
FT                   /locus_tag="SPAP_0358"
FT   CDS_pept        325455..325736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0358"
FT                   /product="Preprotein translocase subunit YajC"
FT                   /note="Operon 152 Gene 6 COG1862 Preprotein translocase
FT                   subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83951"
FT                   /protein_id="ADM83951.1"
FT                   /translation="MFYGIVIVLAVSPLLLSSFHSIRQQKLLRKQMEQRQEYLASLTSG
FT                   DEVLLLSGIHGKIISIQDDLVFLQIAKGVVIYVEKESVMGKTKELLFK"
FT   gene            325758..327659
FT                   /locus_tag="SPAP_0359"
FT   CDS_pept        325758..327659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0359"
FT                   /product="hypothetical protein"
FT                   /note="Operon 152 Gene 7 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83952"
FT                   /protein_id="ADM83952.1"
FT                   /translation="MKEERRQFFERIDGNQCRDYILSHCSKDYEKVKSSLERLMDNRFM
FT                   FDSPWDMEPCSKIHQIQPMVWDQVFEDDPEWAYMLNRQEYLLQFMIGYVVEGDKDYIQK
FT                   CKFFLFDWIEQVREFSPQSLMTRTLDTGIRSFTWLKLLLLLLKFDLLEEKELEKILVSL
FT                   EKQIDFMKSHYRAKYTLSNWGILQTIPMLAIYYFFSDKMDLEEAYHFASEELKQQIETQ
FT                   ILGDGSQFEQSILYHVEVYKALLDLCLLLPDLQDSYRELLEKMATYIQMMTGLDGRTLA
FT                   FGDSDSTETTEMLSLSAVVLNKEDLLNGLDVKVDLLSLLFLGREKVKRLQEFERRAWQP
FT                   KSMIFEDSGHVCIKDEHRYIFFKNGPLGSAHSHSDENSFCLQYQGQPIFIDAGRYSYRE
FT                   IYERYLLKSAWSHSTCIVDGKAPERITGSWEYEYYPHSLFCHHKEREGVHYIEGAYWSA
FT                   EPDLPYLHKRKILMLVEDVWLLVDDIRCQGQHEALTQFILDKDVTYQDGKINQLRLWSE
FT                   VDFDLEDTIISPKYNELERSSKLTKRQFFENQMLDYTIIAHESFEIIRHSVYQTDDREV
FT                   ENALAFEVKNDETDKLILLLSEDIGVGEKLCLVDGTKMRGKCLVYDKINERMIRLQC"
FT   gene            327719..328720
FT                   /locus_tag="SPAP_0360"
FT   CDS_pept        327719..328720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0360"
FT                   /product="Transcriptional regulator"
FT                   /note="Operon 152 Gene 8 COG1609 Transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83953"
FT                   /protein_id="ADM83953.1"
FT                   /translation="MEKKLTIKDIAEMAQTSKTTVSFYLNGKYEKMSQETREKIEKVIH
FT                   ETNYKPSIVARSLNSKRTKLIGVLIGDITNSFSNQIVKGIEDIASQNGYQVMIGNSNYS
FT                   QESEDRYIESMLLLGVDGFIIQPTSNFRKYSRIIDEKKKKMVFFDSQLYEHRTSWVKTN
FT                   NYDAVYDMTQSCIEKGYEHFLLITADTSRLSTRIERASGFVDALTDANKRHASLTIEDK
FT                   HTNLEQIKEFLQKEIDPDEKTLVFIPNCWALPLVFTVIKELNYNLPQVGLIGFDNTEWT
FT                   CFSSPSVSTLVQPSFEEGQQATKILIDQIEGRNQEERQQVLDCSVNWKESTF"
FT   gene            complement(328830..329165)
FT                   /locus_tag="SPAP_0361"
FT   CDS_pept        complement(328830..329165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0361"
FT                   /product="hypothetical protein"
FT                   /note="Operon 153 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83954"
FT                   /protein_id="ADM83954.1"
FT                   /translation="MKSLARLLIIHVFISIFLFFALISGAVSHTVLLLLLLFLPALNKG
FT                   LEKIQSKRIPVLNAALFFLLISFPQLLTNPVQWKFSIFLVVTIISSLAYFYNFYQVVKE
FT                   VDQKQLI"
FT   gene            complement(329176..329418)
FT                   /locus_tag="SPAP_0362"
FT   CDS_pept        complement(329176..329418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0362"
FT                   /product="hypothetical protein"
FT                   /note="Operon 153 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83955"
FT                   /protein_id="ADM83955.1"
FT                   /translation="MKKEKRQLRYPGLKAGSIYGTVIFFIIPLIDTLTSENPNFISSLL
FT                   NTKHIFKTILGAFFFGVMIHIVDSLRIARAKKDQD"
FT   gene            complement(329677..329970)
FT                   /locus_tag="SPAP_0363"
FT   CDS_pept        complement(329677..329970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0363"
FT                   /product="hypothetical protein"
FT                   /note="Operon 154 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83956"
FT                   /protein_id="ADM83956.1"
FT                   /translation="MKKETFTEKLIKRTYGISGPLDEYKRREADRIGNQVFIILFYLMI
FT                   FGNLIPLLLAYKYPQEVALIYPPLILVIALIAAGYVTYQMKKQGLQLLIQTC"
FT   gene            complement(329986..330180)
FT                   /locus_tag="SPAP_0364"
FT   CDS_pept        complement(329986..330180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0364"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="Operon 154 Gene 2 COG1476 Predicted transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83957"
FT                   /protein_id="ADM83957.1"
FT                   /translation="MNRVKEFRKELGISQLELAKDIGVSRQTINMIENDKYNPTLELCL
FT                   NLARSLQTDLNSLFWEEDF"
FT   gene            330346..331296
FT                   /locus_tag="SPAP_0365"
FT   CDS_pept        330346..331296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0365"
FT                   /product="Predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in cell envelope biogenesis"
FT                   /note="Operon 155 Gene 1 COG0275 Predicted
FT                   S-adenosylmethionine-dependent methyltransferase involved
FT                   in cell envelope biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83958"
FT                   /protein_id="ADM83958.1"
FT                   /translation="MTKEFHHVTVLLHETIDMLDVKPDGIYVDATLGGAGHSEYLLSKL
FT                   SEKGHLYAFDQDQNAIDNAQKRLAPYIEKGMVTFIKDNFRHLQARLREAGVQEIDGICY
FT                   DLGVSSPQLDQRERGFSYKKDAPLDMRMNQDASLTAYEVVNHYDYHDLIRIFFKYGEDK
FT                   FSKQIARKIEQAREVKPIETTTELAEIIKLVKPAKELKKKGHPAKQIFQAIRIEVNDEL
FT                   GAADESIQQAMDMLALDGRISVITFHSLEDRLTKQLFKEASTVEVPKGLPFIPDDLKPK
FT                   MELVSRKPILPSAEELEANNRSHSAKLRVARKIHK"
FT   gene            331308..331625
FT                   /locus_tag="SPAP_0366"
FT   CDS_pept        331308..331625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0366"
FT                   /product="Protein required for the initiation of cell
FT                   division"
FT                   /note="Operon 155 Gene 2 COG4839 Protein required for the
FT                   initiation of cell division"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83959"
FT                   /protein_id="ADM83959.1"
FT                   /translation="MAEKMEKTGQILQMQLKRFSRVEKAFYFSIAVTTLIVAISIIFMQ
FT                   TKLLQVQNDLTKINAQIEEKKTELDDAKQEVNELLRAERLKEIANSHDLQLNNENIRIA
FT                   E"
FT   gene            331629..333881
FT                   /locus_tag="SPAP_0367"
FT   CDS_pept        331629..333881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0367"
FT                   /product="Cell division protein FtsI/penicillin-binding
FT                   protein 2"
FT                   /note="Operon 155 Gene 3 COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83960"
FT                   /protein_id="ADM83960.1"
FT                   /translation="MKWTKRVIRYATKNRKSPAENRRRVGKSLSLLSVFVFAIFLVNFA
FT                   VIIGTGTRFGTDLAKEAKKVHQTTRTVPAKRGTIYDRNGVPIAEDATSYNVYAVIDENY
FT                   KSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQLSQPNLKQVSFGAKGNGITYANM
FT                   MSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESS
FT                   LNSILAGTDGIITYEKDRLGNIVPGTEQVSQRTMDGKDVYTTISSPLQSFMETQMDAFQ
FT                   EKVKGKYMTATLVSAKTGEILATTQRPTFDADTKEGITEDFVWRDILYQSNYEPGSTMK
FT                   VMMLAAAIDNNTFPGGEVFNSSELKIADATIRDWDVNEGLTGGRMMTFSQGFAHSSNVG
FT                   MTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIVNIAQSSFGQGISVTQ
FT                   TQMIRAFTAIANDGVMLEPKFISAIYDPNDQTARKSQKEIVGNPVSKDAASLTRTNMVL
FT                   VGTDPVYGTMYNHSTGKPTVTVPGQNVALKSGTAQIADEKNGGYLVGVTDYIFSAVSMS
FT                   PAENPDFILYVTVQQPEHYSGIQLGEFANPILERASAMKDSLNLQTTAKALEQVSQQSP
FT                   YPMPSVKDISPGDLAEELRRNLVQPIVVGTGTKIKNSSAEEGKNLAPNQQVLILSDKVE
FT                   EVPDMYGWTKETAETLAKWLNIELEFQGSGSTVQKQDVRANTAIKDIKKITLTLGD"
FT   gene            333883..334863
FT                   /locus_tag="SPAP_0368"
FT   CDS_pept        333883..334863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0368"
FT                   /product="UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /note="Operon 155 Gene 4 COG0472 UDP-N-acetylmuramyl
FT                   pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83961"
FT                   /protein_id="ADM83961.1"
FT                   /translation="MFISLSAGIVTFLLTLVGIPAFIQFYRKAQITGQQMHEDVKQHQA
FT                   KAGTPTMGGLVFLITSVLVAFFFALFSSQFSNNVGMILFILVLYGLVGFLDDFLKVFRK
FT                   INEGLNPKQKLALQLLGGVIFYLFYERGGDMLSVFGYQVHLGIFYIVFALFWLVGFSNA
FT                   VNLTDGVDGLASISVVISLSAYGVIAYVQGQMDILLVILAMIGGLLGFFIFNHKPAKVF
FT                   MGDVGSLALGGMLAAISMALHQEWTLLIIGIVYVFETTSVMMQVSYFKLTGGKRIFRMT
FT                   PVHHHFELGGLSGKGNPWSEWKVDFFFWGVGLLASLLTLAILYLM"
FT   gene            335427..337532
FT                   /locus_tag="SPAP_0369"
FT   CDS_pept        335427..337532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0369"
FT                   /product="hypothetical protein"
FT                   /note="Operon 156 Gene 1 protein supported
FT                   gi|163764771|ref|ZP_02171825.1| ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83962"
FT                   /protein_id="ADM83962.1"
FT                   /translation="MNNNFNNFNNMDDLFNQLMGGMRGYSSENRRYLINGREVTPEEFA
FT                   HYRTTGQLPGNAETDVQMPQQASGMKQDGVLAKLGRNLTAEAREGKLDPVIGRNKEIQE
FT                   TSEILSRRTKNNPVLVGDAGVGKTAVVEGLAQAIVNGDVPAAIKNKEIISIDISGLEAG
FT                   TQYRGSFEENVQNLVNEVKEAGNIILFFDEIHQILGAGSTGGDSGSKGLADILKPALSR
FT                   GELTVIGATTQDEYRNTILKNAALARRFNEVKVNAPSAENTFKILQGIRDLYQQHHNVI
FT                   LPDEVLKAAVDYSVQYIPQRSLPDKAIDLVDVTAAHLAAQHPVTDVHAVEREIETEKDK
FT                   QEKAVEAEDFEAALNYKTRIAELEKKIENHTEDMKVTASVNDVAESVERMTGIPVSQMG
FT                   ASDIERLKDMAHRLQDKVIGQDKAVEAVARAIRRNRAGFDEGNRPIGSFLFVGSTGVGK
FT                   TELAKQLALDMFGTQDAIIRLDMSEYSDRTAVSKLIGTTAGYVGYDDNSNTLTERVRRN
FT                   PYSIILLDEIEKADPQVITLLLQVLDDGRLTDGQGNTVNFKNTVIIATSNAGFGYEANL
FT                   TEDADKPELMDRLKPFFRPEFLNRFNAVIEFSHLTKEDLSKIVDLMLAEVNQTLAKKDI
FT                   DLVVSQAAKDYITEEGYDEVMGVRPLRRVVEQEIRDKVTDFHLDHLDAKHLEADMEDGV
FT                   LVIREKA"
FT   gene            complement(337828..338310)
FT                   /locus_tag="SPAP_0370"
FT   CDS_pept        complement(337828..338310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0370"
FT                   /product="LuxS protein involved in autoinducer AI2
FT                   synthesis"
FT                   /note="Operon 157 Gene 1 COG1854 LuxS protein involved in
FT                   autoinducer AI2 synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83963"
FT                   /protein_id="ADM83963.1"
FT                   /translation="MSKEVIVESFELDHTIVKAPYVRLIGEETGPKGDIISNYDIRLVQ
FT                   PNEDSIPTAGLHTIEHLLAKLIRTRIDGMIDCSPFGCRTGFHMIMWGRHTSAKIAAVIK
FT                   DSLKEIAETTTWEDVPGTTIESCGNYKDHSLFSAKEWAKLILEQGISDDAFERHVI"
FT   gene            complement(338405..339889)
FT                   /locus_tag="SPAP_0371"
FT   CDS_pept        complement(338405..339889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0371"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 157 Gene 2 COG4868 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83964"
FT                   /protein_id="ADM83964.1"
FT                   /translation="MKKQAFSSEQYLNLQRDHILERINQFDGKLYLEFGGKMLEDFHAA
FT                   RVLPGYEPDNKIKLLQELKEQVEVVIAINASNIEHSKARGDLGISYDQEVLRLIDKFNE
FT                   LGIFVGSVVITQYAGQPAADAFRNQLEKNGIDSYLHYPIKGYPTDMDHIISPEGMGKND
FT                   YIKTSRNLIVVTAPGPGSGKLATCMSNMYHDQINGIKSGYAKFETFPVWNLPLHHPVNL
FT                   AYEAATADLDDVNMIDPFHLQTYGETTVNYNRDIEIFPVLKRMLERILGKSPYASPTDM
FT                   GVNMVGFAITDDEAAVEASKQEIIRRYYQTVLDFKAEKVGEAAVKKIELLMNDLGITPA
FT                   DRKVAVVARQKAEETGGPALAFELPNGEIVTGKNSELFGPTAAALINAIKKSADIAKEV
FT                   KLIEPEVVKPIQGLKIDHLGSRNPRLHSNEILIALAITATENPDATRAMEELGNLKGSE
FT                   AHSTIILTDEDKNVLRKLGINVTFDPYYQYDRLYRK"
FT   gene            340042..341652
FT                   /locus_tag="SPAP_0372"
FT   CDS_pept        340042..341652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0372"
FT                   /product="glucan 1,6-alpha-glucosidase"
FT                   /note="Operon 158 Gene 1 COG0366 Glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83965"
FT                   /protein_id="ADM83965.1"
FT                   /translation="MQEKWWHNAVVYQVYPKSFMDSNGDGVGDLPGITSKLDYLAKLGI
FT                   TAIWLSPVYDSPMDDNGYDIADYQAIATIFGTMEDMDQLIAEAKKRDIRIIMDLVVNHT
FT                   SDEHAWFVEACENPNSPERDYYIWRDEPNDLDSIFSGSAWEYDEKSGQYYLHFFSKKQP
FT                   DLNWENEKLRQKIYEMMNFWIDKGIGGFRMDVIDMIGKIPDEKVVNNGPMLHPYLKEMN
FT                   QATFGDKDLLTVGETWGATPEIAKLYSDPKGQELSMVFQFEHIGLQYQEGQPKWHYQKE
FT                   LNIAKLKEIFNKWQTELGVEDGWNSLFWNNHDLPRIVSIWGNDQEYREKSAKAFAILLH
FT                   LMRGTPYIYQGEEIGMTNYPFETLDQVEDIESLNYAREALEKGVPIEEIMDSIRVIGRD
FT                   NARTPMQWDESKNAGFSTGQPWLAVNPNYEMINVQEALANPDSIFYTYQKLVQIRKENS
FT                   WLVRADFELLDTADKVFAYIRKDGDRRFLVVANLSNEEQDLTVEGKVKSVLIENTLAQE
FT                   VFEKQILVPWDAFCVEMTD"
FT   gene            complement(341783..343192)
FT                   /locus_tag="SPAP_0373"
FT   CDS_pept        complement(341783..343192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0373"
FT                   /product="Transposase-like protein, IS1202"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83966"
FT                   /protein_id="ADM83966.1"
FT                   /translation="MNETKKYLVIKAIAQGKKTKKRACVVLNLSERQINRLLLAYQQKG
FT                   KEAFRHGNRNRKPKHAIPDEIKERILKKYLSYETYKPNVRHFCELLAEEEGIQLSDTTV
FT                   RKILYKKNILSPKSHRKTKKRVRKQAKLNPKQPLDNLILPTAEDFLENPKKVHPSRPRK
FT                   KFAGELIQMDTSPHAWFGAETSNLHLAIDDASGNILGAYFDKQETLNAYYHVLEQILAN
FT                   HGIPLQIKTDKRTVFTYQASNSKKMEDDTHTQFGYACHQLGILLETTSIPQAKGRVERL
FT                   NQTLQSRLPIELEQNNIHTLEEANTFLLSYIQTFNEQFGNKTKLSVFEEVPNPSERNLI
FT                   LARLAERVVDSGHHIRFQNRYYIPTEQGKEVYFIRKTKALVIKAFDGDIYLNIADKIYH
FT                   TKELLNHELYSKNFEQEPEQKKKDASISLHKPIRGNSHLSNNIFIKIKRIMKSLLVRSL
FT                   ILLNYKYSKMK"
FT   gene            343368..344813
FT                   /gene="wzg"
FT                   /locus_tag="SPAP_0374"
FT   CDS_pept        343368..344813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzg"
FT                   /locus_tag="SPAP_0374"
FT                   /product="integral membrane regulatory protein Wzg"
FT                   /function="Transcriptional regulator"
FT                   /note="Operon 160 Gene 1 COG1316 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83967"
FT                   /protein_id="ADM83967.1"
FT                   /translation="MSRRFKKSGSQKVKRSVNIVLLTIYLLLVCFLLFLIFKYNILAFR
FT                   YLNLVVTALVLLVALVGLLLIIYKKAEKFTIFLLVFSILVSSVSLFAVQQFVGLTNRLN
FT                   ATSNYSEYSISVAVLADSEIENVTQLTSVTAPTGTDNENIQKLLADIKSSQNTDLTVNQ
FT                   SSSYLAAYKSLIAGETKAIVLNSVFENIIESEYPDYASKIKKIYTKGFTKKVEAPKTSK
FT                   NQSFNIYVSGIDTYGPISSVSRSDVNILMTVNRDTKKILLTTTPRDAYVPIADGGNNQK
FT                   DKLTHAGIYGVDSSIHTLENLYGVDINYYVRLNFTSFLKMIDLLGGIDVHNDQEFSALH
FT                   GKFHFPVGNVHLDSEQALGFVRERYSLADGDRDRGRNQQKVIVAILQKLTSTEALKNYS
FT                   TIIDSLQDSIQTNMPLETMINLVNAQLESGGNYKVNSQDLKGTGRTDLPSYAMPDSNLY
FT                   VMEINDSSLASVKTAIQDVLEGR"
FT   gene            344815..345546
FT                   /gene="wzh"
FT                   /locus_tag="SPAP_0375"
FT   CDS_pept        344815..345546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzh"
FT                   /locus_tag="SPAP_0375"
FT                   /product="protein-tyrosine phosphatase Wzh"
FT                   /function="Capsular polysaccharide biosynthesis protein"
FT                   /note="Operon 160 Gene 2 COG4464 Capsular polysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83968"
FT                   /protein_id="ADM83968.1"
FT                   /translation="MIDIHSHIVFDVDDGPKSREESKALLTEAYRQGVRTIVSTSHRRK
FT                   GMFETPEEKIAENFLQVREIAKEVASDLVIAYGAEIYYTPDVLDKLEKNRIPTLNNSRY
FT                   ALIEFSMNTPYRDIHSALIKILMLGITPVIAHIERYDALENNEKRVRELIDMGCYTQVN
FT                   SSHVLKSKLFGERYKFMKKRAQYFLERDLVHVIASDMHNVDSRPPHMAEAYDLVSQKYG
FT                   EAKAQELFIDNPRKIVMDQLI"
FT   gene            345555..346247
FT                   /gene="wzd"
FT                   /locus_tag="SPAP_0376"
FT   CDS_pept        345555..346247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzd"
FT                   /locus_tag="SPAP_0376"
FT                   /product="capsular polysaccharide biosynthesis protein Wzd"
FT                   /function="Capsular polysaccharide biosynthesis protein"
FT                   /note="Operon 160 Gene 3 COG3944 Capsular polysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83969"
FT                   /protein_id="ADM83969.1"
FT                   /translation="MKEQNTIEIDVFQSLKTLWKYKLIILLVALVTGAGAFAYSTFIVK
FT                   PEYTSTTRIYVVNRNQGDKPGLTNQDLQAGTYLVKDYREIILSQDVLEKVATNLKLDIP
FT                   AKTLTSKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIIAVTRVSDVTTLE
FT                   EARPATTPSSPNVRRNTLVGFLGGAAVTVITVLLIELLDTRVKRPEDVEDVLQMPLLGV
FT                   VPDFDKMK"
FT   gene            346257..346946
FT                   /gene="wze"
FT                   /locus_tag="SPAP_0377"
FT   CDS_pept        346257..346946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wze"
FT                   /locus_tag="SPAP_0377"
FT                   /product="tyrosine-protein kinase Wze"
FT                   /function="ATPases involved in chromosome partitioning"
FT                   /note="Operon 160 Gene 4 COG0489 ATPases involved in
FT                   chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83970"
FT                   /protein_id="ADM83970.1"
FT                   /translation="MPTLEISQVKLELAKKAEEYYNALCTNLQLSGDDLKVFSITSVKA
FT                   GEGKTTTSTNIAWAFARAGYKTLLIDADMRNSVMSGVFKSRERITGLTEFLSGTTDLSQ
FT                   GLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLGTLRKYFDYIVVDTAPIGIVIDAA
FT                   IIMQKCDASILVTKAGETKRRDLQKAKEQLEQTGKSCLGVVLNKFDTSVEKYGSYGSYG
FT                   NYRKQKK"
FT   gene            346961..348322
FT                   /gene="wchA"
FT                   /locus_tag="SPAP_0378"
FT   CDS_pept        346961..348322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wchA"
FT                   /locus_tag="SPAP_0378"
FT                   /product="undecaprenylphosphate glucosephosphotransferase
FT                   WchA (initial sugar transferase)"
FT                   /function="Sugar transferases involved in
FT                   lipopolysaccharide synthesis"
FT                   /note="Operon 160 Gene 5 COG2148 Sugar transferases
FT                   involved in lipopolysaccharide synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83971"
FT                   /protein_id="ADM83971.1"
FT                   /translation="MSEKLAKPSVAIVQSFLVILLTYLLSAVRETEIVSTTAIVLYILH
FT                   YFVFYISDYGRNFFKRGYLIELVQTLKYILFFALAISISNFFLEDRFSISRRGMIYFLL
FT                   LHVFLVYVLNLFIKWYWKRAYPNFKGSKKVFLLTATSHVEKVLDRLIESNEVVGELVAV
FT                   SVLDKPDFQHDYLKVVAEGEIVNFATHEVVDEVFINLPSEKYNIGELVSQFETMGIDVT
FT                   VNLNAFDWARNKQIREMAGLNVVTFSTTFYKTSHVIAKWIIDIVGSLVGLILCGLVSIV
FT                   LVPLIRKDGGSAFFAQTRIGKNGRHFTFYKFRSMCVDAEDKKRELMEQNTMQGGMFKVD
FT                   DDPRITKIGHFIRKTSLDELPQFYNVLKGDMSLVGTRPPTVDEYEHYTPEQKRRLSFKP
FT                   GITGLWQVSGRSEIKNFDEVVKLDVAYIDDWTIWKDIEILLKTVKVVLMKDGAK"
FT   gene            348326..348775
FT                   /gene="wchJ"
FT                   /locus_tag="SPAP_0379"
FT   CDS_pept        348326..348775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wchJ"
FT                   /locus_tag="SPAP_0379"
FT                   /product="putative glycosyl transferase enhancer"
FT                   /function="UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase"
FT                   /note="Operon 160 Gene 6 COG0707
FT                   UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83972"
FT                   /protein_id="ADM83972.1"
FT                   /translation="MKICLVGSSGGHLTHLYLLKPFWKDKERFWVTFDKEDTRSILGNE
FT                   TFYPCHYPTNRNLKNLIKNTVLAFNILRKERPDVIISSGAAVAVPFFYLGKLFGAKTVY
FT                   IEVFDRIDAPTLTGKIVYPVTDKFIVQWEEMKKVYPKAINLGGIF"
FT   gene            348775..349254
FT                   /gene="wchK"
FT                   /locus_tag="SPAP_0380"
FT   CDS_pept        348775..349254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wchK"
FT                   /locus_tag="SPAP_0380"
FT                   /product="putative glycosyl transferase"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="Operon 160 Gene 7 COG5017 Uncharacterized conserved
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83973"
FT                   /protein_id="ADM83973.1"
FT                   /translation="MIFVTIGTHEQQFNRLIKEVDRLKGEGFIQDDVFIQTGFSDYEPV
FT                   YCQWKNLISYDEMNRYIDEANIIITHGGPATFMAVIAKGKIPIVVPRLKKFGEHVNDHQ
FT                   MEFCSKILSEGYELSLINDISELQYSLKQEKKTKFYSNNTCFLKKLSKTIEDLIV"
FT   gene            349496..350593
FT                   /gene="wcyK"
FT                   /locus_tag="SPAP_0381"
FT   CDS_pept        349496..350593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcyK"
FT                   /locus_tag="SPAP_0381"
FT                   /product="putative glycosyl transferase"
FT                   /function="Glycosyltransferase"
FT                   /note="Operon 161 Gene 1 COG0438 Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83974"
FT                   /protein_id="ADM83974.1"
FT                   /translation="MKILHIPTGGLFSDGIGTFIYSYLEYMDLNKYDVTILATNSPLKS
FT                   DKEKFECLGVKVIEIERKKSNLSKYVYKLKKIIKKEKFDIIHVHGSSALMSIELLTAKV
FT                   AGIPVRIAHSHNTTCEHHKLDKLLRPIFYRVYTQACACSVSAGQWLFEEKNYKIIHNAR
FT                   DVNRYQYDAIKRKKLREELLLSDETIALGHVGRFNTQKNQCFLVSLMEKLVIKNIDIKL
FT                   FLVGTGDTLEEIKKLVIQKKLEDNIVFLGQFDDMKSFVSSMDIMLLPSLYEGLPLVSVE
FT                   WQINGVESILSDRVTQECIYTGTVQQLSIDSMELWEKEILNLSTSDRERVSLQNIQLIK
FT                   NAGYDISLEVKEIEELYNSLYDIAN"
FT   gene            350615..351274
FT                   /gene="wcwC"
FT                   /locus_tag="SPAP_0382"
FT   CDS_pept        350615..351274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcwC"
FT                   /locus_tag="SPAP_0382"
FT                   /product="putative acetyl transferase"
FT                   /function="Exopolysaccharide biosynthesis protein"
FT                   /note="Operon 161 Gene 2 COG3955 Exopolysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83975"
FT                   /protein_id="ADM83975.1"
FT                   /translation="MKMLQNLKPIKRKLKPIKRTYKRIVYSITKSNMRKRLKNTDFSII
FT                   SDNCWGGRVYEELGLPYRTPFIGLYIFSEDYVKLLKNFRKYMEYELTFTNNSKWNTEYD
FT                   GEYPIGILKDIELHFLHYANQEEAYEKWNKRKNRINYENIFFKMNDDNKCSLKLLKEFD
FT                   TLDLKNKIIFAAFNYKELDNLIHFTDPRGNGNVGTDLFYYDQYFDVVNWLNGETQT"
FT   gene            351271..351993
FT                   /gene="wcrL"
FT                   /locus_tag="SPAP_0383"
FT   CDS_pept        351271..351993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcrL"
FT                   /locus_tag="SPAP_0383"
FT                   /product="putative glycosyl transferase"
FT                   /function="Mannosyltransferase OCH1 and related enzymes"
FT                   /note="Operon 161 Gene 3 COG3774 Mannosyltransferase OCH1
FT                   and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83976"
FT                   /protein_id="ADM83976.1"
FT                   /translation="MIPKKIHYCWFGGKPLSNDVKRCIASWKKFCPDYEIIEWTEKNFC
FT                   IENQNQFVQDAYRDKAWAFVSDYARLKIIYENGGIYLDTDVEVIKNLDKLLENKAFFGV
FT                   HQVNHLVNTGLGFGSEKGTSILKELLNLYDEIEFDLSKKDELLCPELNTPVFKRLGYTY
FT                   SDCVVKNEYFTIYPEEYFDPISLGDGVENILSDKTFSIHHYSASWTSLRNQMKSKIIRK
FT                   LGRSNILELKRILKGKTR"
FT   gene            351990..353162
FT                   /gene="wzy"
FT                   /locus_tag="SPAP_0384"
FT   CDS_pept        351990..353162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzy"
FT                   /locus_tag="SPAP_0384"
FT                   /product="oligosaccharide repeat unit polymerase Wzy"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83977"
FT                   /protein_id="ADM83977.1"
FT                   /translation="MRISPSKLIFAFFSSFYILVILFPRGIFLGHSTLASRLWIIYNGS
FT                   LYLSILLGLIYVILKILSRNIAIHQHAFFILQYYFIVIILTFMVSGSIGVGLQSIFYPI
FT                   FIYLFFNEVRDKKSIVLIFDIFLYILTPLFVINTIDVFLNFTNIFHITFLGHVQVISQY
FT                   SVIGFLVSAYYLLEEKRNILVAQLLLILTIINCFFSDVSLSKVIALFMIVYIISYKLRK
FT                   LFWKRGRKISVVTFIASVVMLALVIFGYFLPYLRYFDFTFNGRYQIWRIVYATILQVKW
FT                   FGYGLFGFQFKLPWQKLGEVGINYTHNQVLQLALDSGIVGIISFFTMIFYMIFSTKNIQ
FT                   NSTISSLFIFAYFCLFIIMFIESVTYYPYYFIIIVLQTLYLKLERERNVK"
FT   gene            353152..353652
FT                   /gene="wcwT"
FT                   /locus_tag="SPAP_0385"
FT   CDS_pept        353152..353652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcwT"
FT                   /locus_tag="SPAP_0385"
FT                   /product="putative acetyl transferase"
FT                   /function="Acetyltransferase (isoleucine patch
FT                   superfamily)"
FT                   /note="Operon 161 Gene 5 COG0110 Acetyltransferase
FT                   (isoleucine patch superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83978"
FT                   /protein_id="ADM83978.1"
FT                   /translation="MLNRLIRNFNKVYYSYRIKRKAAQCGGRVYTGGKTFVTANTYLDE
FT                   NVSFNGMSMYGEGKISIGKNFHSGLNCQIITSFHNYDLGDKIPYDESYIHKDVLIEDNV
FT                   WVGNNVIILGGAIIEEGAIIQAGSTVIGRIPAGAIAGGHPAKPFRFRNMEHYNQLKRQK
FT                   KFH"
FT   gene            353662..354849
FT                   /gene="wcwU"
FT                   /locus_tag="SPAP_0386"
FT   CDS_pept        353662..354849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcwU"
FT                   /locus_tag="SPAP_0386"
FT                   /product="putative glycerol phosphotransferase"
FT                   /function="Putative glycosyl/glycerophosphate transferases
FT                   involved in teichoic acid biosynthesis TagF/TagB/EpsJ/RodC"
FT                   /note="Operon 161 Gene 6 COG1887 Putative
FT                   glycosyl/glycerophosphate transferases involved in teichoic
FT                   acid biosynthesis TagF/TagB/EpsJ/RodC"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83979"
FT                   /protein_id="ADM83979.1"
FT                   /translation="MNIVSYLKKNGITHTLKIINEYKMQELFDSLVSIFTKQKELRNSI
FT                   VIECHTDFENNGGAFYDYLINNEYNKKYKIVLLLKDKLVKELPENVDYFYLRKPSLRKS
FT                   YVMSLSKFFTFDNDMLRKYRKDQKHFYLTHGCFPLKSTIGKITVPNYVDFVLSPSGNVD
FT                   NIIVKQFGLTSKEQCLHTGFPCHDIFYSKPEPLVFLSNYDKKIIWAPTFRKGGGYNRND
FT                   STASYPLGIPLLETLDELANLNTYLSQRDIALIVKLHPMQDISDLELKQFSHIKFLTNQ
FT                   DLNRKNTNLYQLLMNSDALLSDYSAISYDYLHLDKPIGYVFSDLNDYKLGLSVDNVDDY
FT                   IAGDKILSFNNLLHFIDNIYLEIDKNKEKRKELFNKIFEKQDGESCERLAQIMEL"
FT   gene            354806..356269
FT                   /gene="wzx"
FT                   /locus_tag="SPAP_0387"
FT   CDS_pept        354806..356269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzx"
FT                   /locus_tag="SPAP_0387"
FT                   /product="flippase Wzx"
FT                   /function="Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /note="Operon 161 Gene 7 COG2244 Membrane protein involved
FT                   in the export of O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83980"
FT                   /protein_id="ADM83980.1"
FT                   /translation="MENRVKDWHKLWNYKSRYEEMSVGMKAALWYTVANFIQKGFVFLS
FT                   TPILTRILNVNDYGTLILYQSWFVLFAIFATLNLSQTAYNKGLVEFENDKDNFTFSLLF
FT                   LSKTITIIVAFLYFTFNILVKDSTGLTPSFMIFLFSDILFNISIEFYLARQRFEFKYRK
FT                   AVLISTFSSFFIVAISTTILLAIKNDLFIKIVLDAIIRIIFGLYCFYLLFFSGRRQLKI
FT                   EKKYIKYGLSYSLPLIPHFLSHYILNQSDRLMINMFDGKEKLAIYSLAYSVSMIMFLFT
FT                   NAINQSIMPHTFQALKKKDYCGIHGSTKWLFVVVGGITALSILFAPELIVILGGNKYKE
FT                   SIWLVPPIAISVYFLFVYSMFSNISFYYKMNKLISLVSTGAALSNIILNYIFINIFGYQ
FT                   AAAYTTLLCYILLAFSHFFLYRFLLKKEEIHEELYNMKMILIISLILLIILFLILVIYN
FT                   LAIIRYAIIAIILFLLFTKRNKIITSLKS"
FT   gene            356383..356775
FT                   /gene="gct"
FT                   /locus_tag="SPAP_0388"
FT   CDS_pept        356383..356775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gct"
FT                   /locus_tag="SPAP_0388"
FT                   /product="CDP-glycerol-1-phosphate biosynthetic protein
FT                   Gct"
FT                   /function="Cytidylyltransferase"
FT                   /note="Operon 162 Gene 1 COG0615 Cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83981"
FT                   /protein_id="ADM83981.1"
FT                   /translation="MKRVITYGTFDLLHYGHINLLKRAKQLGDYLIVVVSSDEFNLKEK
FT                   NKVCYFNFEHRKNLVEAIRYVDLVISETSWEQKKTDIKEYHIDTFVMGDDWKGKFDYLK
FT                   EEGVEVIYLPRTKEISTTKIKEDLAD"
FT   gene            357137..358165
FT                   /gene="wcjE"
FT                   /locus_tag="SPAP_0389"
FT   CDS_pept        357137..358165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcjE"
FT                   /locus_tag="SPAP_0389"
FT                   /product="putative acetyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83982"
FT                   /protein_id="ADM83982.1"
FT                   /translation="MTKVRINWVDFGKGFAIFLVLVGHVFIGLSESNKFSIANDVLLFL
FT                   IAQIYIFHIPVFFALSGYFFRPVSDLKEFWYYAKKKTIILGIPYIFYSIIHFCLQKLAG
FT                   ASVRVPTTIHNLLNIYRYPLGVSWYLYTLWSILIVYGLLSIVFKNRKSLFLVSVFAYIF
FT                   TLFIQIDIFIVQRTLVWGICFFLGSVLSEIHFDKINLKKFLFFFVLFDFIYMFAWFLFY
FT                   EVGSKKDYVSYINPGLWGIAFIVCVLVAFAIFPKMEKNFPKTFLYFTKYGKDSLGIYIL
FT                   HAPICSMIRILMLKVGINSVFLHVVVGIVLGWYLSILATYILKKIPFLNIVLLPQKYIK
FT                   LK"
FT   gene            358343..360325
FT                   /locus_tag="SPAP_0390"
FT   CDS_pept        358343..360325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0390"
FT                   /product="ABC-type oligopeptide transport system,
FT                   periplasmic component"
FT                   /note="Operon 164 Gene 1 COG4166 ABC-type oligopeptide
FT                   transport system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83983"
FT                   /protein_id="ADM83983.1"
FT                   /translation="MKSSKLFALAGVTLLAATTLAACSGSGSSTKGEKTFSYIYETDPD
FT                   NLNYLTTAKAATANITSNVVDGLLENDRYGNFVPSMAEDWSVSKDGLTYTYTIRKDAKW
FT                   YTSEGEEYAAVKAQDFVTGLKYAADKKSDALYLVQESIKGLDAYVKGEIKDFSQVGIKA
FT                   LDEQTVQYTLNKPESFWNSKTTMGVLAPVNEEFLNSKGDDFAKATDPSSLLYNGPYLLK
FT                   SIVTKSSVEFAKNPNYWDKDNVHIDKVKLSFWDGQDTSKPAENFKDGSLTAARLYPTSA
FT                   SFAELEKSMKDNIVYTQQDSITYLVGTNIDRQSYKYTSKTSDEQKASTKKALLNKDFRQ
FT                   AIAFGFDRTAYASQLNGQTGASKILRNIFVPPTFVQADGKNFGDMVKEKLVTYGDEWKD
FT                   VNLADSQDGLYNPEKAKAEFAKAKSALQAEGVTFPIHLDMPVDQTATTKVQRVQSMKQS
FT                   LEATLGADNVIIDIQQLQKDEVNNITYFAENAAGEDWDLSDNVGWGPDFADPSTYLDII
FT                   KPSVGESTKTYLGFDSGEDNVAAKKVGLYDYEKLVTEAGDEATDVAKRYDKYAAAQAWL
FT                   TDSALIIPTTSRTGRPILSKMVPFTIPFALSGNKGTSEPVLYKYLELQDKAVTVDEYQK
FT                   AQEKWMKEKEESNKKAQEDLAKHVK"
FT   gene            360329..360520
FT                   /locus_tag="SPAP_0391"
FT   CDS_pept        360329..360520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0391"
FT                   /product="hypothetical protein"
FT                   /note="Operon 164 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83984"
FT                   /protein_id="ADM83984.1"
FT                   /translation="MQNIRKDLVFLLNAESFFTFVKKDSKCTDPQKLEPLFVRIEKIFV
FT                   NFTCFLLLSQLLFVILKV"
FT   gene            360626..365929
FT                   /locus_tag="SPAP_0392"
FT   CDS_pept        360626..365929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0392"
FT                   /product="hypothetical protein"
FT                   /note="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83985"
FT                   /protein_id="ADM83985.1"
FT                   /translation="MNKGLFEKRCKYSIRKFSLGVASVMIGAAFFGTSPVLADSVQSGS
FT                   TANLPADLATALATAKENDGRDFEAPKVGEDQGSPEVTDGPKTEEELLALEKEKPAEEK
FT                   PKEDKPAAAKPETPKTVTPEWQTVEKKEQKGTVTIREEKGVRYNQLSSTAQNDNAGKPA
FT                   LFEKKGLTVDANGNATVDLTFKDDSEKGKSRFGVFLKFKDTNNNVFVGYDKDGWFWEYK
FT                   SPTTSTWYRGSRVAAPETGSTNRLSITLKSDGQLNASNNDVNLFDTVTLPAAVNDHLKN
FT                   EKKILLKAGSYGNDRTVVSVKTDNQEGVKADDTPAQKETGSVVDDSKVTYDTIQSKVLK
FT                   AVIDQAFPRVKEYTLNGHTLPGQVQQFNQVFINNHRITPEVTYKKINETTAEYLMKIRD
FT                   DAHLINAEMTVRLQVVDNQLHFDVTKIVNHNQVTPGQKIDDERKLLSSISFLGNALVSV
FT                   SSDQTGAKFDGATMSNNTHVSGDDHIDVTNPMKDLAKGYMYGFVSTDKLAAGVWSNSQN
FT                   SYGGGSNDWTRLTAYKETVGNANYVGIHSSEWQWEKAYKGIVFPEYTKELPRAKVVITE
FT                   DANADKKVDWQDGAIAYRSIMNNPQGWEKVKDITAYRIAMNFGSQAQNPFLMTLDGIKK
FT                   INLHTDGLGQGVLLKGYGSEGHDSGHLNYADIGKRIGGVEDFKTLIEKAKKYGAHLGIH
FT                   VNASETYPESKYFNEKILRKNPDGSYSYGWNWLDQGINIDAAYDLAHGRLARWEDLKKK
FT                   LGDGLDFIYVDVWGNGQSGDNGAWATHVLAKEINKQGWRFAIEWGHGGEYDSTFHHWAA
FT                   DLTYGGYTNKGINSAITRFIRNHQKDAWVGDYRSYGGAANYPLLGGYSMKDFEGWQGRS
FT                   DYNGYVTNLFAHDVMTKYFQHFTVSKWENGTPVTMTDNGSTYKWTPEMRVELVDTDNNK
FT                   VVVTRKSNDVNSPQYRERTVTLNGRVIQDGSAYLTPWNWDANGKKLSTDKEKMYYFNTQ
FT                   AGATTWTLPSDWAKSKVYLYKLTDQGKTEEQKLTVKDGKITLDLLANQPYVLYRSKQTN
FT                   PEMSWSEGMHIYDQGFNSGTLKHWTISGDASKAEIVKSQGANDMLRIQGNKEKVSLTQK
FT                   LTGLKPNTKYAVYVGVDNRSNAKASITVNTGEKEVTTYTNKSLALNYVKAYAHNTRRNN
FT                   ATVDDTSYFQNMYAFFTTGSDVSNVTLTLSREAGDQATYFDEIRTFENNSSMYGDKHDT
FT                   GKGTFKQDFENVAQGIFPFVVGGVEGVEDNRTHLSEKHDPYTQRGWNGKKVDDVIEGNW
FT                   SLKTNGLVSRRNLVYQTIPQNFRFEAGKTYRVTFEYEAGSDNTYAFVVGKGEFQSGRRG
FT                   TQASNLEMHELPNTWTDSKKAKKATFLVTGAETGDTWVGIYSTGNASNTRGDSGGNANF
FT                   RGYNDFMMDNLQIEEITLTGKMLTENALKNYLPTVAMTNYTKESMDALKEAVFNLSQAD
FT                   DDISVEEARAEIAKIEALKNALVQKRTALVADDFESLDAPAQPGEGLENAFDGNVSSLW
FT                   HTSWNGGDVGKPATMVLKEPTEITGLRYVPRGSGSNGNLRDVKLVVTDESGKEHTFTAT
FT                   DWPDNNKPKDIDFGKTIKAKKIVLTGTKTYGDGGDKYQSAAELIFTRPQVAETPLDLSG
FT                   YEAALAKVQKLTDKDNQEEVASVQASMKYATDNHLLTERMVEYFADYLNQLKDSATKPD
FT                   APIVEKPEFKLNSLASEQGKTPDYKQEIARPETPAQILPATGESQSDTALFLAGVSLAL
FT                   SALFVVKTKKD"
FT   gene            complement(366096..368255)
FT                   /locus_tag="SPAP_0393"
FT   CDS_pept        complement(366096..368255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0393"
FT                   /product="Membrane carboxypeptidase (penicillin-binding
FT                   protein)"
FT                   /note="Operon 166 Gene 1 COG0744 Membrane carboxypeptidase
FT                   (penicillin-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83986"
FT                   /protein_id="ADM83986.1"
FT                   /translation="MNKPTILRLIKYLSISFLSLVIAAIVLGGGVFFYYVSKAPSLSES
FT                   KLVATTSSKIYDNKNQLIADLGSERRVNAQANDIPTDLVKAIVSIEDHRFFDHRGIDTI
FT                   RILGAFLRNLQSNSLQGGSTLTQQLIKLTYFSTSTSDQTISRKAQEAWLAIQLEQKATK
FT                   QEILTYYINKVYMSNGNYGMQTAAQNYYGKDLNNLSLPQLALLAGMPQAPNQYDPYSHP
FT                   EAAQDRRNLVLSEMKNQGYISAEQYEKAVNTPITDGLQSLKSASNYPAYMDNYLKEVIN
FT                   QVEEETGYNLLTTGMDVYTNVDQEAQKHLWDIYNTDEYVAYPDDELQVASTIVDVSNGK
FT                   VIAQLGARHQSSNVSFGINQAVETNRDWGSTMKPITDYAPALEYGVYDSTATIVHDEPY
FT                   NYPGTNTPVYNWDRGYFGNITLQYALQQSRNVPAVETLNKVGLNRAKTFLNGLGIDYPS
FT                   IHYSNAISSNTTESDKKYGASSEKMAAAYAAFANGGTYYKPMYIHKVVFSDGSEKEFSN
FT                   VGTRAMKETTAYMMTDMMKTVLSYGTGRNAYLAWLPQAGKTGTSNYTDEEIENHIKTSQ
FT                   FVAPDELFAGYTRKYSMAVWTGYSNRLTPLVGNGLTVAAKVYRSMMTYLSEGSNPEDWN
FT                   IPEGLYRNGEFVFKNGARSTWNSPAPQQPPSTESSSSSSDSSTSQSSSTTPSTNNSTTT
FT                   NPNNNTQQSNTTPDQQNQNPQPAQP"
FT   gene            complement(368252..368848)
FT                   /locus_tag="SPAP_0394"
FT   CDS_pept        complement(368252..368848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0394"
FT                   /product="Penicillin-binding protein-related factor A,
FT                   putative recombinase"
FT                   /note="Operon 166 Gene 2 COG3331 Penicillin-binding
FT                   protein-related factor A, putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83987"
FT                   /protein_id="ADM83987.1"
FT                   /translation="MVNYPHKVSSQKRQTSLSQPKNFANRGMSFEKMINATNDYYLSQG
FT                   LAVIHKKPTPIQIVQVDYPQRSRAKIVEAYFRQASTTDYSGVYNGYYIDFEVKETKQKR
FT                   AIPMKNFHPHQIQHMEQVLAQQGICFVLLHFSSQQETYLLPAFDLIRFYHQDKGQKSMP
FT                   LEYIREYGYEIKAGAFPQIPYLNVIKEHLLGGKTR"
FT   gene            368914..369441
FT                   /locus_tag="SPAP_0395"
FT   CDS_pept        368914..369441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0395"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 167 Gene 1 COG4474 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83988"
FT                   /protein_id="ADM83988.1"
FT                   /translation="MATALVLGYSAFDLGLFSDKDPRLKLIKKAIRKDLEAMAADGVSW
FT                   LVFTGSLGFEYWILEVAQEMKTEYGFQLATIFAFETHGENWNEGNQMKLSRFKQVDFVK
FT                   YAYPRYEHKGQLRDYQQFLLENTTSSYLFYDEENETKLAYFYQKMKNQEDYFIKRLTFD
FT                   QLNELAENFSEN"
FT   gene            369499..369840
FT                   /locus_tag="SPAP_0396"
FT   CDS_pept        369499..369840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0396"
FT                   /product="Cell division initiation protein"
FT                   /note="Operon 167 Gene 2 COG3599 Cell division initiation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83989"
FT                   /protein_id="ADM83989.1"
FT                   /translation="MERDMASIIFSAKDIFEQEFGREVRGYNKVEVDEFLDDVIKDYET
FT                   YAALVKSLRQEIADLKEELTRKPKPSPVQAEPLEAAITSSMTNFDILKRLNRLEKEVFG
FT                   KQILDNSDF"
FT   gene            complement(369829..370038)
FT                   /locus_tag="SPAP_0397"
FT   CDS_pept        complement(369829..370038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0397"
FT                   /product="hypothetical protein"
FT                   /note="Operon 168 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83990"
FT                   /protein_id="ADM83990.1"
FT                   /translation="MALSSLLWPIQGLSHFNCRNDFSSLGLWFRLAQTLQASQPVLAWT
FT                   FLMRSNSPHAIIQKLHISNNYLKI"
FT   gene            370326..371483
FT                   /locus_tag="SPAP_0398"
FT   CDS_pept        370326..371483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0398"
FT                   /product="Predicted N6-adenine-specific DNA methylase"
FT                   /note="Operon 169 Gene 1 COG0116 Predicted
FT                   N6-adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83991"
FT                   /protein_id="ADM83991.1"
FT                   /translation="MKKEFNLIATVAAGLEAVVGREVRELGYDCQVENGRVRFQGDVRA
FT                   IIETNLWLRAADRIKIIVGTFPAKTFEELFQGVFALDWENYLPLGARFPISKAKCVKSK
FT                   LHNEPSVQAISKKAVVKKLQKHYARPEGVPLMENGPEFKIEVSILKDVATVMIDTTGSS
FT                   LFKRGYRTEKGGAPIKENMAAAILQLSNWYPDKPLIDPTCGSGTFCIEAVMIARKMAPG
FT                   LRRSFAFEEWNWISDRLIQEVRTEAAKKVDRELELDIMGCDIDARMVEIAKANAQAAGV
FT                   AGDITFKQMRVQDLRSDKINGVIISNPPYGERLSDDAGVTKLYAEMGQVFAPLKTWSKF
FT                   ILTSDEAFESKYGSQADKKRKLYNGTLKVDLYQYFGQRVKRQEVK"
FT   gene            371496..372890
FT                   /locus_tag="SPAP_0399"
FT   CDS_pept        371496..372890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0399"
FT                   /product="hypothetical protein"
FT                   /note="Operon 169 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83992"
FT                   /protein_id="ADM83992.1"
FT                   /translation="MSKKRRNRHKKEGQEPQFDFDEAKELTVGQAIRKNEEVEAGVLPE
FT                   DSILDKYVKQHRDEIEADKFATRQYKKEEFVETQSLDDLIQEMREAVEKSEASSEEVPS
FT                   SEDILLPLPLDDEEQGLDPLLLDDENPTEMTEEVEEEQNLSRLDQEDSEKKSKKGFILT
FT                   VLALVSVIICVSAYYVYRQVARSTKEIETSQSTTANQSDVDDFNTLYDAFYTDSNKTAL
FT                   KNSQFDKLNQLKTLLDKLEGSREHTLAKSKYDSLATQIKAIQDVNAQFEKPAIVDGVLD
FT                   TNAKAKSDAKFTDIKTGNTELDKVLDKAISLGKSQQTSTSSSSSSQTSSSSSSQASSNT
FT                   TSEPKPSSSNETRSSRSEVNMGLSSAGVAVQRSASRVAYNQSAIDDSNNSAWDFADGVL
FT                   EQILATSRSRGYITGDQYILERVNIVNGNGYYNLYKPDGTYLFTLNCKTGYFVGNGAGH
FT                   ADDLDY"
FT   gene            372966..374390
FT                   /locus_tag="SPAP_0400"
FT   CDS_pept        372966..374390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0400"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /note="Operon 169 Gene 3 COG0362 6-phosphogluconate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83993"
FT                   /protein_id="ADM83993.1"
FT                   /translation="MTKANFGVVGMAVMGRNLALNIESRGYTVAIYNRSKEKTEDVIAC
FT                   HPEKNFVPSYDVESFVNSIEKPRRIMLMVQAGPGTDATIQALLPHLDKGDILIDGGNTF
FT                   YKDTIRRNEELANSGINFIGTGVSGGEKGALEGPSIMPGGQKEAYELVSDVLEEISAKA
FT                   PEDGKPCVTYIGPDGAGHYVKMVHNGIEYGDMQLIAESYDLMQHLLGLSAEDMAEIFTE
FT                   WNKGELDSYLIEITADILSRKDDEGQDGPIVDYILDAAGNKGTGKWTSQSSLDLGVPLS
FT                   LITESVFARYISTYKEERVHASKVLPKPAAFNFEGDKAELIEKIRQALYFSKIISYAQG
FT                   FAQLRVASKENNWNLPFADIASIWRDGCIIRSRFLQKITDAYNRDADLANLLLDEYFLD
FT                   VTAKYQQAVRDIVALAVQAGVPVPTFSAAITYFDSYRSADLPANLIQAQRDYFGAHTYQ
FT                   RKDKEGTFHYSWYDEK"
FT   gene            374402..375091
FT                   /locus_tag="SPAP_0401"
FT   CDS_pept        374402..375091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0401"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /note="Operon 169 Gene 4 COG0745 Response regulators
FT                   consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83994"
FT                   /protein_id="ADM83994.1"
FT                   /translation="MGKRILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQT
FT                   DYDLILLNVNLGDMMAQDFAEKLSRTKPASVIMILDHWEDLQEELEVVQRFAVSYIYKP
FT                   VLIENLVARISAIFRGRDFIDQHCSLMKVPRTYRNLRIDVEHHTVYRGEEMIALTRREY
FT                   DLLATLMGSKKVLTREQLLESVWKYESATETNIVDVYIRYLRSKLDVKGQKSYIKTVRG
FT                   VGYTMQE"
FT   gene            375189..376208
FT                   /locus_tag="SPAP_0402"
FT   CDS_pept        375189..376208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0402"
FT                   /product="Choline binding protein F"
FT                   /note="Operon 169 Gene 5 COG5263 FOG: Choline binding
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83995"
FT                   /protein_id="ADM83995.1"
FT                   /translation="MKILKKMMQVLLAVFFFGLLATNTVFANTTGGRFVDKDNRKYYVK
FT                   DDHKAIYWHKIDGKTYYFGDGGEMVVGWQYLEIPGTGYRDNLFDNQPVNEIGLQEKWYY
FT                   FGQDGALLEQTDKQVLEAKTSENTGKVYGEQYPLSAEKRTYYFDNNYAVKTGWIYEDGN
FT                   WYYLNKLGNFGDDSYNPLPIGEVAKGWTQDFHVTIDIDRSKPAPWYYLDPTTGIMQTGW
FT                   QYLGNKWYYLRSSGAMATGWYQEGTTWYYLDQPNGDMKTGWQNLGNKWYYLRSSGARVT
FT                   GWVKDDSTWYYLNAGNGDMKTGWFQVNGRWYYAYSSGALAVNTTVDGYSVNYNGEWVR"
FT   gene            complement(376326..377582)
FT                   /locus_tag="SPAP_0403"
FT   CDS_pept        complement(376326..377582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0403"
FT                   /product="Permeases of the major facilitator superfamily"
FT                   /note="Operon 170 Gene 1 COG0477 Permeases of the major
FT                   facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83996"
FT                   /protein_id="ADM83996.1"
FT                   /translation="MCRHKEKSMKLFWTNNIYRQLLLNSCFSSFGDSIFYLAIINYVAQ
FT                   YNFAPLAILLISISEMVPLLSQLFLGILGDFQENRVKHALCIAKIKILLYAILTVFLVL
FT                   SPFSLVSVIMIVIINLISDTLSYLSAYMMNALYISVIKDNLHDAMGFRQSLMRVVRIVA
FT                   NLAGAFLINVISIQTISLINTLTFVIAFLGLYVIRHTLYEVEKRIEMSHTALSFKKYFQ
FT                   HLKQSLAVLLRLKDTVILLFLTTSMIAILDVSPRLIALRFIQQTLAQLSIGQLLAMLSI
FT                   IISCGAILGNMTSSNLFKNIRFTHLLVFCEISLLALITSILCQAYIVIFMTSFISSTII
FT                   GILSPRLQAAVFAHIPSDKMGTVGSALSTVDILAPSLLSLLALSIASGVSVQLALIFLY
FT                   LILIALIFCQWLVTFNTHN"
FT   gene            complement(377717..378187)
FT                   /locus_tag="SPAP_0404"
FT   CDS_pept        complement(377717..378187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0404"
FT                   /product="Lantibiotic modifying enzyme"
FT                   /note="Operon 171 Gene 1 COG4403 Lantibiotic modifying
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83997"
FT                   /protein_id="ADM83997.1"
FT                   /translation="MTILLKLSSTIVYGEIYHYFLQRDTAKESILDYSFAHGYCGIAYA
FT                   LFAYSKVLEPSMFYNDLHTFHAELKKLLEKVTSNTENLGNLQLSWCEGISGIILYLCMY
FT                   DCDGNKDIISKYQEFVFNHHLKMMTGYCHGITSLLQTTVYNQNKLLMKKSNR"
FT   gene            complement(378087..378476)
FT                   /locus_tag="SPAP_0405"
FT   CDS_pept        complement(378087..378476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0405"
FT                   /product="Lantibiotic modifying enzyme"
FT                   /note="Operon 171 Gene 2 COG4403 Lantibiotic modifying
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83998"
FT                   /protein_id="ADM83998.1"
FT                   /translation="MYPPELDSKILSIIKKAVTIRTTHTYEYQYSLLFGDAGYLWLLLH
FT                   LFSISKNQYYLQLANVTSKKLIENYDTLEEIDFALGKSGVLLSLIKYYQFTNDNTLKTF
FT                   IHNSIWGNLSLFPTKRYSQRKHFRL"
FT   gene            378436..378630
FT                   /locus_tag="SPAP_0406"
FT   CDS_pept        378436..378630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0406"
FT                   /product="hypothetical protein"
FT                   /note="Operon 172 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADM83999"
FT                   /protein_id="ADM83999.1"
FT                   /translation="MIESILESSSGGYNLFRGNSSPAIPCWNDKLLTKFPNSVEEVILP
FT                   SEFTVLSSKNRRTLLHSVL"
FT   gene            379088..379417
FT                   /locus_tag="SPAP_0407"
FT   CDS_pept        379088..379417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0407"
FT                   /product="Choline binding protein C"
FT                   /note="Operon 173 Gene 1 COG5263 FOG: Choline binding
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84000"
FT                   /protein_id="ADM84000.1"
FT                   /translation="MTRKAYDTDLNDQEWAKIEPYFSKHRTYKWPKRVLVNETLYVTKT
FT                   GCQWRMLPHDFPLYLMVWSFFHRSMTTGWFQVNGRWYYAYSSGALAVNTTVDGYSVNYN
FT                   GEWVQ"
FT   gene            379539..380417
FT                   /locus_tag="SPAP_0408"
FT   CDS_pept        379539..380417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0408"
FT                   /product="Mevalonate kinase"
FT                   /note="Operon 174 Gene 1 COG1577 Mevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84001"
FT                   /protein_id="ADM84001.1"
FT                   /translation="MTKKVGVGQAHSKIILIGEHAVVYGYPAISLPLLEVEVTCKVVPA
FT                   ESPWRLYEEDTLSMAVYASLEYLDITEACIRCEIDSAIPEKRGMGSSAAISIAAIRAVF
FT                   DYYQADLPHDVLEILVNRAEMIAHMNPSGLDAKTCLSDQPIRFIKNVGFTELEMDLSAY
FT                   LVIADTGVYGHTREAIQVVQNKGKDALPFLHALGELTQQAEVAISQKDAEGLGQILSQA
FT                   HLHLKEIGVSSPEADFLVETTLSHGALGAKMSGGGLGGCIIALVTNLTHAQELAERLEE
FT                   KGAVQTWIESL"
FT   gene            380399..381352
FT                   /locus_tag="SPAP_0409"
FT   CDS_pept        380399..381352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0409"
FT                   /product="Mevalonate pyrophosphate decarboxylase"
FT                   /note="Operon 174 Gene 2 COG3407 Mevalonate pyrophosphate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84002"
FT                   /protein_id="ADM84002.1"
FT                   /translation="MDREPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTE
FT                   TTLSPLPANVTADEFYINGQLQNEVEHAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGL
FT                   SSSSSGLSALVKACNAYFKLGLDRSQLAQEAKFASGSSSRSFYGPLGAWDKDSGEIYPV
FT                   ETDLKLAMIMLVLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDF
FT                   AKIGELTEKNALAMHATTKTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNV
FT                   KVFCQEKDLEHLSEIFGQRYRLIVSKTKDLSQDDCC"
FT   gene            381339..382346
FT                   /locus_tag="SPAP_0410"
FT   CDS_pept        381339..382346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0410"
FT                   /product="Mevalonate kinase"
FT                   /note="Operon 174 Gene 3 COG1577 Mevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84003"
FT                   /protein_id="ADM84003.1"
FT                   /translation="MIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYR
FT                   IYSDMFDFAVDLRPNPDYSLIQETIALMGDFLAVRGQNLRPFSLEICGKMEREGKKFGL
FT                   GSSGSVVVLVVKALLALYDVSVDQELLFKLTSAVLLKRGDNGSMGDLACIVAEDLVLYQ
FT                   SFDRQKVAAWLEEENLATVLERDWGFSISQVKPTLECDFLVGWTKEVAVSSHMVQQIKQ
FT                   NINQNFLTSSKETVTSLVEALEQGKSEKIIDQVEVASKLLEGLSTDIYTPLLRQLKEAS
FT                   QDLQTVAKSSGAGGGDCGIALSFDAQSTKTLKNRWADLGIELLYQERIGHDDKS"
FT   gene            382330..383340
FT                   /locus_tag="SPAP_0411"
FT   CDS_pept        382330..383340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0411"
FT                   /product="L-lactate dehydrogenase (FMN-dependent)-like
FT                   alpha-hydroxy acid dehydrogenase"
FT                   /note="Operon 174 Gene 4 COG1304 L-lactate dehydrogenase
FT                   (FMN-dependent) and related alpha-hydroxy acid
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84004"
FT                   /protein_id="ADM84004.1"
FT                   /translation="MTTNRKDEHILYALEQKSSYNSFDEVELIHSSLPLYNLDEIDLST
FT                   EFAGRKWDFPFYINAMTGGSNKGREINQKLAQVAESCGILFVTGSYSAALKNPTDDSFS
FT                   VKSSHPNLLLGTNIGLDKPVELGLQTVEEMNPVLLQVHVNVMQELLMPEGERKFRSWQS
FT                   HLADYSKQIPVPIVLKEVGFGMDAKTIERAYEFGVRTVDLSGRGGTSFAYIENRRSGQR
FT                   DYLNQWGQSTMQALLNAQEWKDKVELLVSGGVRNPLDMIKCLVFGAKAVGLSRTVLELV
FT                   ETYTVEEVIGIVQGWKADLRLIMCSLNCATIADLQKVDYLLYGKLKEAKDQMKKA"
FT   gene            383417..384115
FT                   /locus_tag="SPAP_0412"
FT   CDS_pept        383417..384115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0412"
FT                   /product="Predicted membrane protein"
FT                   /note="Operon 174 Gene 5 COG4758 Predicted membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84005"
FT                   /protein_id="ADM84005.1"
FT                   /translation="MRKFKIFLFIEACLLTGALILMVSEHFSRFLLILFLFLLLIRYYT
FT                   GKEGNNLLLVAATILFFFIVMLNPFVILAIFVAVIYSLFLLYPMMNQEKEQTNLVFEEV
FT                   VTVKKEKNRWFGNLHHFSSYQTCQFDDINLFRFMGKDTIHLERVILTNHDNVIILRKMV
FT                   GTTKIIVPVDVEVSLSVNCLYGDLIFFNQPKRALRNEHYHQETKDYLKSNKSVKIFLTT
FT                   MIGDVEVVRG"
FT   gene            384112..385107
FT                   /locus_tag="SPAP_0413"
FT   CDS_pept        384112..385107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0413"
FT                   /product="Signal transduction histidine kinase"
FT                   /note="Operon 174 Gene 6 COG4585 Signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84006"
FT                   /protein_id="ADM84006.1"
FT                   /translation="MKKQAYVIIALTSFLFVFFFSHSLLEILDFDWSIFLHDVEKTEKF
FT                   VFLLLVFSMSMTCLLALFWRGIEELSLRKMQANLKRLLAGQEVVQVADPDLDASFKSLS
FT                   GKLNLLTEALQKAENQSLAQEEEIIEKERKRIARDLHDTVSQELFAAHMILSGISQQAL
FT                   KLDREKMQTQLQSVTAILETAQKDLRVLLLHLRPVELEQKSLIEGIQILLKELEDKSDL
FT                   RVSLKQNMTKLPKKIEEHIFRILQELISNTLRHAQASCLDVYLYQTDVELQLKVVDNGI
FT                   GFQLGSLDDLSYGLRNIKERVEDMAGTVQLLTAPKQGLAVDIRIPLLDKE"
FT   gene            385121..385753
FT                   /locus_tag="SPAP_0414"
FT   CDS_pept        385121..385753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0414"
FT                   /product="Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /note="Operon 174 Gene 7 COG2197 Response regulator
FT                   containing a CheY-like receiver domain and an HTH
FT                   DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84007"
FT                   /protein_id="ADM84007.1"
FT                   /translation="MKILLVDDHEMVRLGLKSYFDLQDDVEVVGEASNGSQGIDLALEL
FT                   RPDVIVMDIVMPEMNGIDATLAILKEWPEAKILIVTSYLDNEKIMPVLDAGAKGYMLKT
FT                   SSADELLHAVSKVAAGELAIEQEVSKKVEYHRNHMELHEELTARERDVLQLIAKGYENQ
FT                   RIADDLFISLKTVKTHVSNILAKLEVSDRTQAAVYAFQHHLVGQEEF"
FT   gene            385754..385963
FT                   /locus_tag="SPAP_0415"
FT   CDS_pept        385754..385963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0415"
FT                   /product="hypothetical protein"
FT                   /note="Operon 174 Gene 8 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84008"
FT                   /protein_id="ADM84008.1"
FT                   /translation="MSLADLLEELEAAKDSKKARSMEAYMRHQFSFLGIAVPERNKLYK
FT                   IFSRSEKNKDYRLGFCRHLLGKGS"
FT   gene            386346..386522
FT                   /locus_tag="SPAP_0416"
FT   CDS_pept        386346..386522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0416"
FT                   /product="Predicted DNA alkylation repair enzyme"
FT                   /note="Operon 175 Gene 1 COG4912 Predicted DNA alkylation
FT                   repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84009"
FT                   /protein_id="ADM84009.1"
FT                   /translation="MEKILLHNLNQTEFFINKAIGWTLRDYSKTNPTWVTCFIEKNKER
FT                   MAELSIKEASKYL"
FT   gene            386672..387586
FT                   /locus_tag="SPAP_0417"
FT   CDS_pept        386672..387586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0417"
FT                   /product="V8-like Glu-specific endopeptidase"
FT                   /note="Operon 176 Gene 1 COG3591 V8-like Glu-specific
FT                   endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84010"
FT                   /protein_id="ADM84010.1"
FT                   /translation="MKKTIYKKLGISIIASTLLASQLSTVSALSVISSTGEEYEVSETL
FT                   QDSPGTNNFSLPNVSPTYGQYYTNQSEVIIGKNDLVKVKNTLQYPYSTSAYVESEFRGV
FT                   KNGKDVTYRGSANFIKDNVLITAAHNIYKHEFGKDAEELYVTPARTPNSVPFGRIKVKE
FT                   VRYLKEFRNLNSKDAREYDLALLILEEPIGAKLGTLGLPTSQKNLTGITVTITGYPSYN
FT                   FKIHQMYTDKKQVLSDDGMFLDYQVDTLEGSSGSTVYDASNRVVGVHTLGDGANQINSA
FT                   VKLNERNLPFIYSVLKGYSLEGW"
FT   gene            388014..388244
FT                   /locus_tag="SPAP_0418"
FT   CDS_pept        388014..388244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0418"
FT                   /product="hypothetical protein"
FT                   /note="Operon 177 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84011"
FT                   /protein_id="ADM84011.1"
FT                   /translation="MITCFNYFLKNRFRKSEIKKDDFVLTAHVFRYSHISLLAELEVPI
FT                   TAIMDRVDYTNETKILSVYTHVTEKMKSNIT"
FT   gene            388438..389721
FT                   /locus_tag="SPAP_0419"
FT   CDS_pept        388438..389721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0419"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (trigger factor)"
FT                   /note="Operon 178 Gene 1 COG0544 FKBP-type peptidyl-prolyl
FT                   cis-trans isomerase (trigger factor)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84012"
FT                   /protein_id="ADM84012.1"
FT                   /translation="MSVSFENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFR
FT                   KGHLPRPIFDKKFGEESLYQDVMNALLPNAYEAAVKEAGLEVVAQPKIDVTSMEKGQDW
FT                   VIAAEVVTKPEVKLGDYKNLEVSVDVEKEVTDADVEERIERERNNLAELVIKEAAAEDG
FT                   DTVVIDFVGSIDGVEFDGGKGENFSLGLGSGQFIPGFEDQLVGHSAGETVDVIVTFPED
FT                   YQAEDLAGKEAKFVTTIHEVKAKEVPALDDELAKDIDEEVETLADLKEKYRKELAAAKE
FT                   EAYKDAVEGAAIDTAVENAEIVELPEEMIHEEVHRSVNEFLGNLQRQGINPDMYFQITG
FT                   TTQEDLHNQYQAEAESRTKTNLVIEAVAKAEGFDASEEEIQKEVEQLAADYNMEVAQVQ
FT                   NLLSADMLKHDITIKKAVELITSTATVK"
FT   gene            complement(389769..390446)
FT                   /locus_tag="SPAP_0420"
FT   CDS_pept        complement(389769..390446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0420"
FT                   /product="ATP-dependent exoDNAse (exonuclease V), alpha
FT                   subunit-helicase superfamily I member"
FT                   /note="Operon 179 Gene 1 COG0507 ATP-dependent exoDNAse
FT                   (exonuclease V), alpha subunit - helicase superfamily I
FT                   member"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84013"
FT                   /protein_id="ADM84013.1"
FT                   /translation="MYRGTAGIDAINQLMQDLLNPPQKDQLSFEAPQCHYRKGDKVIHL
FT                   VNDAEINVFNGDLGAITDLIPGKYTESKQDEIVIDFDGNEVSYPRNEWYKIRLAYAMSI
FT                   HKSQGSEFPVVILPITSASRRMLERNLIYTAITRAKSKLILLGELQAFDYATQHIGTAR
FT                   KTYLIERFSDLLENVEEKQQAVSETVTSSASEQSYILTEENWDSIPAMIGITDTDLKEI
FT                   FGK"
FT   gene            complement(390500..392134)
FT                   /locus_tag="SPAP_0421"
FT   CDS_pept        complement(390500..392134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0421"
FT                   /product="ATP-dependent exoDNAse (exonuclease V), alpha
FT                   subunit-helicase superfamily I member"
FT                   /note="Operon 179 Gene 2 COG0507 ATP-dependent exoDNAse
FT                   (exonuclease V), alpha subunit - helicase superfamily I
FT                   member"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84014"
FT                   /protein_id="ADM84014.1"
FT                   /translation="MEVYFSGTIERIIFENPSNFYRILLLEIDDTDAEDFDDFEIIVTG
FT                   TMADVIEGEDYTFWGQIVQHSKYGEQLQISRYDRAKPTSKGLVKYFSSSHFKGIGLKTA
FT                   QKIVDTYGENTIDEILQHPEKLEGIAGLSAKNREAFVSTLRLNYGTEMVLSKLANYGIP
FT                   NKLAFQIQDFYKEETLDVVENYPYQLVEDIKGLGFTIADQLAEELGIESQAPERFRAGL
FT                   VHSLFQACMETGDTYVEARDLLEQTLTLLESSRPVELDPSQVAQELSYLIEEDKVQQID
FT                   TKIFDNSLFFAEEGIRSHLVRILEKGKQKSHDLETIQKHITTIEEELGIEYDNIQKQAI
FT                   CDAIQNKVFILTGGPGTGKTTVINGIIAVYALLEGLDFRKKSNLPILLAAPTGRAARRM
FT                   NELTGLPSATIHRHLGMTGDDDTSHLEDYLDADFIIVDEFSMVDTWLANQLFSNISSNS
FT                   KILIVGDSDQLPSVSPGQVLADLLHIPLIPQTHLEKIYRQSKESTIVTLASQIRQGILP
FT                   ADFTQKKLTVPTLKLLVAIFLPPLKKS"
FT   gene            complement(392413..392913)
FT                   /locus_tag="SPAP_0422"
FT   CDS_pept        complement(392413..392913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0422"
FT                   /product="Signal peptidase I"
FT                   /note="Operon 180 Gene 1 COG0681 Signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84015"
FT                   /protein_id="ADM84015.1"
FT                   /translation="MDPTLADGEILFVVKHLPIDRFDIVVAHEEDGNKDIVKRVIGMPG
FT                   DTIRYENDKLYINDKETDEPYLADYIKRFKDDKLQSTYSGKGFEGNKGTFFRSIAQKAQ
FT                   AFTVDVNYNTNFSFTVPEGEYLLLGDDRLVSSDSRHVGTFKAKDITGEAKFRFWPITRI
FT                   GTF"
FT   gene            complement(393031..393912)
FT                   /locus_tag="SPAP_0423"
FT   CDS_pept        complement(393031..393912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0423"
FT                   /product="Ribonuclease HIII"
FT                   /note="Operon 181 Gene 1 COG1039 Ribonuclease HIII"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84016"
FT                   /protein_id="ADM84016.1"
FT                   /translation="MASITLTPSEKDIQAFLEHYQTSLAPSKNPYIRYFLKLPQATVSI
FT                   YTSGKILLQGEGAEKYASFFGYQAVEQTSGQNLPLIGTDEVGNGSYFGGLAVVAAFVTP
FT                   DQHDFLRKLGVGDSKTLTDQKIRQIAPILKEKIQHQALLLSPSKYNEVIGDRYNAVSVK
FT                   VALHNQAIYLLLQKGVQPEKIVIDAFTSAKNYDKYLAQEANRFSNPISLEKKAEGKYLA
FT                   VAVSSVIARDLFLENLENLGRELGYQLPSGAGTASDKVASQILQAYGMQGLSFCAKLHF
FT                   KNTEKAKKRLER"
FT   gene            393999..394301
FT                   /locus_tag="SPAP_0424"
FT   CDS_pept        393999..394301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0424"
FT                   /product="hypothetical protein"
FT                   /note="Operon 182 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84017"
FT                   /protein_id="ADM84017.1"
FT                   /translation="MANLNRFKFTFGKKSLTLTSEHDNLFMEEIAKVATEKYQAIKEQM
FT                   PSADDETIALLLAVNCLSTQLSREIEFDDKEQELEELRHKLVTCKQEQSKIEDSL"
FT   gene            394298..394846
FT                   /locus_tag="SPAP_0425"
FT   CDS_pept        394298..394846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0425"
FT                   /product="Uncharacterized membrane protein, required for
FT                   colicin V production"
FT                   /note="Operon 182 Gene 2 COG1286 Uncharacterized membrane
FT                   protein, required for colicin V production"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84018"
FT                   /protein_id="ADM84018.1"
FT                   /translation="MISFLLLLVLVWGFYIGYRRGLLLQVYYLISAMASAFMAGQFYKG
FT                   LGEQFHLLLPYANSQEGQGTFFFPSDQLFQLDKVFYAGIGYLLVFGIVYSIGRLLGLLL
FT                   HLIPSKKLGGKLFQVSAGILSMLVTLFVLQMALTILATIPMAVIQNPLEKSIVAKHIIQ
FT                   SIPITTSWLKQIWVTNLIG"
FT   gene            394950..397286
FT                   /locus_tag="SPAP_0426"
FT   CDS_pept        394950..397286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0426"
FT                   /product="Mismatch repair ATPase (MutS family)"
FT                   /note="Operon 183 Gene 1 COG1193 Mismatch repair ATPase
FT                   (MutS family)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84019"
FT                   /protein_id="ADM84019.1"
FT                   /translation="MNKKILETLEFDKVKALFEPHLLTEQGLEQLRQLAPTAKADKIKQ
FT                   AFAEMKEMQALFVEQPHFTILSTKEIAGVCKRLEMGADLNIEEFLLLKRVLLASRELQS
FT                   FYANLENVSLEELALWFEKLHDFPQLQGNLQAFNDAGFIENFASEKLARIRRKIHDSES
FT                   QVRDVLQDLLKQKAQMLTEGIVASRNGRQVLPVKNTYRNKIAGVVHDISASGNTVYIEP
FT                   REVVKLSEEIASLRADERYEMLRILQEISERVRPHAAEIANDAWIIGHLDLIRAKVRFI
FT                   QERQAVVPQLSENQEIQLLHVCHPLVKNAVANDVHFGQDLTAIVITGPNTGGKTIMLKT
FT                   LGLTQVMAQSGLPILADKGSRVGIFEEIFADIGDEQSIEQSLSTFSSHMTNIVDILGKV
FT                   NQHSLLLLDELGAGTDPQEGAALAMAILEDLRLRQIKTMATTHYPELKAYGIETAFVQN
FT                   ASMEFDTATLRPTYRFMQGVPGRSNAFEIAKRLGLSEVIVGDASQQIDQDNDVNRIIEQ
FT                   LEEQTLESRKRLDNIREVEQENLKMNRALKKLYNELNREKETELNKAREQAAEIVDMAL
FT                   SESDQILKNLHSKSQLKPHEIIEAKAKLKKLAPEKVDLSKNKVLQKAKKKRAPKVGDDI
FT                   VVLSYGQRGTLTSQLKDGRWEAQVGLIKMTLEEKEFDLVQAQQEKPVKKKQVNVVKRTS
FT                   GRGPQARLDLRGKRYEEAMNELDIFIDQALLNNMAQVDIIHGIGTGVIREGVTKYLQRN
FT                   KHVKSFGYAPQNAGGSGATIVTFKG"
FT   gene            397629..398951
FT                   /locus_tag="SPAP_0427"
FT   CDS_pept        397629..398951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0427"
FT                   /product="Na+/alanine symporter"
FT                   /note="Operon 184 Gene 1 COG1115 Na+/alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84020"
FT                   /protein_id="ADM84020.1"
FT                   /translation="MLELLKSIDAFAWGPPLLILLVGTGIYLTIRLGLLQVLRLPKAFQ
FT                   LIFIQDKGHGDVSSFAALCTALASTVGTGNIIGVATAIKVGGPGALFWMWMAAFFGMAT
FT                   KYAEGLLAIKYRTKDDHGAVAGGPMHYILLGMGEKWRPLAVLFAVAGVLVALLGIGTFT
FT                   QVNSIAESIQNTTTISPAITALVLSVFVAIAVFGGLKSISKVSTTVVPFMAIIYILGTL
FT                   TVIFFNIGKIPGTIALVFTSAFSPLAAVGGFAGASVRMAIQNGVARGVFSNESGLGSAP
FT                   IAAAAAKTNEPVEQGLISMTGTFIDTLIICTLTGLTILVTGVWSGDLNGVALTQSAFST
FT                   VFSHFGPALLTIFLVLFAFTTILGWNYYGERCFEFLFGVRFIWLYRVVFVLMVLLGGFI
FT                   ELDMVWIIADIVNALMALPNLIALLVLSPVVIAETKKYFDK"
FT   gene            399169..399717
FT                   /locus_tag="SPAP_0428"
FT   CDS_pept        399169..399717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0428"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="Operon 185 Gene 1 COG2128 Uncharacterized conserved
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84021"
FT                   /protein_id="ADM84021.1"
FT                   /translation="MTTFTIHTVESAPAEVKEILETVEKDNNGYIPNLIGLLANAPTVL
FT                   EAYQIVSSIHRRNSLTPVEREVVQITAAVTNGCAFCVAGHTAFSIKQIQMNDDLIQALR
FT                   NRTPIETDPKLDTLAKFTLAVINTKGRVGDEALSEFLEAGYTQQNALDVVFGVSLAILC
FT                   NYANNLANTPINPELQPYA"
FT   gene            399827..400726
FT                   /locus_tag="SPAP_0429"
FT   CDS_pept        399827..400726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0429"
FT                   /product="Tellurite resistance protein-like permease"
FT                   /note="Operon 186 Gene 1 COG1275 Tellurite resistance
FT                   protein and related permeases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84022"
FT                   /protein_id="ADM84022.1"
FT                   /translation="MKKLPLVFSGCLLGLAGAGNLILDTLPVLSHLFSLTGLVLWIYFL
FT                   ILHLFNWKETKQELTKPPLLSGMATFPMAGMILSTYVFRVFSYLPLVAQGIWWFSFLLD
FT                   LTLIAGFTIKFACPGRRVHATPSWTVLYVGIAVAALTYPLVGIIEIAYATLSFGFLLTF
FT                   YLYPLIYSDLKKHPLPLALLGQEGIYCAPFSLLLASLVRVGGTSLPTWVLIVMILASQS
FT                   FFFFVLTRLPNILKQGFQPAFSALTFPTIITATSLKMAQGILKLPFLDYLVLAETIICL
FT                   TILFFVLGAYLIWLRKKV"
FT   gene            complement(400751..402025)
FT                   /locus_tag="SPAP_0430"
FT   CDS_pept        complement(400751..402025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0430"
FT                   /product="Seryl-tRNA synthetase"
FT                   /note="Operon 187 Gene 1 COG0172 Seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84023"
FT                   /protein_id="ADM84023.1"
FT                   /translation="MLDIKRIRTDFEAVAEKLATRGVDAAVLNEMKEIDAKRRNILVKV
FT                   ETLKAERNTVSAEIAQAKRNKENTDDKIAAMQNLSAEVKALDAELAEIDAKLTEFTTTL
FT                   PNIPADSVPVGADEDDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARF
FT                   LFYKGLGARLERAIYNFMLDEHGKEGYTEVITPYIVNHDSMFGTGQYPKFKEDTFELSD
FT                   TNFVLIPTAEVPLTNYYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFH
FT                   KVEMVKFAKPEESYEELEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWI
FT                   PAQNNYREISSCSNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENY
FT                   QNEDGSVTIPEALRPYMGGAEVIKP"
FT   gene            complement(402239..402610)
FT                   /locus_tag="SPAP_0431"
FT   CDS_pept        complement(402239..402610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0431"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 188 Gene 1 COG4687 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84024"
FT                   /protein_id="ADM84024.1"
FT                   /translation="MAQSLNKTVLLSTTGTSYLSIAGKVGKFLVGDQALEFYPDVNVEQ
FT                   FIQIPWSHINQIGANVTGCKISRHFEVFTDKGKFLFASKDSGAILKIAREKLGNDKVVK
FT                   LPTLIQTISQKFKNLFAKK"
FT   gene            complement(402613..403977)
FT                   /locus_tag="SPAP_0432"
FT   CDS_pept        complement(402613..403977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0432"
FT                   /product="Aspartokinase"
FT                   /note="Operon 188 Gene 2 COG0527 Aspartokinases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84025"
FT                   /protein_id="ADM84025.1"
FT                   /translation="MKVVKFGGSSLASASQLEKVLNIVKSDSERRFVVVSAPGKRNAED
FT                   TKVTDALIKYYRDYVAGNDISKSQSWIIDRYAAMVSELGLKPAVLEKISKSIHALATLP
FT                   IEENKFLYDTFLAAGENNNAKLIAAYFNQNGIDARYMHPREAGIVVTSEPGHARIIPSS
FT                   YDKIEELTNTNEVLVIPGFFGVTKENQICTFSRGGSDITGSIIAAGVKADLYENFTDVD
FT                   GIFAAHPGIIHQPHSIPELTYREMRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPD
FT                   HPGTRIVLKHSNDEFPVVGIAGDSGFVSINMSKYLMNREVGFGRKVLQILEELNIGWEH
FT                   MPTGIDDLSIILRSRQLTPIKEEEILRQLVQKAKVDHAEIEHDLSIIMIVGEKMKSHIG
FT                   VTATATRALSENKINIQMMSQGSSEVSIMFVVNKDQEKAAIKALYNAFFGESKED"
FT   gene            404302..405087
FT                   /locus_tag="SPAP_0433"
FT   CDS_pept        404302..405087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0433"
FT                   /product="Enoyl-CoA hydratase/carnithine racemase"
FT                   /note="Operon 189 Gene 1 COG1024 Enoyl-CoA
FT                   hydratase/carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84026"
FT                   /protein_id="ADM84026.1"
FT                   /translation="MEHIIYQLEEDLAILTLNRPEVANGFHIPMCEEILEALTLAEENP
FT                   AVHFILINANGKVFSVGGDLVEMKRAVDEDDIPSLTKIAELVNTISYKIKQIAKPVLME
FT                   VDGAVAGAAANMAVAADFCLATDKAKFIQAFVGVGLAPDAGGIHLLSRSIGVTRAAQLA
FT                   MTGEALTAEKALEWGLVYRVSEAEKLEKTREQLLKKLRRASSNSYAAIKKLVWESQFKD
FT                   WQGYATLELNLQKSLAQTEDFKEGVRAHSERRRPKFTGK"
FT   gene            405181..405615
FT                   /locus_tag="SPAP_0434"
FT   CDS_pept        405181..405615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0434"
FT                   /product="Transcriptional regulator"
FT                   /note="Operon 189 Gene 2 COG1846 Transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84027"
FT                   /protein_id="ADM84027.1"
FT                   /translation="MDYQRINEYLTSIFNNVLVIEEVNLRGSRFKDISIKEMHTIDVIG
FT                   KAPDVTPSQVSKELMVTLGTVTTSLNNLERKGYIERVRSEQDRRVVHLHLTKKGRLIHR
FT                   LHKRFHKAMVEKIIDGMSEEEIAVMGKGLTNLYQFLEDLK"
FT   gene            405615..406589
FT                   /locus_tag="SPAP_0435"
FT   CDS_pept        405615..406589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0435"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /note="Operon 189 Gene 3 COG0332
FT                   3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84028"
FT                   /protein_id="ADM84028.1"
FT                   /translation="MAFAKISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHI
FT                   SRTESTSDLATEVAKKLMAKAGITGKELDFIILATITPDSMMPSTAARVQANIGANKAF
FT                   AFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSETLSKAVDWSDRSTAVLFGDGAGG
FT                   VLLEASEQEHFLAESLNSDGSRSECLTYGHSGLHSPFSDQESADSFLKMDGRTVFDFAI
FT                   RDVAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEYGNTS
FT                   AASIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI"
FT   gene            406649..406873
FT                   /locus_tag="SPAP_0436"
FT   CDS_pept        406649..406873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0436"
FT                   /product="Acyl carrier protein"
FT                   /note="Operon 189 Gene 4 COG0236 Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84029"
FT                   /protein_id="ADM84029.1"
FT                   /translation="MAVFEKVQEIIVEELGKDASEVTLESTFDDLDADSLDLFQVISEI
FT                   EDAFDIQIEAENDLKTVGDLVAYVEEQAK"
FT   gene            406992..407966
FT                   /locus_tag="SPAP_0437"
FT   CDS_pept        406992..407966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0437"
FT                   /product="dioxygenase"
FT                   /note="Operon 190 Gene 1 COG2070 Dioxygenases related to
FT                   2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84030"
FT                   /protein_id="ADM84030.1"
FT                   /translation="MKTRITELLKIDYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGGN
FT                   APKEVVKANIDKIKSLTDKPFGVNIMLLSPFVEDIVDLVIEEGVKVVTTGAGNPSKYME
FT                   RFHEAGIIVIPVVPSVALAKRMEKIGADAVIAEGMEAGGHIGKLTTMTLVRQVATAISI
FT                   PVIAAGGIADGEGAAAGFMLGAEAVQVGTRFVVAKESNAHPNYKEKILKARDIDTTISA
FT                   QHFGHAVRAIKNQLTRDFELAEKDAFKQEDPDLEIFEQMGAGALAKAVVHGDVDGGSVM
FT                   AGQIAGLVSKEETAEEILKDLYYGAAKKIQEEASRWAGVVRND"
FT   gene            407959..408879
FT                   /locus_tag="SPAP_0438"
FT   CDS_pept        407959..408879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0438"
FT                   /product="(acyl-carrier-protein) S-malonyltransferase"
FT                   /note="Operon 190 Gene 2 COG0331 (acyl-carrier-protein)
FT                   S-malonyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84031"
FT                   /protein_id="ADM84031.1"
FT                   /translation="MTKTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLR
FT                   YLIDTEEDKLNQTRYTQPAILATSVAIYRLLQEKGYQPDMVAGLSLGEYSALVASGALD
FT                   FEDAVALVAKRGAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPA
FT                   QIVIAGEVVAVDRAVELLQEAGAKRLIPLKVSGPFHTALLEPASQKLAETLAQVSFSDF
FT                   TCPLVGNTEAAVMQKEDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGF
FT                   VKKIDQTAHLAHVEDQASLVALLEK"
FT   gene            408913..409644
FT                   /locus_tag="SPAP_0439"
FT   CDS_pept        408913..409644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0439"
FT                   /product="dehydrogenase"
FT                   /note="Operon 190 Gene 3 COG1028 Dehydrogenases with
FT                   different specificities (related to short-chain alcohol
FT                   dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84032"
FT                   /protein_id="ADM84032.1"
FT                   /translation="MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELL
FT                   AEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEAD
FT                   FEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGF
FT                   TKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTV
FT                   FLAGQDYLTGQVVAIDGGLSM"
FT   gene            409666..410901
FT                   /locus_tag="SPAP_0440"
FT   CDS_pept        409666..410901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0440"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /note="Operon 190 Gene 4 COG0304
FT                   3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84033"
FT                   /protein_id="ADM84033.1"
FT                   /translation="MKLNRVVVTGYGVTSPIGNTPEEFWNSLATGKIGIGGITKFDHSD
FT                   FDVHNAAEIQDFPFDKYFVKKDTNRFDNYSLYALYAAQEAVNHANLDVEALNRDRFGVI
FT                   VASGIGGIKEIEDQVLRLHEKGPKRVKPMTLPKALPNMASGNVAMRFGANGVCKSINTA
FT                   CSSSNDAIGDAFRSIKFGFQDVMLVGGTEASITPFAIAGFQALTALSTTEDPTRASIPF
FT                   DKDRNGFVMGEGSGMLVLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPHPEGQGAIK
FT                   AIKLALEEAEISPEQVAYVNAHGTSTPANEKGESGAIVAVLGKEVPVSSTKSFTGHLLG
FT                   AAGAVEAIVTIEAMRHNFVPMTAGTSEVSDYIEANVVYGQGLEKEIPYAISNTFGFGGH
FT                   NAVLAFKRWENR"
FT   gene            410904..411389
FT                   /locus_tag="SPAP_0441"
FT   CDS_pept        410904..411389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0441"
FT                   /product="Biotin carboxyl carrier protein"
FT                   /note="Operon 190 Gene 5 COG0511 Biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84034"
FT                   /protein_id="ADM84034.1"
FT                   /translation="MNLNDIKDLMTQFDQSSLREFSYKNGTDELQFSKNEARPVPEVAT
FT                   QVAPAPVLATPSPVAPTSAPAETVAEEVPAPAEASVASEGNLVESPLVGVVYLAAGPDK
FT                   PAFVTVGDSVKKGQTLVIIEAMKVMNEIPAPKDGVVTEILVSNEEMVEFGKGLVRIK"
FT   gene            411386..411808
FT                   /locus_tag="SPAP_0442"
FT   CDS_pept        411386..411808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0442"
FT                   /product="3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratase"
FT                   /note="Operon 190 Gene 6 COG0764
FT                   3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
FT                   dehydratases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84035"
FT                   /protein_id="ADM84035.1"
FT                   /translation="MIDIQGIKEALPHRYPMLLVDRVLEVSEDTIVAIKNVTINEPFFN
FT                   GHFPQYPVMPGVLIMEALAQTAGVLELSKPENKGKLVFYAGMDKVKFKKQVVPGDQLVM
FT                   TATFVKRRGTIAVVEAKAEVDGKLAASGILTFAIGN"
FT   gene            411820..413187
FT                   /locus_tag="SPAP_0443"
FT   CDS_pept        411820..413187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0443"
FT                   /product="Biotin carboxylase"
FT                   /note="Operon 190 Gene 7 COG0439 Biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84036"
FT                   /protein_id="ADM84036.1"
FT                   /translation="MFRKILIANRGEIAVRIIRAARELGIATVAVYSTADKEALHTLLA
FT                   DEAVCIGPGKATESYLNINAVLSAAVLTEAEAIHPGFGFLSENSKFATMCEEVGIKFIG
FT                   PSGHVMDMMGDKINARAQMIKAGVPVIPGSDGEVHNSEEALIVAEKIGYPVMLKASAGG
FT                   GGKGIRKVEKPDDLVSAFETASSEAKANYGNGAMYIERVIYPARHIEVQILGDEHGHVI
FT                   HLGERDCSLQRNNQKVLEESPSIAIGKTLRHEIGAAAVRAAEFVGYENAGTIEFLLDEA
FT                   SSNFYFMEMNTRVQVEHPVTEFVSGVDIVKEQICIAAGQPLSVKQEDIVLRGHAIECRI
FT                   NAENPAFNFAPSPGKITNLYLPSGGVGLRVDSAVYPGYTIPPYYDSMIAKIIVHGENRF
FT                   DALMKMQRALYELEIEGVQTNADFQLDLISDRNVIAGDYDTSFLMETFLPKYQEKE"
FT   gene            413224..414090
FT                   /locus_tag="SPAP_0444"
FT   CDS_pept        413224..414090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0444"
FT                   /product="Acetyl-CoA carboxylase beta subunit"
FT                   /note="Operon 190 Gene 8 COG0777 Acetyl-CoA carboxylase
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84037"
FT                   /protein_id="ADM84037.1"
FT                   /translation="MALFSKKDKYIRINPNRSVREKPQAKPEVPDELFSQCPGCKHTIY
FT                   QKDLGSERICPHCSYTFRISAQERLALTIDMGTFKELFTGIESKDPLHFPGYQKKLASM
FT                   REKTGLHEAVVTGTALIKGQTVALGIMDSNFIMASMGTVVGEKITRLFEYATVEKLPVV
FT                   LFTASGGARMQEGIMSLMQMAKISAAVKRHSNAGLFYLTILTDPTTGGVTASFAMEGDI
FT                   ILAEPQSLVGFAGRRVIENTVRESLPEDFQKAEFLLEHGFVDAIVKRRDLPDTIASLVR
FT                   LHGGSPR"
FT   gene            414087..414854
FT                   /locus_tag="SPAP_0445"
FT   CDS_pept        414087..414854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0445"
FT                   /product="Acetyl-CoA carboxylase alpha subunit"
FT                   /note="Operon 190 Gene 9 COG0825 Acetyl-CoA carboxylase
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84038"
FT                   /protein_id="ADM84038.1"
FT                   /translation="MNIAKIVREAREQSRLTTLDFATGIFDEFIQLHGDRSFRDDGAVV
FT                   GGIGWLGDQAVTVVGIQKGKSLQDNLKRNFGQPHPEGYRKALRLMKQAEKFGRPVVTFI
FT                   NTAGAYPGVGAEERGQGEAIARNLMEMSDLKVPIIAIIIGEGGSGGALALAVADRVWML
FT                   ENSIYAILSPEGFASILWKDGTRAMEAAELMKITSHELLEMDVVDKVISEIGLSSKELI
FT                   KSVKKELQTELARLSQKPLEELLEERYQRFRKY"
FT   gene            415013..415198
FT                   /locus_tag="SPAP_0446"
FT   CDS_pept        415013..415198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0446"
FT                   /product="hypothetical protein"
FT                   /note="Operon 191 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84039"
FT                   /protein_id="ADM84039.1"
FT                   /translation="MTGTNTFTVLSTEDLEQTSGGLAVWEDGYSRWLYYREFAPYMRQG
FT                   ALNSYIDAWKYGFRAG"
FT   gene            415216..415689
FT                   /locus_tag="SPAP_0447"
FT   CDS_pept        415216..415689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0447"
FT                   /product="hypothetical protein"
FT                   /note="Operon 191 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84040"
FT                   /protein_id="ADM84040.1"
FT                   /translation="MRNTKKLRQFGIFLLIILLSTYLPQTIGLYVTIILGLGADVYSLI
FT                   LTMGLVGSFLLLIWRLKKKKMLFIFEKKSWNWSFVFYLFATYVVYQILGNFWARYAHLI
FT                   NHRNIHDEYFTVLFSNGQPTFLSTILSFVLPVIIGPVFEETLDRGYFMNTFFP"
FT   gene            complement(415988..416410)
FT                   /locus_tag="SPAP_0448"
FT   CDS_pept        complement(415988..416410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0448"
FT                   /product="Transcription termination factor"
FT                   /note="Operon 192 Gene 1 COG0781 Transcription termination
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84041"
FT                   /protein_id="ADM84041.1"
FT                   /translation="MTSPLLESRRQLRKCAFQALMSLEFGTDVETACRFAYTHDREDTD
FT                   VQLPAFLIDLVSGVQAKKEELDKQITQHLKAGWTIERLTLVERNLLRLGVFEITSFDTP
FT                   QLVAVNEAIELAKDFSDQKSARFINGLLSQFVTEEQ"
FT   gene            complement(416403..416792)
FT                   /locus_tag="SPAP_0449"
FT   CDS_pept        complement(416403..416792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0449"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 192 Gene 2 COG1302 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84042"
FT                   /protein_id="ADM84042.1"
FT                   /translation="MGIEEQLGEIVIAPRVLEKIIAIATAKVEGVHSFSNRSVSDTLSK
FT                   LSLGRGIYLKNVDEELTADIYLYLEYGVKVPKVAVAIQKAVKDAVRNMADVELAAINIH
FT                   VAGIVPDKTPKPELKDLFDEDFLND"
FT   gene            complement(416814..417374)
FT                   /locus_tag="SPAP_0450"
FT   CDS_pept        complement(416814..417374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0450"
FT                   /product="translation elongation factor P / translation
FT                   initiation factor 5A"
FT                   /note="EF-P/eIF-5A; Operon 192 Gene 3 COG0231 Translation
FT                   elongation factor P (EF-P)/translation initiation factor 5A
FT                   (eIF-5A)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84043"
FT                   /protein_id="ADM84043.1"
FT                   /translation="MIEASKLKAGMTFETADGKLIRVLEASHHKPGKGNTIMRMKLRDV
FT                   RTGSTFDTSYRPEEKFEQAIIETVPAQYLYKMDDTAYFMNTETYDQYEIPVVNVENELL
FT                   YILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSIKGATVTGSGKPATMETGLVVNV
FT                   PDFIEAGQKLVINTAEGTYVSRA"
FT   gene            complement(417503..418945)
FT                   /locus_tag="SPAP_0451"
FT   CDS_pept        complement(417503..418945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0451"
FT                   /product="Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit"
FT                   /note="Operon 193 Gene 1 COG0064 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase B subunit (PET112 homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84044"
FT                   /protein_id="ADM84044.1"
FT                   /translation="MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFP
FT                   GVLPVLNKGVVDAGIKAALALNMDIHKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGW
FT                   IEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPE
FT                   EAYAYLTALKEVIQYAGISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNSFSNV
FT                   RKGLEYEVQRQAEILRSGGQIRQETRRYDEANKATILMRVKEGAADYRYFPEPDLPLFE
FT                   ISDEWIEEMRTELPEFPKERRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALDGDAK
FT                   QVSNWLQGEVAQFLNAEGKTLEQIELTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNG
FT                   GGAREYVEKAGMVQISDPAILIPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATK
FT                   GQANPQVALKLLAQELAKLKEN"
FT   gene            complement(418945..420411)
FT                   /locus_tag="SPAP_0452"
FT   CDS_pept        complement(418945..420411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0452"
FT                   /product="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit-like amidase"
FT                   /note="Operon 193 Gene 2 COG0154 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase A subunit and related amidases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84045"
FT                   /protein_id="ADM84045.1"
FT                   /translation="MTFNNKTIEELHNLLVSKEISATELTQATLENIKSREEALNSFVT
FT                   IAEEQALVQAKAIDEAGIDADNVLSGIPLAVKDNISTDGILTTAASKMLYNYEPIFDAT
FT                   AVANAKTKGMIVVGKTNMDEFAMGGSGETSHYGATKNAWDHSKVPGGSSSGSAAAVASG
FT                   QVRLSLGSDTGGSIRQPAAFNGIVGLKPTYGTVSRFGLIAFGSSLDQIGPFAPTVKENA
FT                   LLLNAIASEDAKDSTSAHVRIADFTSKIGQDIKGMKIALPKEYLGEGINPEVKETIQSA
FT                   AKHFEKLGAIVEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGYRAEDATNLDEI
FT                   YVNSRSQGFGEEVKRRIMLGTFSLSSGYYDAYYKKAGQVRTLIIQDFEKVFADYDLILG
FT                   PTAPSVAYDLDSLNHDPVAMYLADLLTIPVNLAGLPGISIPAGFSQGLPVGLQLIGPKY
FT                   SEETIYQVAAAFEATTDYHKQQPVIFGGDN"
FT   gene            complement(420411..420713)
FT                   /locus_tag="SPAP_0453"
FT   CDS_pept        complement(420411..420713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0453"
FT                   /product="Asp-tRNAAsn/Glu-tRNAGln amidotransferase C
FT                   subunit"
FT                   /note="Operon 193 Gene 3 COG0721 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84046"
FT                   /protein_id="ADM84046.1"
FT                   /translation="MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVD
FT                   TTGVAPTTTMADRKTVLRPDVAEEGIDRDRLFKNVPEKDNYYIKVPAILDNGGDA"
FT   gene            420926..422470
FT                   /locus_tag="SPAP_0454"
FT   CDS_pept        420926..422470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0454"
FT                   /product="Peptide chain release factor RF-3"
FT                   /note="Operon 194 Gene 1 COG4108 Peptide chain release
FT                   factor RF-3"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84047"
FT                   /protein_id="ADM84047.1"
FT                   /translation="MNIQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVKG
FT                   KKTGTFAKSDWMDIEKQRGISVTSSVMQFDYDGKRVNILDTPGHEDFSEDTYRTLMAVD
FT                   AAVMVVDSAKGIEAQTKKLFEVVKHRGIPVFTFMNKLDRDGREPLELLQELEEILGIAS
FT                   YPMNWPIGMGKAFEGLYDLYNQRLELYKGDERFASLEDGDKLFGSNPFYEQVKDDIELL
FT                   NEAGNEFSEEAILAGELTPVFFGSALTNFGVQTFLEIFLKFAPEPHGHKKTDGEIVDPY
FT                   DKDFSGFVFKIQANMDPRHRDRIAFVRIVSGEFERGMSVNLPRTGKGAKLSNVTQFMAE
FT                   SRENVTNAVAGDIIGVYDTGTYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVSAKNVMKQ
FT                   KSFHKGIEQLVQEGAVQLYKNYQTGEYMLGAVGQLQFEVFKHRMEGEYNAEVVMSPMGK
FT                   KTVRWIKPEDLDERMSSSRNILAKDRFDQPVFLFENDFALRWFADKYPDVELEEKM"
FT   gene            422898..423095
FT                   /locus_tag="SPAP_0455"
FT   CDS_pept        422898..423095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0455"
FT                   /product="Lipopolysaccharide biosynthesis protein,
FT                   LPS:glycosyltransferase"
FT                   /note="Operon 195 Gene 1 COG1442 Lipopolysaccharide
FT                   biosynthesis proteins, LPS:glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84048"
FT                   /protein_id="ADM84048.1"
FT                   /translation="MKEEKKAIVLGADNAYMDKVETTIKSLCVHHYNLKFYVFNDDLPR
FT                   EWFQLMEKRLETLNSEIVNV"
FT   gene            423498..423686
FT                   /locus_tag="SPAP_0456"
FT   CDS_pept        423498..423686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0456"
FT                   /product="hypothetical protein"
FT                   /note="Operon 196 Gene 1 protein supported
FT                   gi|15900358|ref|NP_344962.1| 50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84049"
FT                   /protein_id="ADM84049.1"
FT                   /translation="MAKVCYFTGRKTVSGNNRSHAMNQTKRAVKPNLQKVTVLIDGKPK
FT                   KVWASARALKSGKVERV"
FT   gene            423843..424208
FT                   /locus_tag="SPAP_0457"
FT   CDS_pept        423843..424208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0457"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 197 Gene 1 COG1302 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84050"
FT                   /protein_id="ADM84050.1"
FT                   /translation="MTVKINTKDGQIELTDEVIATVVGGAATEIFGVVGMASKNALKDN
FT                   FQALLGKENYSKGVVVKAAEDGSIAVDVYTVLSYGTKISEVSKNIQERVAFSLENQLGI
FT                   TAQTVNVYIQNIKVVGE"
FT   gene            424211..425878
FT                   /locus_tag="SPAP_0458"
FT   CDS_pept        424211..425878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0458"
FT                   /product="predicted kinase"
FT                   /note="Operon 197 Gene 2 COG1461 Predicted kinase related
FT                   to dihydroxyacetone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84051"
FT                   /protein_id="ADM84051.1"
FT                   /translation="MSKITTSLFQEMVQAASTRLNKQAEYVNSLNVFPVPDGDTGTNMG
FT                   MTIENGAKEVADKPASTVGEVASILAKGLLMGARGNSGVITSQLFRGFSQAIKDKDELT
FT                   GQDLALAFQSGVEVAYKAVMKPVEGTILTVSRGAAIGAKKKAEQTDDAVEVMRAALEGA
FT                   KTALAKTPDMLPVLKEVGVVDSGGQGLVFIYEGFLSALTGEYIASEDFVATPANMSEMI
FT                   NVEHHKSVAGHVATEDITFGYCTEIMVALKQGPTYAKDFDYDEFRNYLDELGDSLLVVN
FT                   DDEIVKVHVHTEDPGLVMQEGLKYGSLVKVKVDNMRNQHEAQVEKEATQVIKSAEEKEY
FT                   ALIAVVAGKGLADIFCSQGVDYVIEGGQTMNPSTEDFIKAVEQVNARNIIFLPNNKNIF
FT                   MAAQSAAEVLEQPAVVVEARTLPQGMTSLLAFDPSKSIEENQERMTAALSDVVSGSVTT
FT                   AVRDTTIDGLEIHENDNLGMVDGKILVSNPDMHQTLTETLKHMLDEDSEIVTFYVGEDG
FT                   SEELANEIAQEIVEEFEDVEVEIHQGQQPVYPYLFSVE"
FT   gene            426078..427778
FT                   /locus_tag="SPAP_0459"
FT   CDS_pept        426078..427778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0459"
FT                   /product="thiamine pyrophosphate-requiring enzyme"
FT                   /note="acetolactate synthase; pyruvate dehydrogenase
FT                   (cytochrome); glyoxylate carboligase; l phosphonopyruvate
FT                   decarboxylase; Operon 198 Gene 1 COG0028 Thiamine
FT                   pyrophosphate-requiring enzymes [acetolactate synthase,
FT                   pyruvate dehydrogenase (cytochrome), glyoxylate
FT                   carboligase, phosphonopyruvate decarboxylase]"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84052"
FT                   /protein_id="ADM84052.1"
FT                   /translation="MEKISLESPKTGSDLVLETLRNLGVDTIFGYPGGAVLPFYDAIYN
FT                   FKGIRHILGRHEQGCLHEAEGYAKSTGKLGVAVVTSGPGATNAITGIADAMSDSVPLLV
FT                   FTGQVARAGIGKDAFQEADIVGITMPITKYNYQVRETADIPRIITEAVHIATTGRPGPV
FT                   VIDLPKDISALETDFIYSPEVNLPSYQPTLEPNDMQIKKILKQLSKAKKPVLLAGGGIS
FT                   YAEAATELNEFAERYQIPVVTSLLGQGTIATSHPLFLGMGGMHGSFAANIAMTEADFMI
FT                   SIGSRFDDRLTGNPKTFAKNAKVAHIDIDPAEIGKIISADIPVVGDAKKALQMLLAEPT
FT                   VHNNTEKWIEKVTKDKNRVRSYDKKERVVQPQAVIERIGELTNGDAIVVTDVGQHQMWT
FT                   AQYYPYQNERQLVTSGGLGTMGFGIPAAIGAKIANPDKEVVLFVGDGGFQMTNQELAIL
FT                   NIYKVPIKVVMLNNHSLGMVRQWQESFYEGRTSESVFDTLPDFQLMAQAYGIKNYKFDN
FT                   PETLAQDLEVITEDVPMLIEVDISRKEQVLPMVPAGKSNHEMLGVQFHA"
FT   gene            427771..428247
FT                   /locus_tag="SPAP_0460"
FT   CDS_pept        427771..428247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0460"
FT                   /product="Acetolactate synthase, small (regulatory)
FT                   subunit"
FT                   /note="Operon 198 Gene 2 COG0440 Acetolactate synthase,
FT                   small (regulatory) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84053"
FT                   /protein_id="ADM84053.1"
FT                   /translation="MRRMLTAKLQNRSGVLNRFTGVLSRRQVNIESISVGATEDPNVSR
FT                   ITIIIDVASHDEVEQIIKQLNRQIDVIRIRDITDKPHLEREVILVKMSAPAEKRAEILA
FT                   IIQPFRATVVDVAPSSITIQMTGNAEKSEALLRVIRPYGIRNIARTGATGFTRD"
FT   gene            428313..429335
FT                   /locus_tag="SPAP_0461"
FT   CDS_pept        428313..429335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0461"
FT                   /product="Ketol-acid reductoisomerase"
FT                   /note="Operon 198 Gene 3 COG0059 Ketol-acid
FT                   reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84054"
FT                   /protein_id="ADM84054.1"
FT                   /translation="MTVQMEYEKDVKVAALDGKKIAVIGYGSQGHAHAQNLRDSGRDVI
FT                   IGVRPGKSFDKAKEDGFDTYTVAEATKLADVIMILAPDEIQQELYEAEIAPNLEAGNAV
FT                   GFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTYEEGFGVPALYAVYQDATGNAKN
FT                   IAMDWCKGVGAARVGLLETTYKEETEEDLFGEQAVLCGGLTALIEAGFEVLTEAGYAPE
FT                   LAYFEVLHEMKLIVDLIYEGGFKKMRQSISNTAEYGDYVSGPRVITEQVKENMKAVLAD
FT                   IQNGKFANDFVNDYKAGRPKLTAYREQAANLEIEKVGAELRKAMPFVGKNDDDAFKIYN
FT                   "
FT   gene            429538..429678
FT                   /locus_tag="SPAP_0462"
FT   CDS_pept        429538..429678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0462"
FT                   /product="hypothetical protein"
FT                   /note="Operon 199 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84055"
FT                   /protein_id="ADM84055.1"
FT                   /translation="MTFEQFFKLAQIAREEGLEIHSPFERAGATKSARYIAKWILRNKK
FT                   Y"
FT   gene            429916..430272
FT                   /locus_tag="SPAP_0463"
FT   CDS_pept        429916..430272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0463"
FT                   /product="hypothetical protein"
FT                   /note="Operon 200 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84056"
FT                   /protein_id="ADM84056.1"
FT                   /translation="MNITNLFSIKTGCDETDRQLQKLFFQLDLQLGELTDQLRKLDSNF
FT                   VPRSQFVDTLDLNDVEYKEILNYFIFHRNDSEESLVEWLYDWISTNRYELPKEFSIRMA
FT                   HKYHESVTEIFGDE"
FT   gene            430322..431572
FT                   /locus_tag="SPAP_0464"
FT   CDS_pept        430322..431572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0464"
FT                   /product="Threonine dehydratase"
FT                   /note="Operon 200 Gene 2 COG1171 Threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84057"
FT                   /protein_id="ADM84057.1"
FT                   /translation="MLSSKDIIKAHKVLNGVVVNTPLDYDHYLSEKYGAKIYLKKENAQ
FT                   RVRSFKIRGAYYAISQLSKEERERGVVCASAGNHAQGVAYTCNEMKIPATIFMPITTPQ
FT                   QKIGQVRFFGGDFVTIKLVGDTFDASAKAAQEFTVSENRTFIDPFDDAHVQAGQGTVAY
FT                   EILEEARKESIDFDAVLVPVGGGGLIAGVSTYIKETSPEIEVIGVEANGARSMKAAFEA
FT                   GGPVKLKEIDKFADGIAVQKVGQLTYEATRQHIQTLVGVDEGLISETLIDLYSKQGIVA
FT                   EPAGAASIASLEVLAEYIKGKTICCIISGGNNDINRMPEMEERALIYDGIKHYFVVNFP
FT                   QRPGALREFVNDILGPNDDITRFEYIKRASKGTGPVLIGIALADKHDYAGLIRRMEGFD
FT                   PAYINLNGNETLYNMLV"
FT   gene            432443..432658
FT                   /locus_tag="SPAP_0465"
FT   CDS_pept        432443..432658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0465"
FT                   /product="hypothetical protein"
FT                   /note="Operon 201 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84058"
FT                   /protein_id="ADM84058.1"
FT                   /translation="MAKSNFEKVESVVGWVRDKKITGYRISKETNAREMSIIALAQGRA
FT                   KVKNISFETALGLIDFYEKNYEKFED"
FT   gene            complement(432767..433507)
FT                   /locus_tag="SPAP_0466"
FT   CDS_pept        complement(432767..433507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0466"
FT                   /product="ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /note="Operon 202 Gene 1 COG1126 ABC-type polar amino acid
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84059"
FT                   /protein_id="ADM84059.1"
FT                   /translation="MTQAILEIKHLKKSYGQNEVLKDISLTVHKGEVISIIGSSGSGKS
FT                   TFLRSINLLETPTDGQILYHGQNVLEKGYDLTQYREKLGMVFQSFNLFENLNVLENTIV
FT                   AQTTVLKRERTEAEKIAKENLEKVGMGERYWQAKPKQLSGGQKQRVAIARALSMNPDAI
FT                   LFDEPTSALDPEMVGEVLKIMQDLAQEGLTMIVVTHEMEFARDVSHRVIFMDKGVIAEE
FT                   GKPEDLFTNPKEDRTKEFLQRYLK"
FT   gene            complement(433507..435072)
FT                   /locus_tag="SPAP_0467"
FT   CDS_pept        complement(433507..435072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0467"
FT                   /product="ABC-type amino acid transport/signal transduction
FT                   systems, periplasmic component/domain protein"
FT                   /note="Operon 202 Gene 2 COG0834 ABC-type amino acid
FT                   transport/signal transduction systems, periplasmic
FT                   component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84060"
FT                   /protein_id="ADM84060.1"
FT                   /translation="MRKIYLSIFTSLLLMLGLVNVAQADEYLRIGMEAAYAPFNWTQDD
FT                   DSNGAVKIDGTNQYANGYDVQIAKKIAKDLGKEPLVVKTKWEGLVPALTSGKIDMIIAG
FT                   MSPTAERKQEIAFSSSYYTSEPVLLVKKDSAYASAKSLDDFNGAKITSQQGVYLYDLIA
FT                   QIPGAKKETAMGDFAQMRQALEAGVIDAYVSERPEALTAEAANSKFKMIQVEPGFKTGE
FT                   EDTAIAIGLRKNDNRISQINASIETISKDDQVALMDRMIKEQPAEATTTEETSSSFFSQ
FT                   VAKILSENWQQLLRGAGITLLISIVGTIIGLIIGLAIGVFRTAPLSENKAIYGLQKLVG
FT                   WVLNVYIEIFRGTPMIVQSMVIYYGTAQAFGINLDRTLAAIFIVSINTGAYMTEIVRGG
FT                   ILAVDKGQFEAATALGMTHNQTMRKIVLPQVVRNILPATGNEFVINIKDTSVLNVISVV
FT                   ELYFSGNTVATQTYQYFQTFTIIAVIYFVLTFTVTRILRFIERRMDMDTYTTGANQMQT
FT                   EDLK"
FT   gene            435210..437099
FT                   /locus_tag="SPAP_0468"
FT   CDS_pept        435210..437099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0468"
FT                   /product="hypothetical protein"
FT                   /note="Operon 203 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84061"
FT                   /protein_id="ADM84061.1"
FT                   /translation="MKKTFFLLVLGLFCLLPLSVFAIDFKINSYQGDLYIHADNTAEFR
FT                   QKIVYQFEEDFKGQIVGLGRAGKMPSGFDIDPHPKVQAAKNGAELADVTSEVTEEADGY
FT                   TVRVYNPGQEGDIVEVDLVWNLKNLLFLYDDIAELNWQPLTDSSESIEKFEFHVRGDKG
FT                   AEKLFFHTGKLFREGTIEKSNLDYTIRLDNLPAKRGVELHAYWPRTDFASARDQGLKGN
FT                   RLEEFNKIEDSIVREKDQSKQLVTWVLPSILSISLLLSVCFYFIYRRKTTPSVKYAKNH
FT                   RLYEPPMELEPMVLSEAVYSTSLEEVSPLVKGAGKFTFDQLIQATLLDVIDRGNVSIIS
FT                   EGDAVGLRLVKEDGLSSFEKDCLNLAFSGKKEETLSNLFADYKVSDSLYRRAKVSDEKR
FT                   IQARGLQLKSSFEEVLNQMQEGVRKRVSFWGLPDYYRPLTGGEKALQVGMGALTILPLF
FT                   IGFGLFLYSLDVHGYLYLPLPILGFLGLVLSVFYYWKLRLDNRDGVLNEAGAEVYYLWT
FT                   SFENMLREIARLDQAELESIVVWNRLLVYATLFGYADKVSHLMKVHQIQVENPDINLYV
FT                   AYGWHSLFYHSSAQMSHYASVANTASTYSVSSGSGSSGGGFSGGGGGGSIGAF"
FT   gene            complement(437590..438210)
FT                   /locus_tag="SPAP_0469"
FT   CDS_pept        complement(437590..438210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0469"
FT                   /product="Transposase-like protein, ISSpn_AP200_1"
FT                   /note="Operon 204 Gene 1 COG3547 Transposase and
FT                   inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84062"
FT                   /protein_id="ADM84062.1"
FT                   /translation="MNKDIKVYTYTPLLIKEFAKSLSLRKTKTNKKDAHGIALKLLSDP
FT                   NREQFQHDNRQVELKILARHIHRLKKKQSDWKVQYTRCLDIIFPELDKIVEKHSEYTYQ
FT                   LLTCYPNPQKRLEAGFDKLIEIKRLTASKIQDILSVAPRSIGTTSPAREFEIIKHYKRL
FT                   IDKAETCVNDLMAEFNSVITTVIWDWESFRGGHFSRDSKYSCL"
FT   gene            complement(438128..438421)
FT                   /locus_tag="SPAP_0470"
FT   CDS_pept        complement(438128..438421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0470"
FT                   /product="Transposase-like protein, ISSpn_AP200_1"
FT                   /note="Operon 204 Gene 2 COG3547 Transposase and
FT                   inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84063"
FT                   /protein_id="ADM84063.1"
FT                   /translation="MLYVGIDIAKNKHDVTALNVPGKTVLKPLTFSNNKAGFELLDLSL
FT                   RRLNQDCLIALENTGHYAFNLLNFLHEQGYKGLHLHSFAHQGICQIIITSQD"
FT   gene            438676..439521
FT                   /locus_tag="SPAP_0471"
FT   CDS_pept        438676..439521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0471"
FT                   /product="Uncharacterized bacitracin resistance protein"
FT                   /note="Operon 205 Gene 1 COG1968 Uncharacterized bacitracin
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84064"
FT                   /protein_id="ADM84064.1"
FT                   /translation="MYLIEILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEA
FT                   FMSMFNVVIQLGAILAVMVIYFNKLNPFKPTKDKQEVRKTWRLWLKVLIATLPLLGVFK
FT                   FDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRNKARAIEPSVTELDKLPYTTAFYIGLF
FT                   QVLALLPGTSRSGATIVGGLLNGTSRSVVTEFTFYLGIPVMFGASALKIFKFVKAGELL
FT                   SFGQLFLLLVAMGVAFAVSMVAIRFLTSYVKKHDFTLFGKYRIVLGSVLLLYSFVRLFV
FT                   "
FT   gene            complement(439668..440729)
FT                   /locus_tag="SPAP_0472"
FT   CDS_pept        complement(439668..440729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0472"
FT                   /product="Nucleotidyltransferase/DNA polymerase involved in
FT                   DNA repair"
FT                   /note="Operon 206 Gene 1 COG0389 Nucleotidyltransferase/DNA
FT                   polymerase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84065"
FT                   /protein_id="ADM84065.1"
FT                   /translation="MLIFPLLNDLSRKIIHIDMDAFFAAVEIRDNPKLRGKPVIIGSDP
FT                   RQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKSVGLQIRAIFK
FT                   RYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGVSYNKFLAK
FT                   MASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEV
FT                   TLIDRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILLAEEDIKKELTLLSE
FT                   KVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSLAQKTQDASQISQIALQLYEELSKKE
FT                   RGVRLLGITMTGF"
FT   gene            441077..443401
FT                   /locus_tag="SPAP_0473"
FT   CDS_pept        441077..443401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0473"
FT                   /product="Pyruvate-formate lyase"
FT                   /note="Operon 207 Gene 1 COG1882 Pyruvate-formate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84066"
FT                   /protein_id="ADM84066.1"
FT                   /translation="MVVKTVVEAQDIFDKAWEGFKGVDWKEKASVSRFVQANYTPYDGD
FT                   ESFLAGPTERSLHIKKIVEETKAHYEETRFPMDTRPTSIADIPAGFIDKENEVIFGIQN
FT                   DELFKLNFMPKGGIRMAETTLKENGYEPDPAVHEIFTKYVTTVNDGIFRAYTSNIRRAR
FT                   HAHTVTGLPDAYSRGRIIGVYARLALYGADYLMQEKVNDWNAIKEIDEETIRLREEVNL
FT                   QYQALQQVVRLGDLYGVDVRKPAMNVKEAIQWVNIAFMAVCRVINGAATSLGRVPIVLD
FT                   IFAERDLARGTFTESEIQEFVDDFVMKLRTVKFARTKAYDQLYSGDPTFITTSMAGMGN
FT                   DGRHRVTKMDYRFLNTLDNIGNSPEPNLTVLWTDKLPYNFRRYCMHMSHKHSSIQYEGV
FT                   TTMAKDGYGEMSCISCCVSPLDPENEEQRHNIQYFGARVNVLKALLTGLNGGYDDVHKD
FT                   YKVFDIEPIRDEVLEFESVKANFEKSLDWLTDTYVDALNIIHYMTDRYNYEAVQMAFLP
FT                   TKQRANMGFGICGFANTVDTLSAIKYATVKPIRDEDGYIYDYETIGDYPRWGEDDPRSN
FT                   ELAEWLIEAYTTRLRSHKLYKDAEATVSLLTITSNVAYSKQTGNSPVHKGVYLNEDGSV
FT                   NLSKLEFFSPGANPSNKAKGGWLQNLNSLSSLDFSYAADGISLTTQVSPRALGKTRDEQ
FT                   VDNLVTILDGYFENGGQHVNLNVMDLNDVYEKIMSGEDVIVRISGYCVNTKYLTPEQKT
FT                   ELTQRVFHEVLSMDDALDALS"
FT   gene            complement(443768..443983)
FT                   /locus_tag="SPAP_0474"
FT   CDS_pept        complement(443768..443983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0474"
FT                   /product="hypothetical protein"
FT                   /note="Operon 208 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84067"
FT                   /protein_id="ADM84067.1"
FT                   /translation="MSIREQDLQDIGAIIKYKNFHSPFDTFKYLKDMGFDTIDLSVLLE
FT                   GFSYAYGMDWLEKFFKENQDKLREFY"
FT   gene            complement(444313..444597)
FT                   /locus_tag="SPAP_0475"
FT   CDS_pept        complement(444313..444597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0475"
FT                   /product="hypothetical protein"
FT                   /note="Operon 209 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84068"
FT                   /protein_id="ADM84068.1"
FT                   /translation="MDWYDYMIQASKQSQFNASHWFRYLRKVIFEDYSYLTNQDVEKLL
FT                   DSKELTRFQKISLKYAFQEHTPTHKYVISLNKPAKLTNVQKLMEKYKHG"
FT   gene            complement(445209..445379)
FT                   /locus_tag="SPAP_0476"
FT   CDS_pept        complement(445209..445379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0476"
FT                   /product="hypothetical protein"
FT                   /note="Operon 210 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84069"
FT                   /protein_id="ADM84069.1"
FT                   /translation="MTKQVPKFTKDTAQLYTCKWLLYNKVTKMYDHTVVNHSVREYITD
FT                   SISTNTIEETG"
FT   gene            complement(446029..447252)
FT                   /locus_tag="SPAP_0477"
FT   CDS_pept        complement(446029..447252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0477"
FT                   /product="Transcriptional regulator/sugar kinase"
FT                   /note="Operon 211 Gene 1 COG1940 Transcriptional
FT                   regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84070"
FT                   /protein_id="ADM84070.1"
FT                   /translation="MITKQSAFLQNRATILEFLYRNPATSRTDIVNETGLTPATTTNII
FT                   KELSEQSLIYETGDEFSEFSGSGRRRKTISITDNIPYVVGGIEINVLGIFLSLCDLQGK
FT                   TLFETEILNEDYPISEINSTITNMIKTAIEYVPLETKLLGFGLSIPGHYNKDSGSIITN
FT                   NPIWESFNLLNVIKRFNFPFIVKNNIDCMAIGQYLFNPHNTPDNFIFLHAGLGIYTSFF
FT                   TKEKIGASKNPYIGEIGHTIVELNGQYCECGKKGCLQTYISDAWLIKHAQLLFKNSQLT
FT                   VLKSLVKTEKDIHLDTLLTAYNLGDSALRQQIDKGVNLLATSIANLLLINPADKIYINS
FT                   QLLNYQPFTHEVRDKIQDQLHFVPFTRNIEIEILPYNKHRGSIGACALAIVAFFIEHSN
FT                   VLQDIISP"
FT   gene            447420..448742
FT                   /locus_tag="SPAP_0478"
FT   CDS_pept        447420..448742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0478"
FT                   /product="Phosphotransferase system cellobiose-specific
FT                   component IIC"
FT                   /note="Operon 212 Gene 1 COG1455 Phosphotransferase system
FT                   cellobiose-specific component IIC"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84071"
FT                   /protein_id="ADM84071.1"
FT                   /translation="MNNILAFLETKVAPFGEKVGNQRHLKAIREGFMMAMPLILVGSLF
FT                   LILISWPQEAFTNWLNSVGLLSILTTMNQSTVAIISLVACFGIAYRLSEGYGTDGPSAG
FT                   IIALSSFVLMAPRFSSMVYDKNGEQVKQLFGGAIPFSSLNASSLFMAITIGLVTAEIYR
FT                   MFIQRGITIKMPSGVPDVVSKSFSALLPGFTTFVLWALVLKGLEAAGVAGGLNGLLGAI
FT                   VGTPLKLIAGTLPGMILCVIVNSFFWFCGVNGGQVLNAFVDPVWLQFTTENQEAVAAGQ
FT                   TLQHIITLPFKDLFVFIGGGGATIGLAICLFLFSKSRANKTLGKLAIIPSIFNINTAIL
FT                   FTFPTVLNPIMLIPFIATPTINALITYVSMAVGLVPYTTGVILPWTMPPIIGGFLATGA
FT                   SWRGALLQVVLILVSVAIYYPFFKIADKRNLEKEKATVGGK"
FT   gene            448744..449217
FT                   /locus_tag="SPAP_0479"
FT   CDS_pept        448744..449217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0479"
FT                   /product="hypothetical protein"
FT                   /note="Operon 212 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84072"
FT                   /protein_id="ADM84072.1"
FT                   /translation="MVIRVFDQQKNTYSSFALEELSYYINRVFKTDIELVEEKEADIFV
FT                   GLVNKEDRKDHVLISLDKGKGRIESNTIVGLLIGIYRMFHEFGVVYTRPGRGHDFVPEL
FT                   RFEDFLDKELSIDETASYYHRGVCIEGADSFENILDFIDWLPKIGMNSFFHSV"
FT   gene            449235..450632
FT                   /locus_tag="SPAP_0480"
FT   CDS_pept        449235..450632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0480"
FT                   /product="hypothetical protein"
FT                   /note="Operon 212 Gene 3 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84073"
FT                   /protein_id="ADM84073.1"
FT                   /translation="MKRWYEHEFNPYLNKEKFSNELVQELSDRLDKELQKRGLIHHRVG
FT                   HGWTGEVLGYSSKFGWESGLSISEEKKPYVAEINGKRELFNTAPILTSLDFSNPDVADK
FT                   MVEIIKDYAKKRPDVNYLHVWLSDARNNICECENCRQELVSDQYIRILNQLDRALTSEG
FT                   LDTKICFLLYHELLWAPQKEKLDNPERFTMMFAPITRTFEMSYADVDFDNSIPTPKPYL
FT                   RNKIILPNSLEENLSYLFEWQKTFKGDSFVYDYPLGRAHYGDLGYMKISQTIYRDVSYL
FT                   SNLHLNGYISCQELRAGFPHNFPNYVMGEMLWKKTRSYEELIEEYFSALYGSNWQSVVE
FT                   YLEKLSSYSSCDYFNAIGSRQNDVLANHYYIAYNLADNFLPIIEENISKLLNSQKDEWK
FT                   QLSYHREYVVKMAKALYLQATGKTRQAQDEWRNVLNYIRGHELLFQSNLDVYRVIEVAK
FT                   NYAGFHL"
FT   gene            450800..451144
FT                   /locus_tag="SPAP_0481"
FT   CDS_pept        450800..451144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0481"
FT                   /product="Phosphotransferase system cellobiose-specific
FT                   component IIA"
FT                   /note="Operon 213 Gene 1 COG1447 Phosphotransferase system
FT                   cellobiose-specific component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84074"
FT                   /protein_id="ADM84074.1"
FT                   /translation="MKSKEEINMLGFTIVAYAGDARSDLMDALAFARDGYFEQARELVE
FT                   SANDSIVSAHREQTNLLAEEASGDNFEVSFIMIHGQDTLMTTMLLYDQVKFFIDEYERI
FT                   RKIEEHIGLQ"
FT   gene            451154..452566
FT                   /locus_tag="SPAP_0482"
FT   CDS_pept        451154..452566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0482"
FT                   /product="Beta-glucosidase/6-phospho-beta-glucosidase/
FT                   beta-galactosidase"
FT                   /note="Operon 213 Gene 2 COG2723
FT                   Beta-glucosidase/6-phospho-beta-glucosidase/beta-
FT                   galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84075"
FT                   /protein_id="ADM84075.1"
FT                   /translation="MENLQVKALPKEFLLGAATAAYQVEGATRVDGKGTNMWDVYLQEN
FT                   SPFLPDPASDFYYRYEEDITLAAEHGLQALRLSISWVRIFPDIDGEPNILAVRYYHRVF
FT                   QSCLKHNVIPFVSLHHFDSPQKMLETGDWLNRENIDRFIRYARFCFQEFTEVKHWFTIN
FT                   ELMSLAAGQYIGGQFPPNHHFQLSEAIQANHNMLLAHALAVLEFHQLGIEGEIGCIHAL
FT                   KPGYPIDGQKENILAAKRYDVYNNKFLLDGTFLGYYSEDTLFHLNQILEANNSSFIIED
FT                   GDLEIMKRAAALNTMFGMNYYRSEFIREYKGENRQEFNSTGIKGQSSFKLNALGEFVKK
FT                   PGIPTTDWDWNIYPQGLFDMLLRIKEEYPQHPVIYLTENGTALKEVKPEGENDIIDDSK
FT                   RIRYIEQHLHKVLEARDRGVNIQGYFIWSLQDQFSWANGYNKRYGLFFVDYETQKRYIK
FT                   KSALWVKGLKRN"
FT   gene            452636..454312
FT                   /locus_tag="SPAP_0483"
FT   CDS_pept        452636..454312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0483"
FT                   /product="Phosphotransferase system cellobiose-specific
FT                   component IIC"
FT                   /note="Operon 213 Gene 3 COG1455 Phosphotransferase system
FT                   cellobiose-specific component IIC"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84076"
FT                   /protein_id="ADM84076.1"
FT                   /translation="MDKLVAAIEKQQGKFEKISTNNYMIAIKDGFIATMPLIMFSSFLM
FT                   IIIMIPKNFGVELPSPAIAWMRKVYMLTMGVLGIIVSGTVAKSLAGNVNRKMPPGKVIN
FT                   DTSAMLAAICGYLVLTVTLVVDEKTGSTSLSTNYLGSQGLITSFVSAFITVNVYRFCIK
FT                   RDITIHLPKVPGAISQAFRDIFPFSFVLLISGLLDIVSRFSLDVPFAQVFQQLLTPIFK
FT                   GAESYPAMMLIWFMCALLWFVGIHGPSIVLPAVTALQLSNMEENAQLLANGQFPYHSLT
FT                   PNFGNYIAAIGGTGATFVVPFILIFFMRSKQLKSVGKATITPVLFAVNEPLLFGMPVIL
FT                   NPYLFVPFLMTPPVNVFLGKVFIDFFGMNGFYIQLPWAFPGPLGLLIGTNFQLISFVFL
FT                   SLMLVVDILIYLPFCRAYDRQLLVKEDIASSNDIILEEDTSEIMPGEIDVIKSKELKVL
FT                   VLCAGSGTSAQLANAINEGAQLAEVRVIANSGAYGAHYDIMGVYDLIILAPQVRSYYRE
FT                   MKVDAERLDIQIVATRGMEYIHLTKSPSKALQFVLEHYQAV"
FT   gene            complement(454438..455865)
FT                   /locus_tag="SPAP_0484"
FT   CDS_pept        complement(454438..455865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0484"
FT                   /product="Trk-type K+ transport systems, membrane
FT                   component"
FT                   /note="Operon 214 Gene 1 COG0168 Trk-type K+ transport
FT                   systems, membrane components"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84077"
FT                   /protein_id="ADM84077.1"
FT                   /translation="MIRYLLSKLLLIEAVLLLVPVAIAVYYRESSQVFTALFSTIGILV
FT                   LLGGSGSLQKPKNQRIYAKEGVLIVALCWILWSFFGGLPFVFSGQIPSLIDAFFEISSG
FT                   FTTTGASILNDVSVLSRSLLFWRSFTHLIGGMGVLVFALAIMDNAKNSHLEVMKAEVPG
FT                   PVFGKVVSKLKNTAQILYLLYLALFSLFVIIYYLAGMPLYDSFVIAMGTAGTGGFTVYN
FT                   DGIAHYGSSLITYLVSIGVLVFGVNFNLYYYLMLRRIKAFFGDEELRAYLVIVLVSTGL
FT                   ISLNTLYLYPGFSKSFEMTFFQVSNIITTTGFGYGDITNWPLFSQFILLFLMAIGGSAG
FT                   STAGGLKIIRGLILSKIAKNQILSILSPHRVLTLHVNKTVIDKDTQHKILKYFVIYAMI
FT                   LLALIFIVSLDSNDFLVVTSAVFSCFNNIGPILGTTSSFSIFSPISKILLSFAMIAGRL
FT                   EIYPILLLFMKRTWSKR"
FT   gene            complement(455881..457230)
FT                   /locus_tag="SPAP_0485"
FT   CDS_pept        complement(455881..457230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0485"
FT                   /product="K+ transport systems, NAD-binding component"
FT                   /note="Operon 214 Gene 2 COG0569 K+ transport systems,
FT                   NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84078"
FT                   /protein_id="ADM84078.1"
FT                   /translation="MKIILVGGGKVGFALCRSLVAEKHDVLLIEQDEAVLNHIVSRFDI
FT                   IGILGNGADFAILEQASVQDCDIFIALTEHDEVNMIAAVLAKKMGAKETIVRVRNPEYS
FT                   NSYFKEKNILGFSLIVNPELLAARAIANIIDFPNALSVERFAGGRVSLMEFVVKSTSGL
FT                   CQMPISDFRKKFGNVIVCAIERDHQIIIPSGDMTVQDKDRIFVTGNRVDMILFHNYFKS
FT                   RAVKSLLIVGAGRIAYYLLGILKDSRIDTKVIEINPEIASFFSEKFPNLYIVQGDGTAK
FT                   DILLEESAQHYDAVATLTGVDEENLITSMFLDRVGVQKNITKVNRTSLLEIINAPDFSS
FT                   IITPKSIAVDTIMHFIRGRVNAQYSDLQAMHHLANGQIETLQFHIKEANKMTAKPLSQL
FT                   KLKKGVLIAAIIRKGKTIFPTGEDMLEVGDKLLVTTLLPNITKIYDLIAR"
FT   gene            457419..458267
FT                   /locus_tag="SPAP_0486"
FT   CDS_pept        457419..458267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0486"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="Operon 215 Gene 1 COG1912 Uncharacterized conserved
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84079"
FT                   /protein_id="ADM84079.1"
FT                   /translation="MNNNLLVLQSDFGLVDGAVSAMIGVALEESPTLKIHHLTHDITPY
FT                   NIFEGSYRLFQTVDYWPEGTTFVSVVDPGVGSKRKSVVAKTAKNQYIVTPDNGTLSFIK
FT                   KHVGIVAIREISEVANRRQNTEHSYTFHGRDVYAYTGAKLASGHITFEEVGPELSVEQI
FT                   VELPVVATIIEDHLVKGAIDILDVRFGSLWTSITREEFYKLEPEFGDRFEVTIYHADML
FT                   VYQNQVVYGKSFADVRIGQPILYINSLYRLGLAINQGSFAKAYNVGVGSSWTIEIKKIE
FT                   G"
FT   gene            458282..458830
FT                   /locus_tag="SPAP_0487"
FT   CDS_pept        458282..458830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0487"
FT                   /product="Predicted membrane protein"
FT                   /note="Operon 215 Gene 2 COG4720 Predicted membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84080"
FT                   /protein_id="ADM84080.1"
FT                   /translation="MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQA
FT                   LLSIIFGPIIGLLVGLIGHAIKDSLVGYGLWWTWIIASGLFGLVVGLFRKYVRVINGVF
FT                   DWKDILIFNLIQLLANALVWGVLAPLGDVVIYQEAAEKVFAQGIVAGIANGVSVAIAGT
FT                   LLLLAYAGTQTRAGSLKKD"
FT   gene            458837..459049
FT                   /locus_tag="SPAP_0488"
FT   CDS_pept        458837..459049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0488"
FT                   /product="hypothetical protein"
FT                   /note="Operon 215 Gene 3 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84081"
FT                   /protein_id="ADM84081.1"
FT                   /translation="MKIKEQTRKQVAGCSKQCFEVVDETDEVSNHTYGKAKLTWFEEIF
FT                   EEYKMMGKAGQLVFFDVYRLVRQVS"
FT   gene            459151..460833
FT                   /locus_tag="SPAP_0489"
FT   CDS_pept        459151..460833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0489"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /note="Operon 216 Gene 1 COG1122 ABC-type cobalt transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84082"
FT                   /protein_id="ADM84082.1"
FT                   /translation="MKEAIIEWKDFSFRYETQQEPTLQGIDLTIYKGEKVLIVGPSGSG
FT                   KSTLGQCLNGIIPNIYKGQTYGEFLIKGQTAFDMSIYDKSHLVSTVLQDTDGQFIGLSV
FT                   AEDLAFALENDVTALDEMKGRVYKWAEKLDLLPLLDQRPQDLSGGQKQRVSLAGVLIDE
FT                   SPILLFDEPLANLDPKSGQDIIELIDQIHKEEGTTTLIIEHRLEDVLHRPVDRIVLIND
FT                   GRILFNGSPDQLLATDLLTQNGIREPLYLTTLRQLGVDLVKEEQLADLDNLSISKGQVQ
FT                   LQTELVKETPELQSLFRLEEVSFSYDDRPILKSLHLDIKKGEKIAIVGKNGAGKSTLAK
FT                   AISSFIQTEGRYLWEKQDIKGDSVAERAERVGYVLQNPNQMISTNMIFDEVALVLRLRG
FT                   VDEKEIETRVYETLKICGLYEFRNWPISALSFGQKKRVTIASILVLGAEIILLDEPTAG
FT                   QDQKNYTEIMEFLEELHQKGHTIVMITHDMQLMLDYSDRVLVMVDGELIADTVPASLLS
FT                   DPELLVKANLKETSIFNLAKKLDVDPLDLTAFYKERREGCKLN"
FT   gene            460818..461648
FT                   /locus_tag="SPAP_0490"
FT   CDS_pept        460818..461648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0490"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ-like transporter"
FT                   /note="Operon 216 Gene 2 COG0619 ABC-type cobalt transport
FT                   system, permease component CbiQ and related transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84083"
FT                   /protein_id="ADM84083.1"
FT                   /translation="MQAKLIGYQHRDTVIHRLSGAGKLLFFILVSLAAMISYDTRMLLL
FT                   IAIFSVFLLYLSEIRFKDVSFVAVFATVFAVLNVLMVYLFSPEYGVGLYGERSVIWQGI
FT                   GVYTLTSQELFYLLNLAIKYLCTIPLAIIFLMTTHPSQFASSLNQIGVPYKIAYSVSLT
FT                   LRYIPDLQEEFFTIKMSQEARGMELSKKASLMQRIKGNLLIITPLIFSSLERIDTIATA
FT                   MELRRFGKEKKRTWYSYQALKKGDYITLLLATLFLVVSLLLILQNQGRFYNPWK"
FT   gene            461841..462344
FT                   /locus_tag="SPAP_0491"
FT   CDS_pept        461841..462344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0491"
FT                   /product="Predicted rRNA methylase (SpoU class)"
FT                   /note="Operon 217 Gene 1 COG0219 Predicted rRNA methylase
FT                   (SpoU class)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84084"
FT                   /protein_id="ADM84084.1"
FT                   /translation="MTNHIVLFEPQIPQNTGNIARTCAATNSPLHIIKPMGFPIDDRKM
FT                   KRAGLDYWDKLEIYFYESLEDFISQMKGKLYLISKFAEKVYSEVDLSTDEDHYFLFGRE
FT                   DKGLPEDFMREHPEKALRIPMNDEHVRSLNVSNTVCMIVYEALRQQNFAGLELVHTYEV
FT                   DKLK"
FT   gene            462797..463360
FT                   /locus_tag="SPAP_0492"
FT   CDS_pept        462797..463360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0492"
FT                   /product="Predicted membrane protein"
FT                   /note="Operon 218 Gene 1 COG3601 Predicted membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84085"
FT                   /protein_id="ADM84085.1"
FT                   /translation="MTNTRRLSTIAILSAISFVLMYFDFPLLPAASFLKIEFSILPVLV
FT                   GLVVMDLPAALGVLLLRSLLKLLLNSQGVNTYIGLPMNIVALGVFVIVFALIWKKERTT
FT                   LRFLLGSLAGTVGLTLAMLVLNYVYAVPLYAKFANFDIGKILGLSNYLMTMVLPFNLIE
FT                   GVIFSVSFWLLYVLLKPTLKHYER"
FT   gene            463374..464000
FT                   /locus_tag="SPAP_0493"
FT   CDS_pept        463374..464000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0493"
FT                   /product="Membrane-associated phospholipid phosphatase"
FT                   /note="Operon 218 Gene 2 COG0671 Membrane-associated
FT                   phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84086"
FT                   /protein_id="ADM84086.1"
FT                   /translation="MKGSFALLLFVILGYMVKFYPEMLVNFDQSIQTAIRGDLPDYLTI
FT                   LFRALTRLIDIPVIITWVVITAFVFYRKRWKIESFFMLGNLALAGLLIVTFKNIYQRPR
FT                   PAILHLVEEKGFSFPSGHSLAVTLMVGTLIVILSQRIKNPVWRKIVQIVLGLYLVSVLV
FT                   SRVYLGVHYPSDVLASLCVGLGVLFIEFPFYDKLRFQWRFKGKQK"
FT   gene            464028..464417
FT                   /locus_tag="SPAP_0494"
FT   CDS_pept        464028..464417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0494"
FT                   /product="hypothetical protein"
FT                   /note="Operon 218 Gene 3 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84087"
FT                   /protein_id="ADM84087.1"
FT                   /translation="MKVNIADLHLTQLYLSEKKLQDIQMLYQSAETIQVDPISILAFGD
FT                   CLLITDGHHRAYQALLAGRDTISAEWDRDGGDELYHLYAQACEERKIYSVFDLEDRILA
FT                   QDGYEAKWYNWCDGFNQAATLLLKR"
FT   gene            464422..464871
FT                   /locus_tag="SPAP_0495"
FT   CDS_pept        464422..464871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0495"
FT                   /product="Sortase-like acyltransferase"
FT                   /note="Operon 218 Gene 4 COG1247 Sortase and related
FT                   acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84088"
FT                   /protein_id="ADM84088.1"
FT                   /translation="MCFVPYYKVNHCEEAFAWYQDVNLVYLVDGVKLPYSQATLEAMYS
FT                   YLDRHGELFWIEVKEKGEWFPIGDITLSQDNLPIVIGNSAYQHRGLGKKILSALIELAR
FT                   VKGWKELRVKKIYTYNHASRRCFKSLGFVENGATEKGMSFILELV"
FT   gene            464999..465586
FT                   /locus_tag="SPAP_0496"
FT   CDS_pept        464999..465586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0496"
FT                   /product="DNA-directed RNA polymerase, delta subunit"
FT                   /note="Operon 219 Gene 1 COG3343 DNA-directed RNA
FT                   polymerase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84089"
FT                   /protein_id="ADM84089.1"
FT                   /translation="MKLEVFAGQEKSELSMIEVARAILELRGRDHEMHFSDLVNEIQNY
FT                   LGTSNSDIREALPLFYTELNFDGSFISLGDNKWGLRSWYGVDEIDEEIIALEENDDDEV
FT                   TPKAKKKRVNAFMDGDSDAIDYNADDPEDEDAYEADPALSYDDENPDDEKNEVEAYDAE
FT                   INEIAPDDLGEDVDLNEDDDEFSDDDAETSEE"
FT   gene            465976..467583
FT                   /locus_tag="SPAP_0497"
FT   CDS_pept        465976..467583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0497"
FT                   /product="CTP synthase (UTP-ammonia lyase)"
FT                   /note="Operon 220 Gene 1 COG0504 CTP synthase (UTP-ammonia
FT                   lyase)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84090"
FT                   /protein_id="ADM84090.1"
FT                   /translation="MSTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYI
FT                   NIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKER
FT                   RGEYLGATVQVIPHITDALKEKIKRAALTTDSDVIITEVGGTVGDIESLPFLEALRQMK
FT                   ADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPAGQGI
FT                   KNKLAQFCDVAPEAVIESLDVEHLYQIPLNLQAQGMDQIVCDHLKLDAPAADMTEWSAM
FT                   VDKVMNLKKQVKISLVGKYVELQDAYISVVEALKHSGYVNDVEVKINWVNANDVTAENV
FT                   AELLSDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCIEFARHVLGL
FT                   EGANSAELAPETKYPIIDIMRDQIDIEDMGGTLRLGLYPSKLKRGSKAAAAYHNQEVVQ
FT                   RRHRHRYEFNNAFREQFEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELSSRPN
FT                   RPEELYTAFVTAAVENSN"
FT   gene            complement(468142..469773)
FT                   /locus_tag="SPAP_0498"
FT   CDS_pept        complement(468142..469773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0498"
FT                   /product="Na+/phosphate symporter"
FT                   /note="Operon 221 Gene 1 COG1283 Na+/phosphate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84091"
FT                   /protein_id="ADM84091.1"
FT                   /translation="MSINWQEILFHFLGGLGLFLYSIKTMGDGLQQAAGDRLRFYIDKY
FT                   TSNPFFGVLVGIGMTALIQSSSGVTVITVGLVSAGLLTLRQAIGIVMGANIGTTVTSFL
FT                   IGFKLGNYALPMLFIGAVCLFFTKNRTVNNIGRILFGFGGIFFALNLMSGAMAPLKDLQ
FT                   VFKDYMIELSKNPVLGVFVGTGLTLLIQASSATIGILQNLYAGNLIDLQGALPVLFGDN
FT                   IGTTITAIIASLGANIAAKRVAGAHVAFNVIGTVVCVIFLVPFTVLIHWFEATLNLAPE
FT                   MTIAFAHGTFNITNTIVQFPFIGALAYFVTKIIPGEDEVVKYEPLYLDEHFIKQAPSIA
FT                   LGNAKKELLHLGNYAAKAFDLSYKYIIDLDEKVAEKGHKTEEAINTIDEQLTRYLIALS
FT                   SEALSQKESEVLTNILDSSRDLERIGDHTEALLNLTDYLQRKNVEFSDAALKELEEVYR
FT                   QTSDFIKDALDSVENNDIEKARSLVERHEAINKIERVLRKTHIKRLNKGECSTQAGVNF
FT                   IDIISHYTRVSDHAMNLAEKVFAEQI"
FT   gene            469975..470085
FT                   /locus_tag="SPAP_0499"
FT   CDS_pept        469975..470085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0499"
FT                   /product="hypothetical protein"
FT                   /note="Operon 222 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84092"
FT                   /protein_id="ADM84092.1"
FT                   /translation="MIIMVLEFDKKLQNIKRFLENNKINLLGGENEESIF"
FT   gene            470066..475006
FT                   /locus_tag="SPAP_0500"
FT   CDS_pept        470066..475006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0500"
FT                   /product="Endo-beta-N-acetylglucosaminidase D"
FT                   /note="Operon 222 Gene 2 COG4724
FT                   Endo-beta-N-acetylglucosaminidase D"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84093"
FT                   /protein_id="ADM84093.1"
FT                   /translation="MKNPFFERRCRYSIRKLSVGACSLMIGAVLFAGPALAEETAVPEN
FT                   SGANPELVSGESEHSTNEADKQNEGEHARENKLEKAEGVAIASETAEAASAAKPEEKAS
FT                   EVVAETPSAEAKPKSDKETEAKPEATNQGDESKPAEEANKTEKEVQPDVPKNTEKTLKP
FT                   KEIKFNSWEELLKWEPGAREDDAINRGSVVLASRRTGHLVNEKASKEAKVQALSNTNSK
FT                   AKDHASVGGEEFKAYAFDYWQYLDSMVFWEGLVPTPDVIDAGHRNGVPVYGTLFFNWSN
FT                   SIADQERFAEALKQDADGSFPIARKLVDMAKYYGYDGYFINQETTGDLVKPLGEKMRQF
FT                   MLYSKEYAAKVNHPIKYSWYDAMTYNYGRYHQDGLGEYNYQFMQPEGDKVPADNFFANF
FT                   NWDKAKNDYTIATANWIGRNPYDVFAGLELQQGGSYKTKVKWNDILDENGKLRLSLGLF
FT                   APDTITSLGKTGEDYHKNEDIFFTGYQGDPTGQKPGDKDWYGIANLVADRTPAVGNTFT
FT                   TSFNTGHGKKWFVDGKVSKDSEWNYRSVSGVLPTWRWWQTSTGEKLRAEYDFTDAYNGG
FT                   NSLKFSGDVAGKTDQDVRLYSTKLEVTEKTKLRVAHKGGKGSKVYMAFSTTPDYKFDDA
FT                   DAWKELTLSDNWTNEEFALSSLAGKTIYAVKLFFEHEGAVKDYQFNLGQLTISDNHQEP
FT                   QSPTSFSVVKQSLKNAQEAEAVVQFKGNKDADFYEVYEKDGDSWKLLTGSSSTTIYLPK
FT                   VSRSASAQGTTQELKVVAVGKNGVRSEAATTTFDWGMTVKDTSLPKPLAENIVPGATVI
FT                   DSTFPKTEGGEGIEGMLNGTITSLSDKWSSAQLSGSVDIRLTKPRTVVRWVMDHAGAGG
FT                   ESVNDGLMNTKDFDLYYKDADGEWKLAKEVRGNKAHVTDITLDKPITAQDWRLNVVTSD
FT                   NGTPWKAIRIYNWKMYEKLDTESVNIPMAKAAARSLGNNKVQVGFADVPAGATITVYDN
FT                   PNSQTPLATLKSEVGGDLASAPLDLTNQSGLLYYRTQLPGKEISNVLAVSVPKDDRRIK
FT                   SVSLETGPKKTSYAEGEDLDLRGGVLRVQYEGGTEDELIRLTHAGVSVSGFDTHHKGEQ
FT                   NLTLQYLGQPVNANLSVTVTGQDEASPKTILGIEVSQEPKKDYLVGDNLDLSEGRFAVA
FT                   YSNDTMEEHSFTDEGVEISGYDAQKTGRQTLTLRYQGHEVNFDVLVSPKAALNDEYLKQ
FT                   KLAEVEAAKNKVVYNFASPEVKEAFLKAIEAAEQVLKDHETSTQDQVNDRLNKLTEAHK
FT                   ALNGQEKFTEEKTELDRLTGEAQELLAAKPNHPSGSALAPLLEKNKALVEKVDLSPEEL
FT                   ATAKQSLKDLVALLKEDKSAVFSDSKTGVEVHFSNKEKTVIKGLKVERVQASAEEKKYF
FT                   AGEDAHVFEIEGLDEKGQDVDLSYASIVKIPIEKDKKVKKVFFLPEGKEAVELAFEQTD
FT                   SHVIFTAPHFTHYAFVYESAEKPQPAKPAPQNKVLPKPTYQPASDQQKAPKLEVQEEKV
FT                   AFHRQEHENAEMLVGEQRVIIQGRDGLLRHVFEVDENGQRRLRSTEVIQEAIPEIVEIG
FT                   TKVKTVPAVVATQEKPAQNTAVKSEEASKQLPNTGTADANEALIAGLASLGLASLALTL
FT                   RRKREDKD"
FT   gene            475096..476292
FT                   /locus_tag="SPAP_0501"
FT   CDS_pept        475096..476292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0501"
FT                   /product="3-phosphoglycerate kinase"
FT                   /note="Operon 222 Gene 3 COG0126 3-phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84094"
FT                   /protein_id="ADM84094.1"
FT                   /translation="MAKLTVKDVDLKGKKVLVRVDFNVPLKDGVITNDNRITAALPTIK
FT                   YIIEQGGRAILFSHLGRVKEEADKAGKSLAPVAADLAAKLGQDVVFPGVTRGAELEAAI
FT                   NALEDGQVLLVENTRYEDVDGKKESKNDPELGKYWASLGDGIFVNDAFGTAHRAHASNV
FT                   GISANVEKAVAGFLLENEIAYIQEAVETPERPFVAILGGSKVSDKIGVIENLLEKADKV
FT                   LIGGGMTYTFYKAQGIEIGNSLVEEDKLDVAKALLEKANGKLILPVDSKEANAFAGYTE
FT                   VRDTEGEAVSEGFLGLDIGPKSIAKFDEALTGAKTVVWNGPMGVFENPDFQAGTIGVMD
FT                   AIVKQPGVKSIIGGGDSAAAAINLGRADKFSWISTGGGASMELLEGKVLPGLAALTEK"
FT   gene            476428..476955
FT                   /locus_tag="SPAP_0502"
FT   CDS_pept        476428..476955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0502"
FT                   /product="Predicted membrane protein"
FT                   /note="Operon 223 Gene 1 COG4129 Predicted membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84095"
FT                   /protein_id="ADM84095.1"
FT                   /translation="MSYFKKYKFDKSQFKLGMRTFKTGIAVFLVLLIFGFFGWKGLQIG
FT                   ALTAVFSLRESFDESVHFGTSRILGNSIGGLYALVFFLLNTFFHEAFWVTLVVVPICTM
FT                   LTIMTNVAMNNKAGVIGGVAAMLIITLSIPSGETISYVFVRVSETFMGVFVAIIVNYDI
FT                   DRIRLFLEKKEK"
FT   gene            477032..477388
FT                   /locus_tag="SPAP_0503"
FT   CDS_pept        477032..477388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0503"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="Operon 223 Gene 2 COG0789 Predicted transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84096"
FT                   /protein_id="ADM84096.1"
FT                   /translation="MKEKEFRRNMAVFPIGSVMKLTDLSARQIRYYEDQELIKPDRNEG
FT                   NRRMYSLNDMDRLLEIKDYISEGYNIAAIKKKYAEREAKSKKAVSQTEVRRALHNELLQ
FT                   QGRFASVQSPFGRG"
FT   gene            477425..478771
FT                   /locus_tag="SPAP_0504"
FT   CDS_pept        477425..478771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0504"
FT                   /product="Glutamine synthetase"
FT                   /note="Operon 223 Gene 3 COG0174 Glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84097"
FT                   /protein_id="ADM84097.1"
FT                   /translation="MPITAADIRREVKEKNVTFIRLMFSDILGTMKNVEIPATDEQLDK
FT                   VLSNKVMFDGSSIEGFVRINESDMYLYPDLDTWTVFPWGDENGSVAGLICDVYTTEGEP
FT                   FAGDPRGNLKRALRHMEEVGFKSFNLGPEPEFFLFKLDENGDPTLEVNDKGGYFDLAPT
FT                   DLADNTRREIVNVLTKMGFEVEASHHEVAVGQHEIDFKYDEVLRACDKIQIFKLVVKTI
FT                   ARKHGLYATFMAKPKFGIAGSGMHCNMSLFDAEGNNAFFDPNDPKGMQLSETAYHFLGG
FT                   LIKHAYNYTAIMNPTVNSYKRLVPGYEAPVYIAWAGRNRSPLVRVPASRGMGTRLELRS
FT                   VDPMANPYIAMAVLLEVGLYGIENKIEAPAPIEENIYIMTAEERKEAGITDLPSTLHNA
FT                   LKALTEDEVVKAALGDHIYTSFLEAKRIEWASYATFVSQWEIDNYLDLY"
FT   gene            478951..479100
FT                   /locus_tag="SPAP_0505"
FT   CDS_pept        478951..479100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0505"
FT                   /product="hypothetical protein"
FT                   /note="Operon 224 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84098"
FT                   /protein_id="ADM84098.1"
FT                   /translation="MEKFNFKNNIGQENKLLQIEIYKFTNFCKLQNYTSVNIFSKDIFE
FT                   TIVN"
FT   gene            479800..480693
FT                   /locus_tag="SPAP_0506"
FT   CDS_pept        479800..480693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0506"
FT                   /product="Restriction endonuclease S subunit"
FT                   /note="Operon 225 Gene 1 COG0732 Restriction endonuclease S
FT                   subunits"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84099"
FT                   /protein_id="ADM84099.1"
FT                   /translation="MIASTAFIVLDTLLNETYLKYYLLSDNFINRVNNKSTGTSYPAIN
FT                   DYNFNLLLIALPPLSEQQRIVEAIESALEKVDEYAESYNRLEQLDKEFPDKLKKSILQY
FT                   AMQGKLVEQDPNDESVEVLLEKIRAEKQKLFEEGKIKKKDLDISIVSQGDDNSYYGNKD
FT                   ETSSYPIYKIPEAWRYIKFASLVNFRIGKTPPRSEATFWGTEIPWVSISDMPISGYVTN
FT                   TRESISKLALKSKKIDISPKGTLLMSFKLSIGKVAILDIPATHNEAIISIFPYANKENI
FT                   IRDYLNDIFATYLYFR"
FT   gene            complement(480789..481295)
FT                   /locus_tag="SPAP_0507"
FT   CDS_pept        complement(480789..481295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0507"
FT                   /product="Restriction endonuclease S subunit"
FT                   /note="Operon 226 Gene 1 COG0732 Restriction endonuclease S
FT                   subunits"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84100"
FT                   /protein_id="ADM84100.1"
FT                   /translation="MNTGLSYKKGDLSINNKGVRIIRGGNIKPLEFSLLDNDYYIDTQF
FT                   ISSEQVYLKHNQLITPVSTSLEHIGKFARIDKDYDGVVAGGFIFQLTPFESSEIISKFL
FT                   LFNLSSPLFYKQLKAITKLSGQALYNIPKTTLSELLIPLAPFEEQELITQKVEKLFEKV
FT                   NQLWK"
FT   gene            complement(481405..482202)
FT                   /locus_tag="SPAP_0508"
FT   CDS_pept        complement(481405..482202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0508"
FT                   /product="Integrase"
FT                   /note="Operon 227 Gene 1 COG0582 Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84101"
FT                   /protein_id="ADM84101.1"
FT                   /translation="MKDFELHLKKAGLAENTVRSYLYGVRFFLENYELKMEDLFEYKGY
FT                   LLDNFKPKTVNLRLQGVNKYLAFIGHDDLKLKFVKVQQKPFLEDVISHADYLFLKRSLK
FT                   KDGILKWHFVVWFLGATGARVSELIKLKVEHVEIGYFDIYSKGGKIRRLYIPKKLRNSC
FT                   LSWLESENRRSGYLFLNKFNEPITARGVAQQLKNYADKYKMNPKVIYPHSFRHLFAKNF
FT                   LAKYNDIALLADLMGHESIETTRIYLRKTATEQQNIVDKIVNW"
FT   gene            complement(482259..482981)
FT                   /locus_tag="SPAP_0509"
FT   CDS_pept        complement(482259..482981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0509"
FT                   /product="Restriction endonuclease S subunit"
FT                   /note="Operon 227 Gene 2 COG0732 Restriction endonuclease S
FT                   subunits"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84102"
FT                   /protein_id="ADM84102.1"
FT                   /translation="MQGKLVEQDPNDESVEVLLEKIRAEKQKLFEEGKIKKKDLDISIV
FT                   SQGDDNSYYEEVPCEIPESWEWVRLNDITSYIQRGKSPKYSNIPIYPVIAQKCNQWSGF
FT                   SIDLARFIDPETVHSYQKERLLRDGDLMWNSTGLGTLGRLAIYHENKNPYGWAVADSHV
FT                   TVIRVLSGVINCHFIYNFLSSPIVQSVIEEKASGSTKQKELLTKTIKEYLIPLPPLPEQ
FT                   SRIVDKIEQFFAHIDALI"
FT   gene            complement(483077..483826)
FT                   /locus_tag="SPAP_0510"
FT   CDS_pept        complement(483077..483826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0510"
FT                   /product="Restriction endonuclease S subunit"
FT                   /note="Operon 227 Gene 3 COG0732 Restriction endonuclease S
FT                   subunits"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84103"
FT                   /protein_id="ADM84103.1"
FT                   /translation="MTPEQLKASILQRAMEGKLVPQNPNDEPASELLKRIKAEKEKLIS
FT                   EGKIKRDKKETEIFRGDDGKHYGKFADGSTQEIDVPYDIPDTWEWVRFSTLVEIVRGGS
FT                   PRPIKDYLTSEVDGINWIKIGDTEKGEKYINNVKEKIKKSGLNKTRFVKKGTFLLTNSM
FT                   SFGRPYILNVDGAIHDGWLAISNYENSLNKDYLFYILSSNVVYSQFLSLISGAVVKNLN
FT                   SDKVASILIPLPPLAEQQRIIEAIDQL"
FT   gene            complement(483826..485289)
FT                   /locus_tag="SPAP_0511"
FT   CDS_pept        complement(483826..485289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0511"
FT                   /product="Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /note="Operon 227 Gene 4 COG0286 Type I
FT                   restriction-modification system methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84104"
FT                   /protein_id="ADM84104.1"
FT                   /translation="MSITSFVKRIQDITRNDAGVNGDAQRIEQMSWLLFLKIYDSREMV
FT                   WELEEDEYESIIPEELKWRNWAHAQNGERVLTGDELLDFVNNKLFKELKELEITSIMPI
FT                   RKTIVKSAFEDANNYMKNGVLLRQVINVIDEVDFNSPEDRHSFNDIYEKILKDIQNAGN
FT                   SGEFYTPRAATDFIAEVLNPKLGESMADLACGTGGFLTSTLNRLSSQRKTSEDTKKYNT
FT                   AVFGIEKKAFPHLLAVTNLFLHEIDDPKIVHGNTLEKNVREYTDDEKFDIIMMNPPFGG
FT                   SELETIKNNFPAELRSSETADLFMAVIMYRLKENGRVGVILPDGFLFGEGVKTRLKQKL
FT                   VDEFNLHTIIRLPHSVFAPYTGIHTNILFFDKTKKTEETWFYRLDMPDGYKNFSKTKPM
FT                   KSEHFNPVRDWWENREEILEGKFYKSKSFTPSELAELNYNLDQCGFPKEEEEILNPFEL
FT                   IQNYQAERATLNHKIDNVLADILQLLEDK"
FT   gene            complement(485302..487635)
FT                   /locus_tag="SPAP_0512"
FT   CDS_pept        complement(485302..487635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0512"
FT                   /product="Type I site-specific restriction-modification
FT                   system, R (restriction) subunit-like helicase"
FT                   /note="Operon 227 Gene 5 COG4096 Type I site-specific
FT                   restriction-modification system, R (restriction) subunit
FT                   and related helicases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84105"
FT                   /protein_id="ADM84105.1"
FT                   /translation="MVEFIKSKKEMSEEDIKANFITPAIVSKGWKNGEHIAYEEYFTDG
FT                   RIEVRGDKARRKEGKKSDYSLYYQFGTRIAIVEAKDNKHSVRAGLQQAIEYGEILDVPF
FT                   VYSSNGDGFIEHDRITREERELELDEFPTREELFSRMTKEKGLTYEITEAISTPYYTDA
FT                   FSMKTPRYYQQIAINRTIETVARGQKRVMFVMATGTGKTFMAFQIIHRLRKAGLAKRVL
FT                   FLADRNILVDQTMAEDFRPFEKVMTKITPKLLTAPEKLNSFEIYLGLYQQLTGEDGTET
FT                   HYQKFDKDFFDLIVIDEAHRGSAKEDSNWRKVIDYFSSATQIGMTATPKETKNASNTEY
FT                   FGEPIYTYSLKQGIEDGFLAPYRVMRVNLDVDVDGYRPETGKVDTNGQLIEDRYYGRKD
FT                   FDKTIVIDDRTQRVAKFVSDYMKQSNARFDKTIVFCVDIDHAERMRAALVKENLDLVQE
FT                   DYRYVMQVTGDNAEGKAQLDNFMDVNSNFPAIVTTSKLLTTGVNAKTCRLIVLDSNIQS
FT                   MTEFKQIIGRGTRLYPQKGKEFFTIIDFRNVTNLFADPDFDGEPVKVLETGAKTVSGST
FT                   PGFVDEEGDPVEKYIVTDKQVTILNSTVQVLDENGKLITESLTDYTRKNILGSYATLND
FT                   FITVWHTADKKKLILDELYKKGVYLDAIRESEGISEQEIDDFDLLLKLAYGQKELTKTE
FT                   RINKLKQSGYLYKYSEEARAVLEILLNKYMDKGIGELESIETLKLPEFQIYGGTFKIIN
FT                   TYFGDKKRYLQAIKELEQELFTVA"
FT   gene            488242..488751
FT                   /locus_tag="SPAP_0513"
FT   CDS_pept        488242..488751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0513"
FT                   /product="hypothetical protein"
FT                   /note="Operon 228 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84106"
FT                   /protein_id="ADM84106.1"
FT                   /translation="MNSRVEFRIFTILDLDKEEEYLHEMHLKGWRYRTSRFGLFYFDQC
FT                   QPDDVIYRIYDSRFLKKYKHELQEFRDRGWELIGAGSCSILRKSSSDLLPEDQVYMSKG
FT                   LKWEVMRSRLRSCTATFLGGLVVCMSLFREELSMSFFLIFVLYAFLISYLIHGYFRLKR
FT                   KYRVDE"
FT   gene            488915..489949
FT                   /locus_tag="SPAP_0514"
FT   CDS_pept        488915..489949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0514"
FT                   /product="transcriptional regulator of heat shock proteins"
FT                   /note="Operon 229 Gene 1 COG1420 Transcriptional regulator
FT                   of heat shock gene"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84107"
FT                   /protein_id="ADM84107.1"
FT                   /translation="MVTERQQDILNLIIDIFTKTHEPVGSKVLQESINSSSATIRNDMA
FT                   ELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFHRLAENEVYEIVKAFDQEFFKLEDI
FT                   LQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLDESRTVTSQFLI
FT                   PRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTDNVIDLFEHIFK
FT                   EMFNENIVMAGKVNLLNFANLAAYQFFDQPQKVALEIREGLREDQMQNVRIADGQESCL
FT                   ADLAVISSKFLIPYRGVGILAIIGPVNLDYQQLINQINVVNRVLTMKLTDFYRYLSSNH
FT                   YEVH"
FT   gene            489976..490500
FT                   /locus_tag="SPAP_0515"
FT   CDS_pept        489976..490500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0515"
FT                   /product="Molecular chaperone GrpE (heat shock protein)"
FT                   /note="Operon 229 Gene 2 COG0576 Molecular chaperone GrpE
FT                   (heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84108"
FT                   /protein_id="ADM84108.1"
FT                   /translation="MAQDIKNEEVEEVQEEEVVETAEETTPEKSELDLANERADEFENK
FT                   YLRAHAEMQNIQRRANEERQNLQRYRSQDLAKAILPSLDNLERALAVEGLTDDVKKGLG
FT                   MVQESLIHALKEEGIEEIAADGEFDHNYHMAIQTLPADDEHPVDTIAQVFQKGYKLHDR
FT                   ILRPAMVVVYN"
FT   gene            490980..492803
FT                   /locus_tag="SPAP_0516"
FT   CDS_pept        490980..492803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0516"
FT                   /product="Molecular chaperone"
FT                   /note="Operon 229 Gene 3 COG0443 Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84109"
FT                   /protein_id="ADM84109.1"
FT                   /translation="MSKIIGIDLGTTNSAVAVLEGTESKIIANPEGNRTTPSVVSFKNG
FT                   EIIVGDAAKRQAVTNPDTVISIKSKMGTSEKVSANGKEYTPQEISAMILQYLKGYAEDY
FT                   LGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKTDKEEK
FT                   ILVFDLGGGTFDVSILELGDGVFDVLSTAGDNKLGGDDFDQKIIDHLVAEFKKENGIDL
FT                   STDKMAMQRLKDAAEKAKKDLSGVTSTQISLPFITAGEAGPLHLEMTLTRAKFDDLTRD
FT                   LVERTKVPVRQALSDAGLSLSEIDEVILVGGSTRIPAVVEAVKAETGKEPNKSVNPDEV
FT                   VAMGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTA
FT                   ADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIPQIEVTFDIDKNGIVSVKA
FT                   KDLGTQKEQTIVIQSNSGLTDEEIDRMMKDAEANAEADKKRKEEVDLRNEVDQAIFATE
FT                   KTIKETEGKGFDAERDAAQAALDDLKKAQEDNNLDDMKAKLEALNEKAQGLAVKLYEQA
FT                   AAAQQAQEGAEGAQATGNAGDDVVDGEFTEK"
FT   gene            493562..494698
FT                   /locus_tag="SPAP_0517"
FT   CDS_pept        493562..494698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0517"
FT                   /product="DnaJ-class molecular chaperone with C-terminal Zn
FT                   finger domain"
FT                   /note="Operon 230 Gene 1 COG0484 DnaJ-class molecular
FT                   chaperone with C-terminal Zn finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84110"
FT                   /protein_id="ADM84110.1"
FT                   /translation="MNNTEFYDRLGVSKNASADEIKKAYRKLSKKYHPDINKEPGAEDK
FT                   YKEVQEAYETLSDDQKRAAYDQYGAAGANGGFGGDGGFGGFNGAGGFGGFEDIFSSFFG
FT                   GGGSSRNPNAPRQGDDLQYRVNLTFEEAIFGTEKEVKYHREAGCRTCNGSGAKPGTSPV
FT                   TCGRCHGAGVINVDTQTPLGMMRRQVTCDVCHGQGKEIKYPCTTCHGTGHEKQAHSVHV
FT                   KIPAGVETGQQIRLAGQGEAGFNGGPYGDLYVVVSVEASDKFEREGTTIFYNLNLNFVQ
FT                   AALGDTVDIPTVHGDVELVIPEGTQTGKKFRLRSKGAPSLRGGAVGDQYVTVNVVTPTG
FT                   LNDRQKVALKEFAAAGDLKVNPKKKGFFDHIKDAFDGE"
FT   gene            complement(494727..494903)
FT                   /locus_tag="SPAP_0518"
FT   CDS_pept        complement(494727..494903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0518"
FT                   /product="hypothetical protein"
FT                   /note="Operon 231 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84111"
FT                   /protein_id="ADM84111.1"
FT                   /translation="MHHNLGNSYSIKIKKQTRKLGTDCSKHRFKVVDRTDEVSSKHCFE
FT                   VVDTTHIYTASRR"
FT   gene            complement(495065..495352)
FT                   /locus_tag="SPAP_0519"
FT   CDS_pept        complement(495065..495352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0519"
FT                   /product="hypothetical protein"
FT                   /note="Operon 232 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84112"
FT                   /protein_id="ADM84112.1"
FT                   /translation="MKLSNLLLFAGAAAGSYLVTKNRQTITDEVLNTTDRVQAIKDDVD
FT                   IIQNSLQIINQQKELIKEYQEDLTYKFKVLEKDIQTRLAVIKEMQGTEDK"
FT   gene            complement(495362..495772)
FT                   /locus_tag="SPAP_0520"
FT   CDS_pept        complement(495362..495772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0520"
FT                   /product="Diadenosine tetraphosphate (Ap4A) hydrolase-like
FT                   HIT family hydrolase"
FT                   /note="Operon 232 Gene 2 COG0537 Diadenosine tetraphosphate
FT                   (Ap4A) hydrolase and other HIT family hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84113"
FT                   /protein_id="ADM84113.1"
FT                   /translation="MSDCIFCKIIAGEIPASKVYEDEQVLAFLDISQVTLGHTLVVPKE
FT                   HYRNLLEMDATSASQLFAQVPKVAQKVMKVTKAAGMNIISNCEEVAGQTVFHTHVHLVP
FT                   RYSADDDLKIDFIAHEPDFDKLAQVAETIKNA"
FT   gene            495840..496571
FT                   /locus_tag="SPAP_0521"
FT   CDS_pept        495840..496571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0521"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="Operon 233 Gene 1 COG1131 ABC-type multidrug
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84114"
FT                   /protein_id="ADM84114.1"
FT                   /translation="MLEIKNLTGGYVHVPVLKDVSFTVESGQLVGLIGLNGAGKSTTIN
FT                   EIIGLLAPYSGSININGLTLQGDATSYRKQIGYIPETPSLYEELTLREHIETVAMAYGI
FT                   EQKVAFERVEPLLKMFRLEQKLDWFPVHFSKGMKQKVMIICAFVVDPSLFIVDEPFLGL
FT                   DPLAISDLIQLLEVEKQKGKSILMSTHVLDSAEKMCDAFVILHKGEVRAKGNLLQLREA
FT                   FDMPEASLNDIYLALTKEEDL"
FT   gene            496568..497617
FT                   /locus_tag="SPAP_0522"
FT   CDS_pept        496568..497617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0522"
FT                   /product="Predicted ABC-type exoprotein transport system,
FT                   permease component"
FT                   /note="Operon 233 Gene 2 COG4473 Predicted ABC-type
FT                   exoprotein transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84115"
FT                   /protein_id="ADM84115.1"
FT                   /translation="MKDLFLKRKQAFRKECLGYLRYVLNDHFVLFLLVLLGFLAYQYSQ
FT                   LLQHFPENHWPILLFVGITSVLLLLWGGIATYMEAPDKLFLLVGEEEIKLHLKRQTGIS
FT                   LVFWLFVQTLFLLLFAPLFLAMGYGLPVFLLYVLLLGVGKYFHFRQKASKFFTETGLDW
FT                   DYLISQESKRKQVLLRFFALFTQVKGISNSVKRRAYLDFILKAVQKVPGKIWQNLYLRS
FT                   YLRNGDLFALSLRLLLLSVLAQVFIEQAWIATAVVVLFNYLLLFQLLALYHAFDYQYLT
FT                   QLFPLDKGQKEKGLQEVVRGLTSFVLLVEVVVGLITFQEKLALLALLGAGLVLLVLYLP
FT                   YQVKRQMQD"
FT   gene            complement(497785..498114)
FT                   /locus_tag="SPAP_0523"
FT   CDS_pept        complement(497785..498114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0523"
FT                   /product="hypothetical protein"
FT                   /note="Operon 234 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84116"
FT                   /protein_id="ADM84116.1"
FT                   /translation="MTDTDPIKRAQTLITDLNKAYQACKQATADDVRFQEQLNSILGFL
FT                   AKAETVDNRFLIELEKFYQTSSLLMGLSALDPDAPTRAAWRAYDRFHFDQVKTKLILNE
FT                   NQRAN"
FT   gene            498391..498729
FT                   /locus_tag="SPAP_0524"
FT   CDS_pept        498391..498729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0524"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /note="Operon 235 Gene 1 COG3279 Response regulator of the
FT                   LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84117"
FT                   /protein_id="ADM84117.1"
FT                   /translation="MKHMIIQTQKTVYKVNVDDVYYIQTHPTKAHTVKIVTEEASFNMV
FT                   QNLSNLENQYGETLMRCHRNCLVNLDKVKSIDFQERILFLGEEGQYAVKYARRRYREIR
FT                   QKWLKEGE"
FT   gene            498734..499471
FT                   /locus_tag="SPAP_0525"
FT   CDS_pept        498734..499471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0525"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /note="Operon 235 Gene 2 COG3279 Response regulator of the
FT                   LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84118"
FT                   /protein_id="ADM84118.1"
FT                   /translation="MRIFVLEDDFSQQTRIETTIEKLLKEHHITLSSFEVFGKPDQLLA
FT                   EVHEKGAHQLFFLDIEIRNEEMKGLEVARKIRDRDPYALIVFVTTHSEFMPLSFRYQVS
FT                   ALDYIDKALSAEEFESRIETALLYANGQDSKSLAEDCFYFKSKFAQFQYPFKEVYYLET
FT                   STRPHRVILYTKTDRLEFTASLEEVLKQEPRLLQCHRSFLINPANVVHLDKKEKLLFFP
FT                   NGGSCLIARYKVREVSEAINNLH"
FT   gene            499485..500825
FT                   /locus_tag="SPAP_0526"
FT   CDS_pept        499485..500825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0526"
FT                   /product="Predicted signal transduction protein with a
FT                   C-terminal ATPase domain"
FT                   /note="Operon 235 Gene 3 COG2972 Predicted signal
FT                   transduction protein with a C-terminal ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84119"
FT                   /protein_id="ADM84119.1"
FT                   /translation="MNVAWILLYTLVTHGLKIVIFFKVDGISLTFERIFKAFLFKILLA
FT                   VVFGMLGYMVGNVYLSYFMEPLYGIGLSFLLLRELPKKLLLFYGLFPMILVNLFYRGVS
FT                   YFVLPFLGQGQVYDDYSFIWLCIIIFNFFISLAFLKWLDYDFTSLRKGILDKDFQKSLT
FT                   QINWIMGAYYLVIQNLSYFEYEQGIQSTTVRHLILVFYLLFFMGIIKKLDTYLKDKLHE
FT                   RLNQEQDLRYREMERYSRHIEELYKEVRSFRHDYTNLLTSLRLGIEEEDMEQIKEIYDS
FT                   VLKDSSEKLQDNKYDLGRLVNVRDRALKSLLAGKFIKARDKNIVFNVEVPEEIQVEGVS
FT                   LLDFLTVVSILCDNAIEASVEACQPHVSIAFFKNGAQETFIIENSIKEEGIDISEIFSF
FT                   GASSKGEERGVGLYTVMKIVESHPNTSLNTTCQDHVFRQVLTVIHIE"
FT   gene            complement(500869..501024)
FT                   /locus_tag="SPAP_0527"
FT   CDS_pept        complement(500869..501024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0527"
FT                   /product="hypothetical protein"
FT                   /note="Operon 236 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84120"
FT                   /protein_id="ADM84120.1"
FT                   /translation="MDKKQNLTSFQELTTTELNQIIGGGWWEDFLYRFNIIEQKNTKGF
FT                   YQPIQL"
FT   gene            complement(501081..502442)
FT                   /locus_tag="SPAP_0528"
FT   CDS_pept        complement(501081..502442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0528"
FT                   /product="hypothetical protein"
FT                   /note="Operon 236 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84121"
FT                   /protein_id="ADM84121.1"
FT                   /translation="MNPNLFRSVEFYQRRYHNYATVFIIPLSLLFTFILIFSLVATKEI
FT                   TVTSQGEITPTSVIASIQSTSDNPILANHLVANQVVEKGDLLIKYSETMEESQKTALAT
FT                   QLQRLEKQKEGLGILKQSLEKATDLFSSEDEFGYHNTFMNFTKQSHDIELGISKTNTEV
FT                   SNQANLTNSSSSAIEQEITKVQQQIGEYQELRDAIINNRARLPTGNPHQSILNRYLIAS
FT                   QGQTQGTAEEPFLSQINQSIASLESSIASLKIQQAGIGSVATYDNSLATKIEVLRTQFL
FT                   QTASQQQLTVENQLTELKVQLDQATQRLENNTLTAPSKGIVHLNSEFEGKNRIPTGTEI
FT                   AQIFPVITDTREVLITYYVSSDYLPLLDKGQTVRLKLEKIGNHGTTIIGQLQSIDQTPT
FT                   RTEQGNLFKLTALAKLSNEDSKLIQYGLQGRVTSVTTKKTYFDYFKDKILTHSD"
FT   gene            complement(502453..504606)
FT                   /locus_tag="SPAP_0529"
FT   CDS_pept        complement(502453..504606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0529"
FT                   /product="ABC-type bacteriocin/lantibiotic exporter"
FT                   /note="Operon 236 Gene 3 COG2274 ABC-type
FT                   bacteriocin/lantibiotic exporters, contain an N-terminal
FT                   double-glycine peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84122"
FT                   /protein_id="ADM84122.1"
FT                   /translation="MTSYKRTFVPQIDARDCGVAALASIAKFYGSDFSLAHLRELAKTN
FT                   KEGTTALGIVKAADEMGFETRPVQADKTLFDMSDVPYPFIVHVNKEGKLQHYYVVYQTK
FT                   KDYLIIGDPDPSVKITKMSKERFFSEWTGVAIFLAPKPSYQPHKDKKNGLLSFLPLIFK
FT                   QKSLIAYIVLSSLLVTIINIGGSYYLQGILDEYIPNQMKSTLGIISVGLVITYILQQVM
FT                   SFSRDYLLTVLSQRLSIDVILSYIRHIFELPMSFFATRRTGEIISRFTDANSIIDALAS
FT                   TILSLFLDVSILILVGGVLLAQNPNLFLLSLLSIPIYMFIIFSFMKPFEKMNHDVMQSN
FT                   SMVSSAIIEDINGIETIKSLTSEENRYQNIDSEFVDYLEKSFKLSKYSILQTSLKQGTK
FT                   LVLNILILWFGAQLVMSSKISIGQLITFNTLFSYFTTPMENIINLQTKLQSAKVANNRL
FT                   NEVYLVESEFQVQENPVHSHFLMGDIEFDDLSYKYGFGRDTLTDINLTIKQGDKVSLVG
FT                   VSGSGKTTLAKMIVNFFEPYKGHISINYQDIKNIDKKVLRRHINYLPQQAYIFNGSILE
FT                   NLTLGGNHMISQEDILRACELAEIRQDIERMPMGYQTQLSDGAGLSGGQKQRIALARAL
FT                   LTKAPVLILDEATSGLDVLTEKKVIDNLISLTDKTILFVAHRLSIAERTNRVIVLDQGK
FT                   IIEVGSHQELMQAQGFYHHLFNK"
FT   gene            504888..505142
FT                   /locus_tag="SPAP_0530"
FT   CDS_pept        504888..505142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0530"
FT                   /product="hypothetical protein"
FT                   /note="Operon 237 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84123"
FT                   /protein_id="ADM84123.1"
FT                   /translation="MNTKMMEQFHEMDIAMLSSIEGGKNNWQTNVFEGGSAAFGGWGLG
FT                   TAICAASGVGAPFMGACGYIGAKFGVALWAGVTGATGGF"
FT   gene            505158..505361
FT                   /locus_tag="SPAP_0531"
FT   CDS_pept        505158..505361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0531"
FT                   /product="hypothetical protein"
FT                   /note="Operon 237 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84124"
FT                   /protein_id="ADM84124.1"
FT                   /translation="MNTYCNINETMLSEVYGGNSGGAAVVAALGCAAGGVKYGKILGPW
FT                   GAAIGGIGGAVVCGYLAYTATS"
FT   gene            505380..505589
FT                   /locus_tag="SPAP_0532"
FT   CDS_pept        505380..505589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0532"
FT                   /product="hypothetical protein"
FT                   /note="Operon 237 Gene 3 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84125"
FT                   /protein_id="ADM84125.1"
FT                   /translation="MKAIFFIILFAFQTYLIYLSISISDKKQKTIELTSLNCFVILFLI
FT                   YDKLIFLFIAYVFLIIFILNLFRN"
FT   gene            505605..505754
FT                   /locus_tag="SPAP_0533"
FT   CDS_pept        505605..505754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0533"
FT                   /product="hypothetical protein"
FT                   /note="Operon 237 Gene 4 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84126"
FT                   /protein_id="ADM84126.1"
FT                   /translation="MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGC
FT                   ATTV"
FT   gene            506274..506435
FT                   /locus_tag="SPAP_0534"
FT   CDS_pept        506274..506435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0534"
FT                   /product="hypothetical protein"
FT                   /note="Operon 238 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84127"
FT                   /protein_id="ADM84127.1"
FT                   /translation="MKKKILIIFVLYLIMSIFLYPLRESIWYNLFYTIAYMIAVMIYFS
FT                   LIKKKEKK"
FT   gene            506445..506816
FT                   /locus_tag="SPAP_0535"
FT   CDS_pept        506445..506816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0535"
FT                   /product="hypothetical protein"
FT                   /note="Operon 238 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84128"
FT                   /protein_id="ADM84128.1"
FT                   /translation="MIKKNHILCEIVPGSVAFACFYLSISISSVFQFLLVVINLASILV
FT                   TVYLTREMRIKEFEDDDLVSPRTNQLMFIGLTGFMSIICLYRGITAGESYQQIIAYIGA
FT                   ILCLTIMLLLIWGLKYYKK"
FT   gene            complement(506939..507142)
FT                   /locus_tag="SPAP_0536"
FT   CDS_pept        complement(506939..507142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0536"
FT                   /product="hypothetical protein"
FT                   /note="Operon 239 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84129"
FT                   /protein_id="ADM84129.1"
FT                   /translation="MLVYVNTKKQVRPIIFKMNNNGVKSLKKLSTDTTRNTIHIIVETI
FT                   FFLSIIIYSFPNKSSLSIKSDF"
FT   gene            507178..507345
FT                   /locus_tag="SPAP_0537"
FT   CDS_pept        507178..507345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0537"
FT                   /product="hypothetical protein"
FT                   /note="Operon 240 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84130"
FT                   /protein_id="ADM84130.1"
FT                   /translation="MVSPRTNQLMFIGLVDFMFVICLYRGISETEFYQQLIAYIGVFSA
FT                   CLSRFCSCGA"
FT   gene            507445..507828
FT                   /locus_tag="SPAP_0538"
FT   CDS_pept        507445..507828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0538"
FT                   /product="hypothetical protein"
FT                   /note="Operon 240 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84131"
FT                   /protein_id="ADM84131.1"
FT                   /translation="MKYRLFFVIFLSSVLDILLGTFLQISIVSIGWLVLYSGLFEAGVF
FT                   LLANKGVAVKIKEVDIRNRFKFIFGKTLWFQILLLIFLIIKLYLGLDARLILFYGHIFI
FT                   VFNALMYLLSSSQVSLKKNKLSS"
FT   gene            507880..508569
FT                   /locus_tag="SPAP_0539"
FT   CDS_pept        507880..508569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0539"
FT                   /product="Predicted metal-dependent membrane protease"
FT                   /note="Operon 240 Gene 3 COG1266 Predicted metal-dependent
FT                   membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84132"
FT                   /protein_id="ADM84132.1"
FT                   /translation="MKKYQLLFKISAVFSYLFFVFGLSQLTLIVQNYWQFSSQIGNFVW
FT                   IQNILSLLFIGVMIVVLVKTGHGYLFRIPRKKWLWYSILTVLVVVFQISFNVQTAKHVQ
FT                   STAEGWAVLIGYSGTNFAELGIYIALFFLVPLMEELIYRGLLQHAFFKHSRFGLDLLLP
FT                   SILFALPHFSSLPSLLDIFVFATVGIIFAGLTRYTKSIYPSYAVHVINNIVATFPFLLT
FT                   FLHRVLG"
FT   gene            508611..508859
FT                   /locus_tag="SPAP_0540"
FT   CDS_pept        508611..508859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0540"
FT                   /product="hypothetical protein"
FT                   /note="Operon 240 Gene 4 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84133"
FT                   /protein_id="ADM84133.1"
FT                   /translation="MYKHLFFLDSKTLDRLTPYILVLASDTIAFNVFVLTFVSAVVFNF
FT                   LNSMLALMAIFIGAGYVVGFWLLKWFVLERLDLKNDV"
FT   gene            508889..509500
FT                   /locus_tag="SPAP_0541"
FT   CDS_pept        508889..509500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0541"
FT                   /product="Predicted metal-dependent membrane protease"
FT                   /note="Operon 240 Gene 5 COG1266 Predicted metal-dependent
FT                   membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84134"
FT                   /protein_id="ADM84134.1"
FT                   /translation="MEFFDKFHALCFGFLVLIIVIIVPYTINHGDFFQNESALILVSLL
FT                   VTSLSVAYARKFEMISFGMLSKKQLLLFIAIFLLSVLETLVYIHFFAVSSGSGVQHLAE
FT                   VSRGISLSLILTTSVFGPIQEELIFRGLLQGAVFDNSWLGLVLTSSLFSFMHGPSNVPS
FT                   FIFYLLGGLLLGLAYKKSQNLWVSTLVHMLYNSWPLLYYL"
FT   gene            509662..510456
FT                   /locus_tag="SPAP_0542"
FT   CDS_pept        509662..510456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0542"
FT                   /product="Predicted choline kinase involved in LPS
FT                   biosynthesis"
FT                   /note="Operon 241 Gene 1 COG0510 Predicted choline kinase
FT                   involved in LPS biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84135"
FT                   /protein_id="ADM84135.1"
FT                   /translation="MDLGDNELTLTPIPGKSGKAYMGSYPDGKRIFVKMNTSPILPGLA
FT                   REQIAPQLLWSRRLADGRDMCAQEWLTGKILTPYDMNRKQIVNILTRLHRSRPLMTQLS
FT                   RLGYAMETPVDLLQSWQETAPDALRKNHFISEVMADLRQTIPGFREDHATIVHGDVRHS
FT                   NWIETDSGLIYLVDWDSVRLTDRMFDVAHMLCHYISEHQWKEWLTYYGYKYNQTVLSKL
FT                   YWYGQLSYLSQISKYYMNQDLENVNREIHGLRHFRDKYGKRR"
FT   gene            510453..511088
FT                   /locus_tag="SPAP_0543"
FT   CDS_pept        510453..511088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0543"
FT                   /product="Predicted S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /note="Operon 241 Gene 2 COG0220 Predicted
FT                   S-adenosylmethionine-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84136"
FT                   /protein_id="ADM84136.1"
FT                   /translation="MRVRNRKGATELLEANPQYVVLNPLEAKAKWRDLFGNDNPIHVEV
FT                   GSGKGAFVSGMAKQNPDINYIGIDIQKSVLSYALDKVLEAGVSNIKLLWVDGSDLTDYF
FT                   EDGEIDRLYLNFSDPWPKKRHEKRRLTYKTFLDTFKRILPENGEIHFKTDNRGLFEYSL
FT                   VSFSQYGMKLNGVWLDLHASDFEGNVMTEYEQKFSNKGQVIYRVEAEF"
FT   gene            511289..511693
FT                   /locus_tag="SPAP_0544"
FT   CDS_pept        511289..511693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0544"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 242 Gene 1 COG0779 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84137"
FT                   /protein_id="ADM84137.1"
FT                   /translation="MDIEYGKIGSDMILSIFVDKPEGITLNDTADLTEMISPVLDTIKP
FT                   DPFPEQYFLEITSPGLERPLKTKDAVAGAVGKYIHVGLYQAIDKQKVFEGTLLAFEEDE
FT                   LTMEYMDKTRKKTVQIPYSLVSKARLAVKL"
FT   gene            511749..512873
FT                   /locus_tag="SPAP_0545"
FT   CDS_pept        511749..512873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0545"
FT                   /product="Transcription elongation factor"
FT                   /note="Operon 242 Gene 2 COG0195 Transcription elongation
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84138"
FT                   /protein_id="ADM84138.1"
FT                   /translation="MLEAFRILEEDKGIKKEDIIDAVVESLRSAYRRRYGQSDSVAIDF
FT                   NEKTGDFTVYTVREVVDEVFDSRLEISLKDALAINSAYELGDKIKFEEAPAEFGRVAAQ
FT                   SAKQTIMEKMRKQTRAITYNTYKEHEQEIMSGTVERFDNRFIYVNLGSIEAQLSKQDQI
FT                   PGEVFASHDRIEVYVYKVEDNPRGVNVFVSRSHPEMIKRLMEQEIPEVYDGTVEIMSVA
FT                   REAGDRTKVAVRSHNPNVDAIGTIVGRGGANIKKITSKFHPARYDAKNDRMVPIEENID
FT                   VIEWVADPAEFIYNAIAPAEVDQVIFDENDSKRALVVVPDNKLSLAIGRRGQNVRLAAH
FT                   LTGYRIDIKSASEFEAMEDAASVELEVENDTVEE"
FT   gene            512895..513188
FT                   /locus_tag="SPAP_0546"
FT   CDS_pept        512895..513188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0546"
FT                   /product="Predicted nucleic-acid-binding protein implicated
FT                   in transcription termination"
FT                   /note="Operon 242 Gene 3 COG2740 Predicted
FT                   nucleic-acid-binding protein implicated in transcription
FT                   termination"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84139"
FT                   /protein_id="ADM84139.1"
FT                   /translation="MKTRKIPLRKSVVSNEVIDKRDLLRIVKNKEGQVFIDPTGKANGR
FT                   GAYIKLDNAEALEAKKKKVFNRSFSMEVEESFYDELIAYVDHKVKRRELGLE"
FT   gene            513181..513480
FT                   /locus_tag="SPAP_0547"
FT   CDS_pept        513181..513480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0547"
FT                   /product="hypothetical protein"
FT                   /note="Operon 242 Gene 4 protein supported
FT                   gi|15900467|ref|NP_345071.1| hypothetical protein SP_0555"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84140"
FT                   /protein_id="ADM84140.1"
FT                   /translation="MNKQKISNLLGLAQRAGRIISGEELVVKAIQDGKAKLVFLAHDAG
FT                   PNLTKKIQDKSHYYQVEIVTVFSTLELSIAVGKSRKVLAVTDAGFTKKMRSLME"
FT   gene            513497..516289
FT                   /locus_tag="SPAP_0548"
FT   CDS_pept        513497..516289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0548"
FT                   /product="translation initiation factor 2"
FT                   /note="Operon 242 Gene 5 COG0532 Translation initiation
FT                   factor 2 (IF-2; GTPase)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84141"
FT                   /protein_id="ADM84141.1"
FT                   /translation="MSKKRLYEIAKELGKESKEVVARAKELGLDVKSHSSSVEEAVAAK
FT                   IAASFKPAAAPKVEAKPAAPKVSAEKKAEKSEPAKPAVAKEEAKPAEPVAPKTEKVAAK
FT                   PQSRNFKAEREARAKEQAERRKQNKGNNRDQQQNGNRQKNDGRNGGKQGQSNRDNRRFN
FT                   DQAKKQQGQQKRRNERRQQEDKRSNQAAPRIDFKARAAALKAEQNAEYARSSEERFKQY
FT                   QAAKEALAQANKRKEPEEIFEEAAKLAEQAQQVQAVVEVVPEKKEPAVDTRRKKQARPD
FT                   KNRDDYDHEEDGPRKQQKNRSSQNQVRNQKNSNWNNNKKNKKGNNKNNRNQTPKPVTER
FT                   KFHELPTEFEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVD
FT                   YGIEAKQKVEVDNADIERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSR
FT                   VATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDG
FT                   VMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEI
FT                   SAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLN
FT                   VQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSAR
FT                   AAGEERAKRALMKQRQATQRVSLENLFDTLKAGELKSVNVIIKADVQGSVEALSASLQK
FT                   IDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHS
FT                   IIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKV
FT                   RVIRDGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDIKMDDVIEAYVMEEIKR
FT                   "
FT   gene            516540..516890
FT                   /locus_tag="SPAP_0549"
FT   CDS_pept        516540..516890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0549"
FT                   /product="Ribosome-binding factor A"
FT                   /note="Operon 242 Gene 6 COG0858 Ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84142"
FT                   /protein_id="ADM84142.1"
FT                   /translation="MANHFRTDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMLGDL
FT                   SVAKVYYTILSNLASDNQKAQIGLEKATGTIKRELGRNLKLYKIPDLTFVKDESIEYGN
FT                   KIDEMLRNLDKN"
FT   gene            517169..517948
FT                   /locus_tag="SPAP_0550"
FT   CDS_pept        517169..517948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0550"
FT                   /product="hypothetical protein"
FT                   /note="Operon 243 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84143"
FT                   /protein_id="ADM84143.1"
FT                   /translation="MAEQDLAMQVLQQVVKLPVVKVDRSKFLVDKFSKELDPKDIPTLL
FT                   EQGTTTLLSQEILDRVANACIRDNVLLASGTSVLAGLAGGLAMAITIPADVAQFYAFSL
FT                   KLAQELGYIYGYEDLWASREELSEDAQNTLLLYLGVMLGVNGTAALLRAGGITIAKQVM
FT                   KTVPNKALTKTLWYPILKKVLRIFGVNLTKGGLAKGIGKFIPILGGIISGGLTFATMKP
FT                   MGESLQKELSKLVNYSEVQYQEDVETIRKEAEIIKGE"
FT   gene            517950..518132
FT                   /locus_tag="SPAP_0551"
FT   CDS_pept        517950..518132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0551"
FT                   /product="hypothetical protein"
FT                   /note="Operon 243 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84144"
FT                   /protein_id="ADM84144.1"
FT                   /translation="MNPIKAFAKIYGNYFLTVQGVKVMKTIKKADHVVVGLGKLFIADK
FT                   LMDTARWLIKPEERE"
FT   gene            518637..518870
FT                   /locus_tag="SPAP_0552"
FT   CDS_pept        518637..518870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0552"
FT                   /product="hypothetical protein"
FT                   /note="Operon 244 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84145"
FT                   /protein_id="ADM84145.1"
FT                   /translation="MDNIIDVSIPVAEVVDKHPEVLEILVELGFKPLANPLMRNTVGRK
FT                   VSLKQGSKLAGTPMDKIVRTLEANGYEVIGLD"
FT   gene            518870..520204
FT                   /locus_tag="SPAP_0553"
FT   CDS_pept        518870..520204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0553"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="Operon 244 Gene 2 COG2461 Uncharacterized conserved
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84146"
FT                   /protein_id="ADM84146.1"
FT                   /translation="MADERIHVLRDILLELHNGASPESVQERFDATFAGVSAIEISLME
FT                   HELMNSDSGVTFEDVMELCDVHANLFKNAIKGVEVSDTEHPGHPVRVFKEENLALRAAL
FT                   IRIRRLLDTYELMEDEEMLAEMRKGLVRQMGLVGQFDIHYQRKEELFFPIMERYGHDSP
FT                   PKVMWGVDDQIRELFQTALTTAKSLPEVSISSVKEVFEAFAIEFESMIFKEESILLMIL
FT                   LESFTQDDWLQIAEESDVYGYAIIRPSEKWVPERQSFIEEKIAEEPVQLDTAEGQVQQV
FT                   IDTPEGHFTITFTPKEKEAVLDRHSQQAFGNGYLSVEQANLILNHLPMEITFVNKEDIF
FT                   QYYNDNTPADEMIFKRTPSQVGRNVELCHPPKYLDKVKAIMKGLREGTKDKYEMWFKSE
FT                   SRGKFVHITYAAVHDENGEFQGVLEYVQDIQPYREIDTDYFRGLE"
FT   gene            520214..520468
FT                   /locus_tag="SPAP_0554"
FT   CDS_pept        520214..520468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0554"
FT                   /product="hypothetical protein"
FT                   /note="Operon 244 Gene 3 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84147"
FT                   /protein_id="ADM84147.1"
FT                   /translation="MSYEQEFMKEFEAWVNTQIMINDMAHKESQKVYEEDQDERAKDAM
FT                   IRYESRLDAYQFLLGKFENFKVGKGFHDLPEGLFGERNY"
FT   gene            520564..520959
FT                   /locus_tag="SPAP_0555"
FT   CDS_pept        520564..520959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0555"
FT                   /product="hypothetical protein"
FT                   /note="Operon 244 Gene 4 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84148"
FT                   /protein_id="ADM84148.1"
FT                   /translation="MSKKLNRKKQLRNGLRRAGAFSSTVTKVVDETKKVVKRAEQSASA
FT                   AGKAVSKKVEQAVEATKEQAQKVANSVEDFAANLGGLPLDRAKTFYDEGINSASDFKNW
FT                   TEKELLALKGIGPATIKKLKENGIKFK"
FT   gene            521371..521820
FT                   /locus_tag="SPAP_0556"
FT   CDS_pept        521371..521820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0556"
FT                   /product="Conserved protein/domain typically associated
FT                   with flavoprotein oxygenases, DIM6/NTAB family"
FT                   /note="Operon 245 Gene 1 COG1853 Conserved protein/domain
FT                   typically associated with flavoprotein oxygenases,
FT                   DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84149"
FT                   /protein_id="ADM84149.1"
FT                   /translation="MIGVVARENAAEQIKQYQKFTVNISDETSMLAMEQAGFISHQEKL
FT                   ERLGVHYEISERTQTPILDACPLVLDCRVDRIVEEDGICHIFAKILERLVAPELLDEKG
FT                   HFKNQLFAPTYFMGDGYQRVYRYLDKRVDMKGSFIKKARKKDGKN"
FT   gene            521807..522367
FT                   /locus_tag="SPAP_0557"
FT   CDS_pept        521807..522367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0557"
FT                   /product="hypothetical protein"
FT                   /note="Operon 245 Gene 2 protein supported
FT                   gi|125718620|ref|YP_001035753.1| ribosomal protein
FT                   N-acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84150"
FT                   /protein_id="ADM84150.1"
FT                   /translation="MARTELPDKIEIERLVLRVRTVADAEDIHVYASLPEVAYPAGFLP
FT                   VKTLEDEIYYLGHILPNRNQKENLPAGYGIVVKGTDKIVGSVDFNHRHEDDVLEIGYTL
FT                   HPDYWGRGYVPEAARALIDLAFKDLGLHKIELTCFGYNLQSQRVAEKLGFTLEARIRDR
FT                   KDAQGNCCDDLRYALLKSEWGVI"
FT   gene            522367..522945
FT                   /locus_tag="SPAP_0558"
FT   CDS_pept        522367..522945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0558"
FT                   /product="hypothetical protein"
FT                   /note="Operon 245 Gene 3 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84151"
FT                   /protein_id="ADM84151.1"
FT                   /translation="MHLFIIGAPASGKMTIGQELSRLTDATLFYNHQAIDFALEIYQDY
FT                   TEEMWEFVRGITFSFLGASARNQRSVILTDVIDFSNQYHLIYLKQIQNLLDDYHQEILF
FT                   VELETSLEECIRRNRTENRLKHKPLKRHIEVSEREILETAETLQLNSQYQPNELHHYFK
FT                   INNTNLSAEEAAKQIQNKINKIEKGHTHV"
FT   gene            522938..525589
FT                   /locus_tag="SPAP_0559"
FT   CDS_pept        522938..525589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0559"
FT                   /product="Valyl-tRNA synthetase"
FT                   /note="Operon 245 Gene 4 COG0525 Valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84152"
FT                   /protein_id="ADM84152.1"
FT                   /translation="MSKELSPKYNPAEVEAGRYQKWLDADVFKPSGDQKAKPYSIVIPP
FT                   PNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGIS
FT                   RYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDL
FT                   YKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPE
FT                   TMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVRDEHADPEFGTGVVKITPAHDP
FT                   NDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRV
FT                   HSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTDDKVEFYPPRFNDTFLQWMEN
FT                   VHDWVISRQLWWGHQIPAWYNEAGEIYVGEEAPEGDGWTQDEDVLDTWFSSALWPFSTM
FT                   GWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQ
FT                   GRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWN
FT                   ISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGV
FT                   AGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHSIMPFVT
FT                   EEIFGQYAEGSIVTAAYPTVNPAFEDLAAHTGVESLKDLIRAVRNARAEVNVAPSKPIT
FT                   ILVKTSDSDLEAFFNSNVNYIKRFTNPEHLEIASTIPAPELAMSSVITGAEIYLPLADL
FT                   LNVEEELARLDKELAKWQKELDMVGKKLSNERFVANAKPEVVQKERDKQADYQAKYDAT
FT                   VARIDEMKKLVK"
FT   gene            525660..526415
FT                   /locus_tag="SPAP_0560"
FT   CDS_pept        525660..526415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0560"
FT                   /product="Zn-finger"
FT                   /note="Operon 245 Gene 5 COG5048 FOG: Zn-finger"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84153"
FT                   /protein_id="ADM84153.1"
FT                   /translation="MSKHPHYELLNLIGYGLAKFDKLFIKEFQCSSKSEFYRYVVSLGI
FT                   AETTGVVKNRMDLFDPYFDNNRKGWWQKAEVYRFRKDLIDMMFGNEDVHSYAEIVKMLL
FT                   ASEGKKTGITIVEKPIVRTKFKRLQETGMEAENYFILHFDKEEKFQGGQLTDARLYGDG
FT                   YDFQVDVQEYSYLAEVKGIRKSKGRVRLTAKEFEKVKEFQSDFILSLVTNLDDIPKLVL
FT                   IDNPLKHFEFKKNIIKNEIIEYRSLEDLY"
FT   gene            526700..526801
FT                   /locus_tag="SPAP_0561"
FT   CDS_pept        526700..526801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0561"
FT                   /product="hypothetical protein"
FT                   /note="Operon 246 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84154"
FT                   /protein_id="ADM84154.1"
FT                   /translation="MAVFVSLDGIVVEILDVFFSFNGDSEFFLCIAF"
FT   gene            526925..527794
FT                   /locus_tag="SPAP_0562"
FT   CDS_pept        526925..527794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0562"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 247 Gene 1 COG4951 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84155"
FT                   /protein_id="ADM84155.1"
FT                   /translation="MERSRFEEMFQLQSSHLTTQEKSQLFTSVFAGRYDVYAKNFINEQ
FT                   GKIQYFPSYDYGWKQLPPEKRSFQTLTNSVLKSHFRGEAAIGIFPMHLDDSCYFLVLDL
FT                   DEGDWKEAGLTIRRIARERQMEAHLEISRSGYGLHIWFFFEEAILSRKARLFGKKLLEL
FT                   AMQESMQLSFDSFDRMFPNQDVLPKGGFDNLISLPFQGEAYHQGRTVFVDEQFQPYEDQ
FT                   WRYLQEIQKISTAKVALLIQEELGKQELDKELKVVLSNMIQLKKSSVTPKTLFFLKNMA
FT                   SFSNPEFY"
FT   gene            complement(527808..528185)
FT                   /locus_tag="SPAP_0563"
FT   CDS_pept        complement(527808..528185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0563"
FT                   /product="Transposase-like protein, IS1515"
FT                   /note="Operon 248 Gene 1 COG3293 Transposase and
FT                   inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84156"
FT                   /protein_id="ADM84156.1"
FT                   /translation="MLDLTTHKVCQMAFSDGHTHDFTLFKESIGQSLPETTLAFVDLGY
FT                   LGILKFHENTFIPAKNSKNRRLSEDDKQLNKEMSAIRIEIEHFNAKFKTFQIMSVPYRN
FT                   RRKRFELRAELICAIINYEVN"
FT   gene            complement(528198..528623)
FT                   /locus_tag="SPAP_0564"
FT   CDS_pept        complement(528198..528623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0564"
FT                   /product="Transposase-like protein, IS1515"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84157"
FT                   /protein_id="ADM84157.1"
FT                   /translation="METVYDKAQKLNSKNFKLLIGVKKETFQLMLEHLNSAYQIQHRKG
FT                   GRPRSLPMEDQLIMTLRYLRYYPTQRLLAFDFGVGVATVNAIITWVEDTLRASGSFDLD
FT                   HLEAPSAAVAIDVTESPIQRPKKTKAKIILVKRNDTP"
FT   gene            528798..528944
FT                   /locus_tag="SPAP_0565"
FT   CDS_pept        528798..528944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0565"
FT                   /product="DNA or RNA helicases of superfamily II"
FT                   /note="Operon 249 Gene 1 COG1061 DNA or RNA helicases of
FT                   superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84158"
FT                   /protein_id="ADM84158.1"
FT                   /translation="MEDRRKVQRSIRVAFKGELTLEQELALSDMNSKENGLLHAGQVLG
FT                   RPF"
FT   gene            529040..530356
FT                   /locus_tag="SPAP_0566"
FT   CDS_pept        529040..530356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0566"
FT                   /product="DNA or RNA helicases of superfamily II"
FT                   /note="Operon 249 Gene 2 COG1061 DNA or RNA helicases of
FT                   superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84159"
FT                   /protein_id="ADM84159.1"
FT                   /translation="MTFEEEEAIRYTASGREKVIGYVGQYGGTKKWLSKLVDVVMIQSL
FT                   FKLENSQSLLDEYEMMIVDECHHVSALMFEKVVAQFRGKYLYGLTATPERKNGHEPIVF
FT                   QRIGEILHTADKRETDFKRQLQLRSTSFGHLEIEKTKASNFIQLSNWIATDSARNQLIL
FT                   KDILAQVAEGRNILVLVNRIQQIDVFEKLLKEKEVDDCYIISGKTKVRERTSLLETLEQ
FT                   LDKGFVLLSTGKYIGEGFDLPQLDTLILAAPFSWKNNLIQYAGRIHRNYKDKSLVRIFD
FT                   YVDIHVPYLEKMFQKRQVAYRKMDYRAIEGEEKQFVYVDSRYEKVLREDLAGERQECML
FT                   ILPYVHQTKLMNFLKEFRISQIEICIPETVVNKALLDQLKSQKIKVSFTQSKIVTPILL
FT                   VNKTIVWYGAMPLLGKVDEMTILRLELASIVSELVAGLR"
FT   gene            530656..531495
FT                   /locus_tag="SPAP_0567"
FT   CDS_pept        530656..531495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0567"
FT                   /product="Transcriptional antiterminator"
FT                   /note="Operon 250 Gene 1 COG3711 Transcriptional
FT                   antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84160"
FT                   /protein_id="ADM84160.1"
FT                   /translation="MIIKRILNHNAVIAQSKKDIDILLFGRGIAFGRKIGDKVNPIDIE
FT                   KSFFLKNRDNMTRFTEMFINVPLELVYITEKIINLGKITLGNNFDEIIYINLTDHISSS
FT                   IERYKEGVIISNPLRWEISKYYKEEFELGKRALQIIKKELGIELPIDEAAFIALHFVNA
FT                   NLENNFQESYKITEIIMGIEKIIQDFYCTEFNQDSIDYYRFITHIKLFAHRLVENTTYC
FT                   DDDDEDLLALMKNKYPREYECGEQVAMFIQTEYNYLLTSSELVYLMAHIRRLTKNLD"
FT   gene            531513..533351
FT                   /locus_tag="SPAP_0568"
FT   CDS_pept        531513..533351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0568"
FT                   /product="Phosphotransferase system IIC component,
FT                   glucose/maltose/N-acetylglucosamine-specific"
FT                   /note="Operon 250 Gene 2 COG1263 Phosphotransferase system
FT                   IIC components,
FT                   glucose/maltose/N-acetylglucosamine-specific"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84161"
FT                   /protein_id="ADM84161.1"
FT                   /translation="MSYKDTVQKILDVIGGEKNVNRVTHCVTRLRLELKDENLVNDDDV
FT                   KKIPGVIGIMKKNGQYQIILGNDVANYYKEFVKLGNFELDSVNQGYKGNILERIIEYIA
FT                   GSMTPIIPAMLGGGMLKVLVIILPMLGILQSDSQTIAFLTFFGDAPYYFLPLLLAYSAS
FT                   QKLKVTSTLAMSVAGVLLHPNFVQMVQSGNPLSLFGVPVTPASYGSSVVPILIMVWLMK
FT                   YIEKMIAKLTPAVTKSFLQPTLVLLVSSCIALVVVGPIGVIVGEGLSNLVGQMYGVAGW
FT                   LTLAILGAIMPFIVMTGMHWAFAPIFLAASIATPDVLILPAMLGSNLAQGAASMAVALK
FT                   SKNNNTKQIAFAAGFSALLAGITEPAVYGVTLKYKKPLYAAMIGGGLAGLFAGLTSVKA
FT                   YLFAVPSLIALPQFIYSDAPSNIVNALIVAVISVVITFVLAYIFGIDEEESSSNLEVEA
FT                   GVSNKKMIFSPISGEIIPLSDVQDKTFSDKLIGDGVAIIPSEGKVYAPFDGKITNIFPT
FT                   KHAIGLKSDEGVELLIHIGLDTVELKGQGFISHVEEGDRVFKNQLIFEMDLNLIKTKGY
FT                   ETVTPVIVTNTNDFLDVLVLPNNQTIEHSKELLVIL"
FT   gene            533364..534779
FT                   /locus_tag="SPAP_0569"
FT   CDS_pept        533364..534779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0569"
FT                   /product="Beta-glucosidase/6-phospho-beta-glucosidase/
FT                   beta-galactosidase"
FT                   /note="Operon 250 Gene 3 COG2723
FT                   Beta-glucosidase/6-phospho-beta-glucosidase/beta-
FT                   galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84162"
FT                   /protein_id="ADM84162.1"
FT                   /translation="MTIFPDDFLWGGAVAANQVEGAYNEDGKGLSVQDVLPKGGLGEAT
FT                   ENPTEDNLKLLGIDFYHKYKEDITLFSEMGFNVFRTSIAWSRIFPKGDEEEPNEAGLKY
FT                   YDELFDELHAHGIEPLVTLSHYETPLYLARKYHGWIDRRMIHFYEKFARTVLERYKDKV
FT                   KYWLTFNEVNSVLELPFTSGGIDIPKENLSKQELYQAIHHELVASSLVTKIAREINSEF
FT                   KVGCMVLAMPAYPMTPNPKDVWATHEYENLNYLFSDVHVRGYYPNYAKRYFKENDINIE
FT                   FAAEDAELLKNYTVDFLSFSYYMSVTQSALPTQYNSGEGNIIGGLVNPYLESSEWGWQI
FT                   DPIGLRIILNRYYDRYQIPLFIVENGLGAKDQLIKDELNNLTVQDDYRIQYMKEHLLQV
FT                   AEALQDGVEIMGYTSWGCIDCVSMSTAQLSKRYGLIYVDRNDDGNGTFNRYKKMSFTWY
FT                   KGVIESNGESLFK"
FT   gene            535325..536413
FT                   /locus_tag="SPAP_0570"
FT   CDS_pept        535325..536413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0570"
FT                   /product="Phenylalanyl-tRNA synthetase alpha subunit"
FT                   /note="Operon 251 Gene 1 COG0016 Phenylalanyl-tRNA
FT                   synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84163"
FT                   /protein_id="ADM84163.1"
FT                   /translation="MWFSFYLRETDGGNMSTIEEQLKALREETLTSLKQITAGNEKEMQ
FT                   DLRVSVLGKKGSLTEILKGMKDVSAEMRPIIGKHVNEARDVLTAAFEETAKLLEEKKVA
FT                   AQLASESIDVTLPGRPVATGHRHVLTQTSEEIEDIFIGMGYQVVDGFEVEQDYYNFERM
FT                   NLPKDHPARDMQDTFYITEEILLRTHTSPVQARAMDAHDFSKGPLKMISPGRVFRRDTD
FT                   DATHSHQFHQIEGLVVGKNISMADLQGTLQLIVQKMFGEERQIRLRPSYFPFTEPSVEV
FT                   DVSCFKCGGEGCNVCKKTGWIEIMGAGMVHPRVLEMSGIDATVYSGFAFGLGQERVAML
FT                   RYGINDIRGFYQGDVRFSEQFK"
FT   gene            536413..536922
FT                   /locus_tag="SPAP_0571"
FT   CDS_pept        536413..536922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0571"
FT                   /product="Histone acetyltransferase HPA2-like
FT                   acetyltransferase"
FT                   /note="Operon 251 Gene 2 COG0454 Histone acetyltransferase
FT                   HPA2 and related acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84164"
FT                   /protein_id="ADM84164.1"
FT                   /translation="MIRKVEVADVEVLAKIAKQTFRETFAYDNTEEQLQEYFEEAYSLK
FT                   TLSTELGNPDSETYFIMHEEEIAGFLKVNWGSAQTERELEDAFEIQRLYVLQKFQGFGL
FT                   GKQLFEFALELATKNSFSWAWLGVWEHNTKAQAFYNRYGFEKFSQHHFMVGQKVDTDWL
FT                   LRKKLR"
FT   gene            536999..539404
FT                   /locus_tag="SPAP_0572"
FT   CDS_pept        536999..539404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0572"
FT                   /product="Phenylalanyl-tRNA synthetase beta subunit"
FT                   /note="Operon 251 Gene 3 COG0072 Phenylalanyl-tRNA
FT                   synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84165"
FT                   /protein_id="ADM84165.1"
FT                   /translation="MLVSYKWLKELVDIDVPSQELAEKMSTTGIEVEGVESPAAGLSKI
FT                   VVGEVLSCEDVPETHLHVCQVNVGEEEERQIVCGAPNVRAGIKVMVALPGARIADNYKI
FT                   KKGKIRGLESLGMICSLGELGISDSVVPKEFADGIQILPEDAVPGEEVFSYLDLDDEII
FT                   ELSITPNRADALSMCGVAHEVAAIYDKAVNFKEFTLTETNEAAADALSVIIGTDKAPYY
FT                   AARILDNVTIAPSPQWLQNLLMNEGIRPINNVVDVTNYILLYFGQPMHAFDLDNFEGTD
FT                   IRVREARAGEKLVTLDGEERDLDVNDLVITVADKPVALAGVMGGQATEISEKSSRVVLE
FT                   AAVFNGKSIRKTSGRLNLRSESSSRFEKGINVATVNEALDAAASLIAELAGATVRKGIV
FT                   SAGELDTSDVEVSSTLADVNRVLGTELSYADVEDVFRRLGFGLSGNADSFTVRVPRRRW
FT                   DITIEADLFEEIARIYGYDRLPTSLPKYDGTAGELTATQKLRRQVRTIAEGVGLTEIIT
FT                   YTLTTPEKAVEFTAQPSNLTELMWPMTVDRSVLRQNMISGILDTVAYNVARKNKNLALY
FT                   EIGKVFEQTGNPREELPNEINSFAFALTGLVAEKDFQTVAVPVDFFYAKGILEALFARL
FT                   GLQVTYTATSEIASLHPGRTAVISLGDQVLGFLGQVHPVTAKAYDIPETYVAELNLSAI
FT                   EAALQPAAPFVEITKFPAVSRDVALLLKAEVTHQEVVDAIQAAGVKRLTDIKLFDVFSG
FT                   EKLGLGMKSMAYSLTFQNPEDSLTDEEVARYMEKIQASLEEKVNAEVR"
FT   gene            complement(539472..540473)
FT                   /locus_tag="SPAP_0573"
FT   CDS_pept        complement(539472..540473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0573"
FT                   /product="hypothetical protein"
FT                   /note="Operon 252 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84166"
FT                   /protein_id="ADM84166.1"
FT                   /translation="MIKTFLSALSVILFVIPIIAYSFFPSSNLNNWLSTRPILAQIYAF
FT                   PLATATMASILSFVFFSLSFYKKNKQIRFYSGILLLLSLILLLFGTDKTLSSASNKTKT
FT                   LKLVTWNVANQIEAQHIERIFSHFDADMAIFPELATNIRGEQENQRIKLLFHQVGLSMA
FT                   NYDIFTSPPTNSGIAPVTVIVKKSYGFYTEAKTFHTTRFGTIVLHSRKQNIPDIIALHT
FT                   APPLPGLMEIWKQDLNIIHNQLASKYPKAIIAGDFNATMRHGALAKISSHRDALNVLPP
FT                   FERGTWNSQSPKLFNTTIDHILLPKNHYYVKDLDIVSFQNSDHRCIFTEITF"
FT   gene            540629..540853
FT                   /locus_tag="SPAP_0574"
FT   CDS_pept        540629..540853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0574"
FT                   /product="Transposase-like protein, IS1239"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84167"
FT                   /protein_id="ADM84167.1"
FT                   /translation="MQDNYTTKGKHLTIDSRRLIERWKKEGKSNREIASLLGKAPQTIH
FT                   TEIKRGTVRQCLGKGRFKEVYSADYAQQS"
FT   gene            540907..541035
FT                   /locus_tag="SPAP_0575"
FT   CDS_pept        540907..541035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0575"
FT                   /product="Transposase-like protein, IS30 family"
FT                   /note="Operon 253 Gene 2 COG2826 Transposase and
FT                   inactivated derivatives, IS30 family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84168"
FT                   /protein_id="ADM84168.1"
FT                   /translation="MMVMVKGVNVGISTIYYWIHRGKLGLSKQDLLYPRKGKSLKK"
FT   gene            541227..541424
FT                   /locus_tag="SPAP_0576"
FT   CDS_pept        541227..541424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0576"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="Operon 254 Gene 1 COG1396 Predicted transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84169"
FT                   /protein_id="ADM84169.1"
FT                   /translation="MSELIEARYEQGISQKKLEEVSGISQPVIARMETGKTSPQLDTVL
FT                   KVLASLGKTLAVVPLEQGKS"
FT   gene            541685..543934
FT                   /locus_tag="SPAP_0577"
FT   CDS_pept        541685..543934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0577"
FT                   /product="Methionine synthase II (cobalamin-independent)"
FT                   /note="Operon 255 Gene 1 COG0620 Methionine synthase II
FT                   (cobalamin-independent)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84170"
FT                   /protein_id="ADM84170.1"
FT                   /translation="MSTTIIGFPRLGEFRELKFTTEKYFRKEISEEELLAAAKDLRAKH
FT                   WNIVKEKGITEIPSNDFSHYDNFLDAAFLFNVVPASVQNLDLSDLERYFALGRGYQGEK
FT                   GDVRALPMKKWFNTNYHYIVPKFEKDTQVKLAGHKIFDEFQEAKELGLNTRPVLVGPFT
FT                   FLQLSDFEEGVKADDFVDSLVSAYQEVFAKLAELGTTRIQLDEAALVKDLTAEEKALFL
FT                   NLYNKLLADKKGLEVLLQTYFGDVRDVYADLVNLPVDAIGLDFVEGKKTLELVKGGFPA
FT                   DKTLYVGIVNGKNIWRNNYEKSLTVLEQIPAENIVLTSSCSLLHVPFTTANEEFEPALL
FT                   NHFAFAVEKLDEIRDLDAIRNGQGSEALAANKELFATERVGENAELRARIAGLTDADYT
FT                   RLPAFAEREAIQEEAFKLPALPTTTIGSFPQTKEVRAKRLAYRKGELSQKEYDAFLAET
FT                   IDEWIKWQEDIDFDVLVHGEFERNDMVEYFGQNLSGYLFSKNGWVQSYGMRGVKPPIIW
FT                   GDVTRLNPITVKWSSYAQSRTNKPVKGMLTGPVTILNWSFPREDISIKDSTLQIALAIK
FT                   DEVLDLEAAGVKIIQIDEAALREKLPLRRSDWYEDYLDWAIPAFRLVHSTVAPDTQIHT
FT                   HMCYSEFTDIIPAIDNMDADVISFEASRSNLEILDALKAKNFQTEVGPGVYDIHSPRVP
FT                   NEGEIDNTIEVILAKVPSKKVWINPDCGLKTRGIPETKESLIRLVEAAKAAREKL"
FT   gene            543998..544864
FT                   /locus_tag="SPAP_0578"
FT   CDS_pept        543998..544864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0578"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="Operon 255 Gene 2 COG0685
FT                   5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84171"
FT                   /protein_id="ADM84171.1"
FT                   /translation="MSRQTPSLSFEVFPPNPAVGNGNIISALQDMQELAPHFISVTASN
FT                   NKFNIKETTVRLADFIQNDLAIPTIAHLPAIYLTKDKVAETIADLDKVGVQKILALRGD
FT                   IIPDVEPQKDFRYATDLIEFIKEQTPHFDIIGACYPEGHPDSPNQISDIQNLKKKVDAG
FT                   CSSLVTQLFFDNERFYDFQDKCILAGIDVPIHAGIMPILNRNQALRLLKTCENIHLPRK
FT                   FKAILDKYEHDPESLRAAGLAYAVDQIVDLVTQDVAGVHLYTMNNADTAKYIHQATHAL
FT                   FNHQSLG"
FT   gene            545549..547762
FT                   /locus_tag="SPAP_0579"
FT   CDS_pept        545549..547762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0579"
FT                   /product="hypothetical protein"
FT                   /note="Operon 256 Gene 1 protein supported
FT                   gi|62291006|ref|YP_222799.1| polynucleotide
FT                   phosphorylase/polyadenylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84172"
FT                   /protein_id="ADM84172.1"
FT                   /translation="MAKQVFQTTFVGRELIVETGQVAKQANGSVVVRYGESTVLTAAVM
FT                   SKKMATGDFFPLQVNYEEKMYAAGKFPGGFMKREGRPSTDATLTARLIDRPIRPMFAEG
FT                   FRNEVQVINTVLSYDENASAPMAAMFGSSLALSISDIPFDGPIAGVQVGYVDGQIIINP
FT                   SQEQAEQSLLELTVAGTKHAINMVESGAKELSEEIMLEALLKGHEAVKELITFQEEIVA
FT                   AVGKEKAEVELLHVDAELQAEIIAAYNSDLQKAVQVEEKLAREAATQAVKDQVTAVYEE
FT                   KYANHEEFDRIMRDVAEILEQMEHAEVRRLITEDKVRPDGRKVDEIRPLDAVVDFLPRV
FT                   HGSGLFTRGQTQALSVLTLAPMGETQIIDGLDPEYKKRFMHHYNFPQYSVGETGRYGAP
FT                   GRREIGHGALGERALAQVLPSLEEFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGV
FT                   PIKAPVAGIAMGLISDGNNYTVLTDIQGLEDHFGDMDFKVAGTRDGITALQMDIKIQGI
FT                   TAEILTEALAQAKKARFEILDVIEATIPEVRPELAPTAPKIDTIKIDVDKIKIVIGKGG
FT                   ETIDKIIAETGVKIDIDEEGNVSIYSSDQDAINRAKEIIAGLVREAKVDEVYRAKVVRI
FT                   EKFGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKIDEKGRIDASMKA
FT                   LLPRPPKPEHDEKGEKSERPHRPRHQKDHKPKKEFTETPKDSE"
FT   gene            547778..548395
FT                   /locus_tag="SPAP_0580"
FT   CDS_pept        547778..548395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0580"
FT                   /product="Serine acetyltransferase"
FT                   /note="Operon 256 Gene 2 COG1045 Serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84173"
FT                   /protein_id="ADM84173.1"
FT                   /translation="MGWWRETIDIVKENDPAARTTLEVLLTYPGVKALAAHRLSHFLWK
FT                   HGFKLLARMYSQFWRFWTQIEIHPGAQIDSGVFIDHGSGLVIGETAIVEKGVLLYHGVT
FT                   LGGTGKDCGKRHPTVRKGALISAHAQVIGPVEIGENAKVGAAAVVVADVPSDVTVVGIP
FT                   AKIVRLHGKKDEPVIHEVEEKREYYVNKLEQAKDASHRSSGL"
FT   gene            548407..549291
FT                   /locus_tag="SPAP_0581"
FT   CDS_pept        548407..549291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0581"
FT                   /product="Acetyltransferase"
FT                   /note="Operon 256 Gene 3 COG0456 Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84174"
FT                   /protein_id="ADM84174.1"
FT                   /translation="MIQARNKLSQEELSEAKKVINCCQNYDGTYRDPYLSNMLNFDPNM
FT                   PAFFLYYEKGELVGLLTVYADDQDVEVTILVHPGHRRQGIARALFTSFEREIASFPIRS
FT                   VTFQTERIFLENHPDFASNWGLIEDEETETWLGKDRRPYPLANVSHLEVLLADSSYQDQ
FT                   ISQLKFQAFSEEHESREVVDRYVAEALKDPESRLYILLKDGQVIGTCTVDLSTNTNYFY
FT                   GLAISEPERGKGYGSYLAKSLVNQLIEQNDKEFQIAVEDSNVGAKRLYEKIGFVKQTQV
FT                   VYLNEKGARDSEV"
FT   gene            549394..550716
FT                   /locus_tag="SPAP_0582"
FT   CDS_pept        549394..550716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0582"
FT                   /product="Cysteinyl-tRNA synthetase"
FT                   /note="Operon 257 Gene 1 COG0215 Cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84175"
FT                   /protein_id="ADM84175.1"
FT                   /translation="MSRDLREFVPIEDGKIKMYVCGPTVYNYIHVGNARSTVAFDTIRR
FT                   YFEYRGYKVAYISNFTDVDDKIINRAREEGITPQEVADKYIAAFREDVTALGVKPATRH
FT                   PRVVEFMADIIRFVEDLIEKGFAYESQGDVYFRVEKSHNYAKLANKTLEDLDLGASGRT
FT                   DEETARKENPVDFALWKSSKPGEISWDSPWGPGRPGWHIECSVMSTEILGDTIDIHGGG
FT                   ADLEFPHHTNEIAQSEAKTGKAFANYWMHNGFVNIDNVKMSKSLGNFITVHDALKTLDG
FT                   QVLRFFFATQHYRKPINFTEKAVRDAETNLKYLKNTYEQPFTGNVDAQELQNFKDKFVA
FT                   AMDEDFNAANGITVVFEMTKWINSGNYDASVKQALADMLEIFGIVFVEEVLDAEIEDLI
FT                   QKRQEARANRDFETADQIRDQLAAQGIKLLDTKDGVRWTRD"
FT   gene            550709..551095
FT                   /locus_tag="SPAP_0583"
FT   CDS_pept        550709..551095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0583"
FT                   /product="hypothetical protein"
FT                   /note="Operon 257 Gene 2 protein supported
FT                   gi|163764762|ref|ZP_02171816.1| ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84176"
FT                   /protein_id="ADM84176.1"
FT                   /translation="MIDVNLINGIALAFEGDAVYSMYIRRHLILKGMTKPNKLHQEATK
FT                   YVSAKAQARLIALMLEEQVLTEKEEEIYKRGRNTNSHTKAKNADVVTYRMSTGFEAVMG
FT                   YLHMTENLERLESLVSWCIQKVEG"
FT   gene            551099..551983
FT                   /locus_tag="SPAP_0584"
FT   CDS_pept        551099..551983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0584"
FT                   /product="Regulator of polyketide synthase expression"
FT                   /note="Operon 257 Gene 3 COG2508 Regulator of polyketide
FT                   synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84177"
FT                   /protein_id="ADM84177.1"
FT                   /translation="MREKELQDWFPEARISDQPVEKEGYLTLPLASQQWILLEEAGLSE
FT                   REKQLVALLTQQEQARSLNPWYSYLVEGKGQAPQVFKKIQLVYCHLSYFQQENLTSWLD
FT                   MMRTLFPNCQTVLQVGAQDYVFVLQQDKYTSVRDILSDTIEAVEYDFGLRLSIMLGQVW
FT                   SQTGHQALSDLIKAERDLFKTWWRQGHQGVHTFSQLYLWSMGERLVDLKPIKECLHQMI
FT                   LDQDQIQEIILSLWENSAVLTKTAQQLYLHRNSLQYKIDKWEELTGLQLKELTDLTLCY
FT                   QLILGSLSTIVGL"
FT   gene            552225..552824
FT                   /locus_tag="SPAP_0585"
FT   CDS_pept        552225..552824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0585"
FT                   /product="hypothetical protein"
FT                   /note="Operon 258 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84178"
FT                   /protein_id="ADM84178.1"
FT                   /translation="MQILCYFTITVVAKPNNSGEVHLDVSIEDNQGGSGHNFSSVSSSS
FT                   QTAKYEETGYNNNSSLYTTIDKTSDATALLKLKLNNVDNQPATEVPSSGITVKLNAKDN
FT                   AGNWTSASNKKEITVKIVSAKPTYPDKILVKNPDNIKDTEKNAIIEKLKEANKNHPAGA
FT                   PTFAKGEGEHANDIVATYSDGTTYYAPLNDVTKYAR"
FT   gene            552970..553143
FT                   /locus_tag="SPAP_0586"
FT   CDS_pept        552970..553143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0586"
FT                   /product="hypothetical protein"
FT                   /note="Operon 259 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84179"
FT                   /protein_id="ADM84179.1"
FT                   /translation="MKSIVTSIDERLRTRLRVIIWKQWKKKSRRLWGLLKLGVPKWIAD
FT                   KVSGWGDHYQLY"
FT   gene            553494..554771
FT                   /locus_tag="SPAP_0587"
FT   CDS_pept        553494..554771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0587"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /note="Operon 260 Gene 1 COG0577 ABC-type antimicrobial
FT                   peptide transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84180"
FT                   /protein_id="ADM84180.1"
FT                   /translation="MNPIQRSWAYVSRKRLRSFILFLILLVLLAGISACLTLMKSNKTV
FT                   ESNLYKSLNTSFSIKKIENGQTFKLSDLASVSKIKGLENVSPELETVAKLKDKEAVTGE
FT                   QSVERDDLSAADNNLVSLTALEDSSKDVTFTSSAFNLKEGRHLQKGDSKKILIHEELAK
FT                   KNGLSLHDKIGLDAGQSESGKGQTVEFEIIGIFSGKKQEKFTGLSSDFSENQVFTDYES
FT                   SQTLLGNSEAQVSAARFYVENPKEMDGLMKQVENLALENQGYQVEKENKAFEQIKDSVA
FT                   TFQTFLTIFLYGMLIAGAGALILVLSLWLRERVYEVGILLALGKGKSSIFLQFCLEVVL
FT                   VSLGALLPAFVAGNGITTYLLQTLLASGDQASLQDTLAKASSLSTSILSFAESYVFLVL
FT                   LSCLSVALCFLFLFRKSPKEILSSIS"
FT   gene            554784..555431
FT                   /locus_tag="SPAP_0588"
FT   CDS_pept        554784..555431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0588"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /note="Operon 260 Gene 2 COG1136 ABC-type antimicrobial
FT                   peptide transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84181"
FT                   /protein_id="ADM84181.1"
FT                   /translation="MTLLQLQDVTYRYKNTAEAVLYQIDYNFEPGKFYSIIGESGAGKS
FT                   TLLSLLAGLDSPVEGSILFQGEDIRKKGYSYHRMHHISLVFQNYNLIDYLSPLENIRLV
FT                   NKKASKNTLLELGLDESQIKRNVLQLSGGQQQRVAIARSLVSEAPVILADEPTGNLDPK
FT                   TAGDIVELLKSLAQKTGKCVIVVTHSKEVAQASDITLELKDKKLTETRNTSK"
FT   gene            555483..556862
FT                   /locus_tag="SPAP_0589"
FT   CDS_pept        555483..556862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0589"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /note="Operon 260 Gene 3 COG0577 ABC-type antimicrobial
FT                   peptide transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84182"
FT                   /protein_id="ADM84182.1"
FT                   /translation="MLHNAFAYVTRKFFKSIVIFLIILLMASLSLVGLSIKGATAKASQ
FT                   ETFKNITNSFSMQINRRVNQGTPRGAGNIKGEDIKKITENKAIESYVKRINAIGDLTGY
FT                   DLIETPETKKNLTADRAKRFGSSLMITGVNDSSKEDKFVSGSYKLVEGEHLTNDDKDKI
FT                   LLHKDLAAKHGWKVGDKVKLDSNIYDADNEKGAKETVEVTIKGLFDGHNKSAVTYSQEL
FT                   YENTAITDIHTAAKLYGYTEDTAIYGDATFFVTADKNLDDVMKELNGISGINWKSYTLV
FT                   KSSSNYPALEQSISGMYKMANLLFWGSLSFSVLLLALLLSLWINARRKEVGILLSIGLK
FT                   QASILGQFITESILIAIPALVSAYFLANYTARAIGNTVLANVTSGVAKQASKAAQASNL
FT                   GGGAEVDGFSKTLSSLDISIQTSDFIIIFVLALVLVVLVMALASSNLLRKQPKELLLDG
FT                   E"
FT   gene            557174..557830
FT                   /locus_tag="SPAP_0590"
FT   CDS_pept        557174..557830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0590"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /note="Operon 261 Gene 1 COG0745 Response regulators
FT                   consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84183"
FT                   /protein_id="ADM84183.1"
FT                   /translation="MKILIVEDEEMIREGVSDYLTDCGYETIEAADGQEALEQFSSYEV
FT                   ALVLLDIQMPKLNGLEVLAEIRKTSQVPVLMLTAFQDEEYKMSAFASLADGYLEKPFSL
FT                   SLLKVRVDAIFKRYYDTGRIFSYKDTKVDFESYSASIAGQEVPINAKELEILDYLVKNE
FT                   GRALTRSQIIDAVWKATDEVPFDRVIDVYIKELRKKLDLDCILTVRNVGYKLERK"
FT   gene            557827..559155
FT                   /locus_tag="SPAP_0591"
FT   CDS_pept        557827..559155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0591"
FT                   /product="Signal transduction histidine kinase"
FT                   /note="Operon 261 Gene 2 COG0642 Signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84184"
FT                   /protein_id="ADM84184.1"
FT                   /translation="MKRTGLFAKIFIYTFSIFSVLVICLHLAIYFLFPSTYLSHRQETI
FT                   GQKATAIAQSLEGKDRQIIEQVLDLYSQTSDIKGTVKGEMTEDKLEVKDSLPLDTDRQT
FT                   TSLFIEEREVKTQDGGTMILQFLASMDLQKEAEQISLQFLPYTLLASFLISLLVAYIYA
FT                   RTIVAPILEIKRVTRRMMYLDAQVRLRVDSKDEIGNLKEQINSLYQHLLTVIADLHEKN
FT                   EAILQLEKMKVEFLRGASHELKTPLASLKILIENMRENIGRYKDRDQYLGVALGIVDEL
FT                   NHHVLQILSLSSVQELRDDRETIDLLQMTQNLVKDYALLAKERELQIDNSLTHQQAYLN
FT                   PSVMKLILSNLISNAIKHSVPGGLVRIGEREGELFIENSCSSEEQEKLAQSFSDNASRK
FT                   VKGSGMGLFVVKSLLEHEKLAYRFEMEENRLTFFIDFPKVVQD"
FT   gene            559296..560177
FT                   /locus_tag="SPAP_0592"
FT   CDS_pept        559296..560177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0592"
FT                   /product="Fructose/tagatose bisphosphate aldolase"
FT                   /note="Operon 262 Gene 1 COG0191 Fructose/tagatose
FT                   bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84185"
FT                   /protein_id="ADM84185.1"
FT                   /translation="MAIVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKKAPV
FT                   LIQTSMGAAKYMGGYKVARNLIANLVESMGITVPVAIHLDHGHYEDALECIEVGYTSIM
FT                   FDGSHLPVEENLKLAKEVVEKAHAKGISVEAEVGTIGGEEDGIIGKGELAPIEDAKAMV
FT                   ETGIDFLAAGIGNIHGPYPVNWEGLDLDHLQKLTEALPGFPIVLHGGSGIPDEQIQAAI
FT                   KLGVAKVNVNTECQIAFANATRKFARDYEANEAEYDKKKLFDPRKFLADGVKAIQASVE
FT                   ERIDVFGSEGKA"
FT   gene            complement(560498..561688)
FT                   /locus_tag="SPAP_0593"
FT   CDS_pept        complement(560498..561688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0593"
FT                   /product="Predicted ferric reductase"
FT                   /note="Operon 263 Gene 1 COG4097 Predicted ferric
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84186"
FT                   /protein_id="ADM84186.1"
FT                   /translation="MKSVKGLLFIIASFILTLLTWMNTSPQFMIPGLALTSLSLTFILA
FT                   TRLPLLESWFHGLEKVYTVHKFTAFLSIILLIFHNFSMGGLWGSRLAAQFGNLAIYIFA
FT                   SIILVAYLGKYIQYEAWRWIHRLVYLAYILGLFHIYMIMGNRLLTFNLLSFLVGSYALL
FT                   GLLAGFYIIFLYQKISFPYLGKITHLKRLNHDTREIQIHLSRPFNYQSGQFAFLKIFQE
FT                   GFESAPHPFSISGGHGQTLYFTIKNSGDHTKNIYDNLQAGSKVTLDRAYGHMIIEEGRE
FT                   NQVWIAGGIGITPFISYIREHPILDKQVHFYYSFRGDENAVYLDLLRNYAQKNPNFELH
FT                   LIDSTKDGYLNFEQKEVPEHATVYMCGPISMMKALAKQIKKQNPKTELIYEGFKFK"
FT   gene            complement(561946..562605)
FT                   /locus_tag="SPAP_0594"
FT   CDS_pept        complement(561946..562605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0594"
FT                   /product="ABC-type amino acid transport system, permease
FT                   component"
FT                   /note="Operon 264 Gene 1 COG0765 ABC-type amino acid
FT                   transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84187"
FT                   /protein_id="ADM84187.1"
FT                   /translation="MESILEVLTPDNLVFIFKGFGLTLYISLIAIILSTIIGTVLAVMR
FT                   NGKNPVLRIISSIYIEFVRNVPNLLWIFTIFLVFKMKSTPAGITAFTLFTSAALVEIIR
FT                   GGLNAVDKGQYEAGMSQGFTSAQILYYIILPQAIRKMLPAIISQFVTVIKDTSLLYSVI
FT                   ALQELFGASQILMGRYFEPEQVFSLYILIALIYFSFNLAISSLSHMLAKRWQQAAE"
FT   gene            complement(562615..563292)
FT                   /locus_tag="SPAP_0595"
FT   CDS_pept        complement(562615..563292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0595"
FT                   /product="ABC-type amino acid transport system, permease
FT                   component"
FT                   /note="Operon 264 Gene 2 COG0765 ABC-type amino acid
FT                   transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84188"
FT                   /protein_id="ADM84188.1"
FT                   /translation="MTDLSSWTAYFQDFGQFFNGFLFTLALAIGSFILAMVLGIFFGAM
FT                   STSKRPILRILARIFVEFYQNTPLLVQFVIVFYGLPLISDHIIMIPIYWTAVLCVGLYH
FT                   GAYIAEVIRSGIQSIPSGQMEAALSQGFTYISAMRLIILPQAFRIILPPLTNQIVNLIK
FT                   NTSTVAIISGVDLMFVTKSWSALNGNYIPAFLGAALLYFALCFPVAQFGRKMEQANKKA
FT                   YSL"
FT   gene            complement(563305..564099)
FT                   /locus_tag="SPAP_0596"
FT   CDS_pept        complement(563305..564099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0596"
FT                   /product="ABC-type amino acid transport/signal transduction
FT                   systems, periplasmic component/domain protein"
FT                   /note="Operon 264 Gene 3 COG0834 ABC-type amino acid
FT                   transport/signal transduction systems, periplasmic
FT                   component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84189"
FT                   /protein_id="ADM84189.1"
FT                   /translation="MKKKFFLSALLISLFGLAAAKPVQADTSIADIQKRGELVVGVKQD
FT                   VPNFGYKDPKTGTYSGIETDLAKMVADELKVKIRYVPVTAQTRGPLLDNEQVDMDIATF
FT                   TITDERKKLYNFTSPYYTDASGFLVNKSAKIKKIEDLNGKTIGVAQGSITQRLITELGK
FT                   KKGLKFKFVELGSYPELITSLHAHRIDAFSVDRSILSGYTNKRTALLDDSFKPSDYGIV
FT                   TKKSNTELNDYLDNLVTKWSKDGSLQKLYDRYKLKPSSHTAD"
FT   gene            complement(564110..564868)
FT                   /locus_tag="SPAP_0597"
FT   CDS_pept        complement(564110..564868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0597"
FT                   /product="ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /note="Operon 264 Gene 4 COG1126 ABC-type polar amino acid
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84190"
FT                   /protein_id="ADM84190.1"
FT                   /translation="MALVEFKNVEKYYGDYHALRNINLRFEKGQVVVLLGPSGSGKSTL
FT                   IRTINGLETVDKGSLLVNGHQVAGASQKDLVPLRKEVGMVFQHFNLYPHKTVLENVTLA
FT                   PIKVLGIDKKEAEKTAQKYLEFVNMWDKKDSYPAMLSGGQKQRIAIARGLAMHPELLLF
FT                   DEPTSALDPETIGDVLAVMQKLAHDGMNMIIVTHEMGFAREVADRIIFMADGEVLVDTT
FT                   DVDNFFDNPSEPRAQQFLSKIINHESDKVK"
FT   gene            565133..567367
FT                   /locus_tag="SPAP_0598"
FT   CDS_pept        565133..567367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0598"
FT                   /product="Single-stranded DNA-specific exonuclease"
FT                   /note="Operon 265 Gene 1 COG0608 Single-stranded
FT                   DNA-specific exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84191"
FT                   /protein_id="ADM84191.1"
FT                   /translation="MDVFLITPTYEWQFALQVEDADFTKIAKKAGLGPEVARLLFERGI
FT                   QDQESLKKFLEPSLEDLHDAYLLHDMDKAVERIRQAIEEGENILVYGDYDADGMTSASI
FT                   VKESLEQLGAECRVYLPNRFTDGYGPNASVYKYFIEQEGISLIVTVDNGVAGHEAIALA
FT                   QSMGVDVIVTDHHSMPETLPDAYAIVHPEHPDADYPFKYLAGCGVAFKLACALLEEVQV
FT                   ELLDLVAIGTIADMVSLTDENRILVQYGLEMLGHTQRIGLQEMLDMAGIAANEVTEETV
FT                   GFQIAPRLNALGRLDDPNPAIDLLTGFDDEEAHEIAFMIHQKNEERKEIVQSIYEEAKT
FT                   MVDPEKKVQVLAKEGWNPGVLGIVAGRLLEELGQTVIVLNIEDGRAKGSARSVEAVDIF
FT                   EALDPHRDLFIAFGGHAGAAGMTLEVEQLSDLSQVLEDYVREKGADAGGKNKLNLDEEL
FT                   DLEALSLETVKSFERLAPFGMDNQKPIFYIKNFQVESARTMGAGNAHLKLKISKGEASF
FT                   EVVAFGQGRWATEFSQTKNLELAVKLSVNQWNGQTALQLMMVDARVEGVQLFNIRGKNA
FT                   VLPEGVPVLDFPGELPNLAASEAIVVKNIPEDITQLKTIFQEQHFSAVYFKNDIDKAYY
FT                   LTGYGTRDQFAKLYKTIYQFPEFDIRYKLKDLAAYLNIQQILLVKMIQVFEELGFVTIK
FT                   DGVMTVNKEAPKREIGESQIYQNLKQTVKDQEMMALGTVQEIYDFLMEKE"
FT   gene            567542..569203
FT                   /locus_tag="SPAP_0599"
FT   CDS_pept        567542..569203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0599"
FT                   /product="Predicted hydrolase of the metallo-beta-lactamase
FT                   superfamily"
FT                   /note="Operon 266 Gene 1 COG0595 Predicted hydrolase of the
FT                   metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84192"
FT                   /protein_id="ADM84192.1"
FT                   /translation="MSNISLTTLGGVRENGKNMYIAEIGESIFVLNVGLKYPENEQLGV
FT                   DVVIPNMDYLFENSDRIAGVFLTHGHADAIGALPYLLAEAKVPVFGSELTIELAKLFVK
FT                   GNDAVKKFNDFHVIDENTEIDFGGTVVSFFPTTYSVPESLGIVLKTSEGSIVYTGDFKF
FT                   DQTASESYATDFARLAEIGRDGVLALLSDSANADSNIQVASESEVRDEITQTIADWEGR
FT                   IIVAAVSSNLSRIQQIFDAADKTGRRIVLTGFDIENIVRTAIRLKKLSLANEILLIKPK
FT                   DMSRFEDHELIILETGRMGEPINGLRKMSIGRHRYVEIKDGDLVYIATAPSIAKEAFVA
FT                   RVENMIYQAGGVVKLITQSLHVSGHGNVRDLQLMINLLQPKYLFPVQGEYRELDAHAKA
FT                   AMAVGMLPERIFIPKKGTTMAYENGDFVPAGSVSAGDILIDGNAIGDVGNVVLRDRKVL
FT                   SEDGIFIVAITVNRREKKIVARARVHTRGFVYLKKSRDILRESSELINQTVEDYLQGDD
FT                   FDWADLKGKVRDNLTKYLFDQTKRRPAILPVVMEAK"
FT   gene            569272..570051
FT                   /locus_tag="SPAP_0600"
FT   CDS_pept        569272..570051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0600"
FT                   /product="Predicted esterase"
FT                   /note="Operon 266 Gene 2 COG0627 Predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84193"
FT                   /protein_id="ADM84193.1"
FT                   /translation="MAVMKIEYYSQVLDMEWGMNVLYPDANRVEEPECEDIPVLYLLHG
FT                   MSGNHNSWLKRTNVERLLRGTNLIVVMPNTSNGWYTDTQYGFDYYTALAEELPQVLKRF
FT                   FPNMTSKREKTFIAGLSMGGYGCFKLALATNRFSHAASFSGALSFQNFSPESQNLGSPA
FT                   YWRGVFGEIRDWTTSPYSLESLAKKSDKKTKLWAWCGEQDFLYEANNLAVKNLKKLGFD
FT                   VTYSHSAGTHEWYYWEKQLEVFLTTLPIDFKLEERLT"
FT   gene            570163..571383
FT                   /locus_tag="SPAP_0601"
FT   CDS_pept        570163..571383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0601"
FT                   /product="Uncharacterized protein involved in methicillin
FT                   resistance"
FT                   /note="Operon 267 Gene 1 COG2348 Uncharacterized protein
FT                   involved in methicillin resistance"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84194"
FT                   /protein_id="ADM84194.1"
FT                   /translation="MYRYQIGIPTLEYDQFVKEHELANVLQSSAWEEVKSNWQHEKFGV
FT                   YREEKLLATASILIRTLPLGYKMFYIPRGPILDYGDKELLNFAIQSIKSYARSKRAVFV
FT                   TFDPSICLSQSLINQEKTEFPENLAIIDSLQQMGVRWSGKTEEMGDTIQPRIQAKIYKE
FT                   NFEEDKLSKSTKQTIRTARNKGLEIQYGGLELLDSFSELMKKTEKRKEIHLRNEAYYKK
FT                   LLDNFKDKAYITLATLDVSKRSQELEEQLAKNRALEETFTESTRTSKVEAQKKEKERLL
FT                   EELTFLQEYIDVGQARVPLAATLSLEFGTTSVNIYAGMDDDFKRYNAPILTWYETARYA
FT                   FERGMIWQNLGGVENSLNGGLYHFKEKFNPTIEEYLGEFTMPTHPLYPLLRLALDFRKT
FT                   LRKKHRK"
FT   gene            571388..572620
FT                   /locus_tag="SPAP_0602"
FT   CDS_pept        571388..572620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0602"
FT                   /product="Uncharacterized protein involved in methicillin
FT                   resistance"
FT                   /note="Operon 267 Gene 2 COG2348 Uncharacterized protein
FT                   involved in methicillin resistance"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84195"
FT                   /protein_id="ADM84195.1"
FT                   /translation="MALTTLTKEEFQTYSDQVSSRSFMQSVQMGDLLEKRGARIVYLAL
FT                   KQEGEIQVAALVYSLPMLGGLHMELNSGPIYTQQDALPVFYAELKEYAKQNGVLELLVK
FT                   PYETYQTFDSQGNPIDAEKKSIIQDLTDLGYQFDGLTTGYPGGEPDWLYYKDLTELTEK
FT                   SLLKSFSKKGKPLVKKAETFGIRLKKLKREELSIFKNITKETSERREYSDKSLEYYEHF
FT                   YDTFGEQAEFLIASLNFSDYMSKLQGEQNKLEENLDKLRLDLSKNPHSEKKQNQLREYS
FT                   SQFETFEVRKAEARDLIEKYGEEDIVLAGSLFVYMPQETTYLFSGSYTEFNKFYAPALL
FT                   QKYVMLESIKRGIPKYNFLGIQGIFDGSDGVLRFKQNFNGYIVRKAGTFRYHPSPLKYK
FT                   AIQLLKKIVGR"
FT   gene            572699..573400
FT                   /locus_tag="SPAP_0603"
FT   CDS_pept        572699..573400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0603"
FT                   /product="Predicted Zn-dependent protease"
FT                   /note="Operon 267 Gene 3 COG5549 Predicted Zn-dependent
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84196"
FT                   /protein_id="ADM84196.1"
FT                   /translation="MRWLFRLIGAFFSFVWRLFWRLVWIVVLLCVLAFGLLWYLNGDFQ
FT                   GALKQAERSVKIGQQSIDQWEKTGQLPKLSQTDSHQHSEGRWAQASARIYLDPQMDSRF
FT                   QEAYLEAIQNWNQTGAFNFELVTESSKADITATEMNDGGTPVAGEAESQTNLLTGQFLS
FT                   VTVRLNHYYLSNPYYGYSYERLVHTAEHELGHAIGLDHTDEKSVMQPAGSFYGIQEEDV
FT                   ANLRKIYETNE"
FT   gene            573439..575286
FT                   /locus_tag="SPAP_0604"
FT   CDS_pept        573439..575286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0604"
FT                   /product="Nuclease subunit of the excinuclease complex"
FT                   /note="Operon 267 Gene 4 COG0322 Nuclease subunit of the
FT                   excinuclease complex"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84197"
FT                   /protein_id="ADM84197.1"
FT                   /translation="MNNLIKPKLELLPTSPGCYIYKDKNGTIIYVGKAKNLRNRVRSYF
FT                   RGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKI
FT                   TNEHYPRLIITRQVKKDGGLYFGPYPDVGAANEIKRLLDRIFPFRKCTNPPSKVCFYYH
FT                   IGQCMAHTICKNDEAYFKSMAQEVSDFLKGQDDKIIDDLKSKMAVTAQSMEFERAAEYR
FT                   DLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFN
FT                   DPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDTKILKPQRGEKKQLVNLA
FT                   IKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMV
FT                   VFVNGRPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQ
FT                   VNIAKQVIQEELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDE
FT                   VHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMRHFKSLTKIKEAGVDEIVEVGV
FT                   PRAVAEAVQRKLNPQETEILLQVAEERVDYQTEGNHNEP"
FT   gene            575276..576109
FT                   /locus_tag="SPAP_0605"
FT   CDS_pept        575276..576109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0605"
FT                   /product="Diadenosine tetraphosphatase-like
FT                   serine/threonine protein phosphatase"
FT                   /note="Operon 267 Gene 5 COG0639 Diadenosine
FT                   tetraphosphatase and related serine/threonine protein
FT                   phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84198"
FT                   /protein_id="ADM84198.1"
FT                   /translation="MNHKIAILSDIHGNATALEAVIADAKNQGVSEYWLLGDIFLPGPG
FT                   ANDLVALLKDLPITASVRGNWDDRVLEALDGQYGLEDPQEVQLLRMTQYLMERMEPATI
FT                   VWLRSLPLLEKKEIDGLRFSISHNLPDKNYGGDLLVENDTEKFDQLLDAETDVAVYGHV
FT                   HKQLLRYGSQGQQIINPGSIGMPYFNWEALKNHCAQYAVIEVEDGELVNILFRKVAYDY
FT                   EAELEFAKSKGLPFIEMYEELRREDNYQGHNLELLASLIEKHGYVEDVKNFFDFL"
FT   gene            complement(576291..577091)
FT                   /locus_tag="SPAP_0606"
FT   CDS_pept        complement(576291..577091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0606"
FT                   /product="ABC-type amino acid transport/signal transduction
FT                   systems, periplasmic component/domain protein"
FT                   /note="Operon 268 Gene 1 COG0834 ABC-type amino acid
FT                   transport/signal transduction systems, periplasmic
FT                   component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84199"
FT                   /protein_id="ADM84199.1"
FT                   /translation="MKKFSLLLAILPFLVACGNQATPKETSAQKTIVLATAGDVPPFDY
FT                   EDKGNLTGFDIEVLKAVDEKLSDYEIQFQRTAWESIFPGLDSGHYQAAANNLSYTKERA
FT                   EKYLYSLPISNNPLVLVSNKKNPLTSLDQIAGKTTQEDTGTSNAQFINNWNQKHTDNPA
FT                   TINFSGEDIGKRILDLANGEFDFLVFDKVSVQKIIKDRGLDLSVVDLPSADSPSNYIIF
FT                   SSDQKEFKEQFDKALKELYQDGTLEKLSNTYLGGSYLPDQSQLQ"
FT   gene            577165..577275
FT                   /locus_tag="SPAP_0607"
FT   CDS_pept        577165..577275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0607"
FT                   /product="hypothetical protein"
FT                   /note="Operon 269 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84200"
FT                   /protein_id="ADM84200.1"
FT                   /translation="MSVIEKLNHEKSLQALSNYGRMEAVELEKEIDYEIS"
FT   gene            577262..577867
FT                   /locus_tag="SPAP_0608"
FT   CDS_pept        577262..577867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0608"
FT                   /product="Nitroreductase"
FT                   /note="Operon 269 Gene 2 COG0778 Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84201"
FT                   /protein_id="ADM84201.1"
FT                   /translation="MKFLELNKKRHATKHFTDKPVDPKDVRTAIEIATLAPSAHNSQPW
FT                   KFVVVREKNAELAKLAYGSNFEQVSSAPVTIALFTDTDLAKRARKIARVGGANNFSEEQ
FT                   LQYFMKNLPAEFARYNEQQVSDYLALNAGLVAMNLVLALTDQGIGSNIILGFDKSKVNE
FT                   VLEIADRFRPELLITVGYTDDKLEPSYRLPVDEIIEKR"
FT   gene            577880..579280
FT                   /locus_tag="SPAP_0609"
FT   CDS_pept        577880..579280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0609"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase-like
FT                   deacylases"
FT                   /note="Operon 269 Gene 3 COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84202"
FT                   /protein_id="ADM84202.1"
FT                   /translation="MIAIDFTAEVEKRKEDLLADLFSLLEINSERDDSKADAQHPFGPG
FT                   PVKALEKFLEIADRDGYPTKNVDNYAGHFEFGDGEEVLGIFAHMDVVPAGSGWDTDPYT
FT                   PTIKDGRLYARGASDDKGPTTACYYGLKIIKELGLPTFKKVRFIVGTDEESGWADMDYY
FT                   FEHVGLAKPDFGFSPDAEFPIINGEKGNITEYLHFAGENTGAARLHSFTGGLRENMVPE
FT                   SATAVVSGDLADLQAKLDAFVAEHKLRGELQEEAGKYKVTIIGKSAHGAMPASGVNGAT
FT                   YLALFLSQFGFAGPAKDYLDIAGKILLNDHEGENLKIAHVDEKMGALSMNAGVFRFDET
FT                   SADNTIALNIRYPKGTSPEQIKSILENLPVASVSLSEHGHTPHYVPMEDPLVQTLLNVY
FT                   EKQTGLQGHEQVIGGGTFGRLLERGVAYGAMFPDSIDTMHQANEFIALDDLFRAAAIYA
FT                   EAIYELIK"
FT   gene            579334..579912
FT                   /locus_tag="SPAP_0610"
FT   CDS_pept        579334..579912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0610"
FT                   /product="hypothetical protein"
FT                   /note="Operon 269 Gene 4 protein supported
FT                   gi|148988990|ref|ZP_01820390.1| hypothetical protein
FT                   CGSSp6BS73_02415"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84203"
FT                   /protein_id="ADM84203.1"
FT                   /translation="MSQIERIKQAIMADSQNASYTERGIEPLFAAPKTARINIIGQAPG
FT                   LKTQEAGLYWKDKSGDRLRDWLGVDEDTFYNSGYFAVLPMDFYFPGHGKSGDLPPRTGF
FT                   AEKWHPQLLQELPDIQLTLLIGQYAQAYYLQEKISGKVTERVKHYKDYLPAYFLLVHPS
FT                   PRNQIWMAKNPWFEAEVVPDLKKRIKTIL"
FT   gene            580072..580224
FT                   /locus_tag="SPAP_0611"
FT   CDS_pept        580072..580224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0611"
FT                   /product="hypothetical protein"
FT                   /note="Operon 270 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84204"
FT                   /protein_id="ADM84204.1"
FT                   /translation="MKEIAFDAFYQLYQNDQLSLVDVREVDEFAALHLEGAHNLPLSQL
FT                   ADSYD"
FT   gene            580530..581855
FT                   /locus_tag="SPAP_0612"
FT   CDS_pept        580530..581855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0612"
FT                   /product="Branched-chain amino acid permease"
FT                   /note="Operon 271 Gene 1 COG1114 Branched-chain amino acid
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84205"
FT                   /protein_id="ADM84205.1"
FT                   /translation="MAKKGTLTGLLLFGIFFGAGNLIFPPSLGALSGEHFLPAIAGFVF
FT                   SGVGIAVLTLIIGTLNPKGYIYEISTKIAPWFATLYLSVLYLSIGPFFATPRTATTAYE
FT                   VGISPLLSDANKGLGLIVFTVLYFAAAYLISLNPSKILDRIGRILTPVFAILIVILVVL
FT                   GAIKYGGTSPQAASAAYQASAFGTGFLEGYNTLDALASVAFSVIAVQTLKQLGFSSKKE
FT                   YISTIWVVGIVVALAFSALYIGLGFLGNHFPVPAEAMKGGTPGVYILSQATQEIFGSTA
FT                   QLFLAAMVTVTCFTTTVGLIVSTAEFFNERFPQISYKVYATAFTLIGFAIANLGLDAII
FT                   KYSIPVLVILYPITIAIVMIVIVNKFVALSKPGMQLTIAVVTVIAIASVLGSSFKVEFL
FT                   ANLVSVLPFAKASLPWLVPAIVGILLSLVLPNKQESDVFEME"
FT   gene            581953..582990
FT                   /locus_tag="SPAP_0613"
FT   CDS_pept        581953..582990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0613"
FT                   /product="Cellulase M-like proteins"
FT                   /note="Operon 272 Gene 1 COG1363 Cellulase M and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84206"
FT                   /protein_id="ADM84206.1"
FT                   /translation="MNQTVEYIKELTAIASPTGFTREISNYLVKTLEGFGYQPVRTAKG
FT                   GVNVTIKGQNDEQHRYVTAHVDTLGAIVRAVKPDGRLKLDRIGGFPWNMIEGENCTVHV
FT                   ASTGQKVSGTILIHQTSCHVYKDAGTAERTQDNMEVRLDVKVSNEKETRALGIEVGDFI
FT                   SFDPRTVVTETGFIKSRHLDDKVSAAILLNLLRVYKEEGIELPVTTHFAFSVFEEVGHG
FT                   ANSNIPSQVVEYLAVDMGAMGDDQQTDEYTVSICVKDASGPYHYDFRQHLVVLAKEQDI
FT                   PFKLDIYPFYGSDASAAMSAGAEVKHALLGAGIESSHSYERTHIDSVVATERMVDAYLK
FT                   SALVD"
FT   gene            582992..583453
FT                   /locus_tag="SPAP_0614"
FT   CDS_pept        582992..583453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0614"
FT                   /product="Diadenosine tetraphosphate (Ap4A) hydrolase-like
FT                   HIT family hydrolase"
FT                   /note="Operon 272 Gene 2 COG0537 Diadenosine tetraphosphate
FT                   (Ap4A) hydrolase and other HIT family hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84207"
FT                   /protein_id="ADM84207.1"
FT                   /translation="MCLICQRIEWIKAGENPYFVKELETGYVVIGDHQYFKGYTLFLAK
FT                   EHVTELHHMETSVKLRFLEEMSLVQEAVAKTFKAEKMNIELLGNGDAHAHWHLFPRRSG
FT                   DMRGHGLNGRGPVWWVPWEEMAAEDCQVKSHELEQMIKALSDELEKYTV"
FT   gene            583479..584195
FT                   /locus_tag="SPAP_0615"
FT   CDS_pept        583479..584195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0615"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /note="Operon 272 Gene 3 COG1876 D-alanyl-D-alanine
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84208"
FT                   /protein_id="ADM84208.1"
FT                   /translation="MKKRYIVLSGLLAVTLAACSQEKAKNEDGTAKTEQTAKADGTVGS
FT                   KSQGAAQKKAEVVNKGDYYSIQGKYDEIIVANKHYPLSKDYNPGENPTAKAELVKLIKA
FT                   MQEAGFPISDHYSGFRSYETQTKLYQDYVNQDGKAAADRYSARPGYSEHQTGLAFDVIG
FT                   TDGDLVTEEKAAQWLLDHAADYGFVVRYLKGKEKETGYMAEEWHLRYVGKEAKEIAASG
FT                   LSLEEYYGFEGGDYVD"
FT   gene            584504..584929
FT                   /locus_tag="SPAP_0616"
FT   CDS_pept        584504..584929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0616"
FT                   /product="hypothetical protein"
FT                   /note="Operon 273 Gene 1 protein supported
FT                   gi|15900537|ref|NP_345141.1| 50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84209"
FT                   /protein_id="ADM84209.1"
FT                   /translation="MAKKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNAR
FT                   TADQAGMIIPVVISVYEDKSFTFVTKTPPAAVLLKKAAGVEKGSGTPNKTKVATVTRAQ
FT                   VQEIAETKMPDLNAANVESAMRMIEGTARSMGFTVVD"
FT   gene            585137..585826
FT                   /locus_tag="SPAP_0617"
FT   CDS_pept        585137..585826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0617"
FT                   /product="hypothetical protein"
FT                   /note="Operon 273 Gene 2 protein supported
FT                   gi|15900538|ref|NP_345142.1| 50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84210"
FT                   /protein_id="ADM84210.1"
FT                   /translation="MAKKSKQLRAALEKIDSTKAYSVEEAVALAKETNFAKFDATVEVA
FT                   YNLNIDVKKADQQIRGAMVLPNGTGKTSRVLVFARGAKAEEAKAAGADFVGEDDLVAKI
FT                   NDGWLDFDVVIATPDMMALVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITY
FT                   RADRAGNVQAIIGKVSFEAEKLVENFKAFNETIQKAKPATAKGTYVTNLTITTTQGVGI
FT                   KVDVNSL"
FT   gene            complement(585915..586301)
FT                   /locus_tag="SPAP_0618"
FT   CDS_pept        complement(585915..586301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0618"
FT                   /product="Transposase-like protein, IS1167"
FT                   /note="Operon 274 Gene 1 COG3464 Transposase and
FT                   inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84211"
FT                   /protein_id="ADM84211.1"
FT                   /translation="MHLTNKEILNKLLSYSEDLKHHYQLYQLLLFHFQNKEPEKFFGLI
FT                   EDNLKQAHPIFQTVFKTFLKDKEKIVNALQLHYSNAKLEATNNLIKLIKRNAFGFRNFE
FT                   NFKKRIFIALNIKKERTKFVLSRA"
FT   gene            complement(586438..587220)
FT                   /locus_tag="SPAP_0619"
FT   CDS_pept        complement(586438..587220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0619"
FT                   /product="Transposase-like protein, IS1167"
FT                   /note="Operon 275 Gene 1 COG3464 Transposase and
FT                   inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84212"
FT                   /protein_id="ADM84212.1"
FT                   /translation="MEQLHFITKLLDIKDPNIQILDIINKDTHKEIIAKLDYDAPSCPE
FT                   CGNQLKKYDFQRPSKIPYLETTGMPTRILLRKRRFKCYHCSKMMVAETPLVKKNHQIPR
FT                   IINQKIAQKLIEKISMTDIAHQLSISTSTVIRKFNDFHFKHDFSCLPEIMSWDEYAFTK
FT                   GKMSFIAQDFDNLNIITILKGRTQAVIRNHFLRYDRAVRCRVKIITMDMFSLYYDLAKQ
FT                   LRFQISRLRLKQSPRLFHSRMLKSFLNAFTLYNILAVL"
FT   gene            587944..588306
FT                   /locus_tag="SPAP_0620"
FT   CDS_pept        587944..588306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0620"
FT                   /product="hypothetical protein"
FT                   /note="Operon 276 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84213"
FT                   /protein_id="ADM84213.1"
FT                   /translation="MLEVGLNSLISLFTFTFDILYPIVKVGHTDDYSHGAVKLSVSLVD
FT                   KDAMKKISVTVIGYFEINIDENITDILYVNGTAILYPYLRSIVSIVSAIDSSEAMLLPT
FT                   INVLELLDKSQPFEEE"
FT   gene            588705..588950
FT                   /locus_tag="SPAP_0621"
FT   CDS_pept        588705..588950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0621"
FT                   /product="hypothetical protein"
FT                   /note="Operon 277 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84214"
FT                   /protein_id="ADM84214.1"
FT                   /translation="MKAFYITIEKFIRDDESLKCYFTKVISSRSKVTSLDQIEADKTIQ
FT                   RKYSSELKKFIGFYNEIICEENSFLHVRKRWSSWFR"
FT   gene            complement(588878..589036)
FT                   /locus_tag="SPAP_0622"
FT   CDS_pept        complement(588878..589036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0622"
FT                   /product="hypothetical protein"
FT                   /note="Operon 278 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84215"
FT                   /protein_id="ADM84215.1"
FT                   /translation="MIVSKQYLLFYLIHEKEVHTLRIINSRIDYLNQLDHLFRTCRKLF
FT                   SSQIISL"
FT   gene            589351..590343
FT                   /locus_tag="SPAP_0623"
FT   CDS_pept        589351..590343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0623"
FT                   /product="ABC-type uncharacterized transport system, ATPase
FT                   component"
FT                   /note="Operon 279 Gene 1 COG4586 ABC-type uncharacterized
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84216"
FT                   /protein_id="ADM84216.1"
FT                   /translation="MAMIEVEHLQKNFVKTVKEPGLKGALRSFIHPEKQTFEAVKDLTF
FT                   EVPKGQILGFIGANGAGKSTTIKMLTGILKPTSGFCRINGKIPQNNRQDYVKDIGVVFG
FT                   QRTQLWWDLALQETYTVLKEIYDVPDSLFHKRMDFLNEVLDLKDFIKDPVRTLSLGQRM
FT                   RADIAASLLHNPKVLFLDEPTIGLDVSVKDNIRRAITQINQEEETTILLTTHDLSDIEQ
FT                   LCDRIFMIDKGQEIFDGTVSQLKETFGKMKTLSFELLPGQSHLVSHYEGLSDMTIDRQG
FT                   NSLNIEFDSSRYQSADIIKQTLSDFEIRDLKMVDTDIEDIIRRFYRKEL"
FT   gene            590345..591163
FT                   /locus_tag="SPAP_0624"
FT   CDS_pept        590345..591163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0624"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /note="Operon 279 Gene 2 COG4587 ABC-type uncharacterized
FT                   transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84217"
FT                   /protein_id="ADM84217.1"
FT                   /translation="MIKLWRRYKPFINAGVQELITYRVNFILYRIGDVMGAFVAFYLWK
FT                   AVFDSSQESLIQGFSMADITLYIIMSFVTNLLTRSDSSFMIGEEVKDGSIIMRLLRPVH
FT                   FAASYLFTELGSKWLIFISVGLPFLSVIVLMKIISGQGIVEVLGLTVLYLFSLTLAYLI
FT                   NFFFNICFGFSAFVFKNLWGSNLLKTSIVAFMSGSLIPLAFFPKVVSDILSFLPFSSLI
FT                   YTPVMIIVGKYDASQILQALLLQFFWLLVMVGLSQLIWKRVQSFITIQGG"
FT   gene            591165..591950
FT                   /locus_tag="SPAP_0625"
FT   CDS_pept        591165..591950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0625"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /note="Operon 279 Gene 3 COG3694 ABC-type uncharacterized
FT                   transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84218"
FT                   /protein_id="ADM84218.1"
FT                   /translation="MKKYQRMHLIFIRQYIKQIMEYKVDFVVGVLGVFLAQGLNLLFLN
FT                   VIFQHIPFLEGWTFQEIAFIYGFSLIPKGMDHLFFDNLWALGQRLVRKGEFDKYLTRPI
FT                   NPLFHILVETFQIDALGELLVGGILLGTTVTSIVWTLPKFLLFLVCIPFATLIYTSLKI
FT                   ATASIAFWTKQSGAMIYIFYMFNDFAKYPISIYNSLLRWLISFIVPFAFTAYYPASYFL
FT                   QEKDVFFNVGGLMLISLVFFVISLKLWDKGLDSYESAGS"
FT   gene            591989..592093
FT                   /locus_tag="SPAP_0626"
FT   CDS_pept        591989..592093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0626"
FT                   /product="hypothetical protein"
FT                   /note="Operon 279 Gene 4 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84219"
FT                   /protein_id="ADM84219.1"
FT                   /translation="MFVIEEVKDENQKKAVVAEVLKDLPEWFGIPEST"
FT   gene            592252..592449
FT                   /locus_tag="SPAP_0627"
FT   CDS_pept        592252..592449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0627"
FT                   /product="Acetyltransferase"
FT                   /note="Operon 280 Gene 1 COG0456 Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84220"
FT                   /protein_id="ADM84220.1"
FT                   /translation="MLATLESEAHKKVGYLQVKTVAEGSNKDYDRTNDFYRGLGFKKLE
FT                   IFLQLWNPQNPCQILIKKLE"
FT   gene            complement(592725..592949)
FT                   /locus_tag="SPAP_0628"
FT   CDS_pept        complement(592725..592949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0628"
FT                   /product="hypothetical protein"
FT                   /note="Operon 281 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84221"
FT                   /protein_id="ADM84221.1"
FT                   /translation="MKIKEQTRKLAAGCSKHCFEVVDRTDEVSSKHCFEVVDRTDEVSN
FT                   HTHGKATLTWFEEIFEEYKSKTFVNRDTL"
FT   gene            593182..593457
FT                   /locus_tag="SPAP_0629"
FT   CDS_pept        593182..593457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0629"
FT                   /product="hypothetical protein"
FT                   /note="Operon 282 Gene 1 protein supported
FT                   gi|148984022|ref|ZP_01817341.1| 50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84222"
FT                   /protein_id="ADM84222.1"
FT                   /translation="MKKSTVLSLTTAAVILAAYAPHEVVLADTSNSEDALSISDKEKVV
FT                   VDKETENKEKHKDIHNAIETSKDTEEKKTTIIEEKEVVSKNTCDRQ"
FT   gene            593771..599614
FT                   /locus_tag="SPAP_0630"
FT   CDS_pept        593771..599614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0630"
FT                   /product="hypothetical protein"
FT                   /note="Operon 282 Gene 2 protein supported
FT                   gi|148984022|ref|ZP_01817341.1| 50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84223"
FT                   /protein_id="ADM84223.1"
FT                   /translation="MMNHARKEIGVEEAIDYLKSINAPFGKNFDGRGMVISNIDTGTDY
FT                   RHKAMRIDDDAKASMRFKKEDLKGTDKNYWLSDKIPHAFNYYNGGKITVEKYDDGRDYF
FT                   DPHGMHIAGILAGNDTEQDIKNFNGIDGIAPNAQIFSYKMYSDAGSGFAGDETMFHAIE
FT                   DSIKHNVDVVSVSSGFTGTGLVGEKYWQAIRALRKAGIPMVVATGNYATSASSSSWDLV
FT                   ANNHLKMTDTGNVTRTAAHEDAIAVASAKNQTVEFDKVNIGGESFKYRNIGAFFDKNKI
FT                   TTNEDGTKAPSKLKFVYIGKGQDQDLIGLDLRGKIAVMDRIYTKDLKNAFKKAMDKGAR
FT                   AIMVVNTVNYYNRDNWTELPAMGYEADEGTKSQVFSISGDDGVKLWNMINPDKKTEVKR
FT                   NNKEDFKDKLEQYYPIDMESFNSNKPNVGDEKEIDFKFAPDTDKELYKEDIIVPAGSTS
FT                   WGPRIDLLLKPDVSAPGKNIKSTLNVINGKSTYGYMSGTSMATPIVAASTVLIRPKLKE
FT                   MLERPVLKNLTGDDKIDLTSLTKIALQNTARPMMDATSWKEKSQYFASPRQQGAGLINV
FT                   ANALRNEVVATFKNTDSKGLVNSYGSISLKEIKGDKKYFTIKLHNTSNRPLTFKVSASA
FT                   ITTDSLTDRLKLDETYKDEKSPDGKQIVPEIHPEKVKGANITFEHDTFTIGANSSFDLN
FT                   AVINVGEAKNKNKFVESFIHFESVEEMEALNSNGKKINFQPSLSMPLMGFAGNWNHEPI
FT                   LDKWAWEEGSRSKTLGGYDDDGKPKIPGTLNKGIGGEHGIDKFNPAGVIQNRKDKNTTS
FT                   LDQNPELFAFNNEGINAPSSSGSKIANIYPLDSNGNPQDAQLERGLTPSPLVLRSAEEG
FT                   LISIVNTNKEGENQRDLKVISREHFIRGILNSKSNDAKGIKSSKLKVWGDLKWDGLIYN
FT                   PRGREENAPESKDNQDPATKIRGQFEPIAEGQYFYKFKYRLTKDYPWQVSYIPVKIDNT
FT                   APKIVSVDFSNPEKIKLITKDTYHKVKDQYKNETLFARDQKEHPEKFDEIANEVWYAGA
FT                   ALVNEDGEVEKNLEVTYAGEGQGRNRKLDKDGNTIYEIKGAGDLRGKIIEVIALDGSSN
FT                   FTKIHRIKFANQADEKGMISYYLVDPDQDSSKYQKLGEIAESKFKNLGNGKEGSLKKDT
FT                   TGVEHHHQENEESIKEKSSFTIDRNISTIRDFENKDLKKLIKKKYKEEDDFVTGGKRTV
FT                   ELDYKYDDKGNITAYEDESALEYETEKFDEIKSKIYGVLSPSKDGHFEILGKISNVSKN
FT                   AKVYYGNNYKFIEIKATKYDSHSKTMIFDLYANINDIVDGLAFAGDMRLFVKDDNQIKA
FT                   ETKIRMPEKNKETKAEYPYVSSYGNVIELGEGDLSKNKPDNLTKMESGKIYSDSEKQQY
FT                   LLKDNIILRKGYALKVTTYNPGKTDMLEGNGVYSKEDIAKIQKANPNLRVLSETTIYAD
FT                   SRNVEDGRSTQAVLMSALDGFNIIRYQVFTFKMNDKGEAIDKDGNLVTDSSKLVLFGKD
FT                   DKEYTGEDKSNVEAIKEDGSMLFIDTKPVNLSMDKNYFNPSKFNKIYVRNPEFYLRGKI
FT                   SDKGGFNWELRVNESVVDNYLIYGDLHIDNTRDFNIKLNVKDGDIMDWGMKDYKANGFP
FT                   DKVTDMDGNVYLQTGYSDLNAKAVGVHYQFLYDNVKPEVNIDPKGNTSIEYADGKSVVF
FT                   NINDKRNNGFDGEIQEQHIYINGKEYTSFDDIKQIIDKTLNIKIVVKDFARNTTVKEFI
FT                   LNKDTGEVSELKPHRVTVTIQNGKEMSSTIVSEEDFILPVYKGELEKGYQFDGWEISGF
FT                   EGKKDAGYVINLSKDTFIKPVFKKIEEKKEEENKPTFDVSKKKDNPQVNHSQLNESHRK
FT                   EDLQREEHSQKSDSTKDVTATVLDKNNISSKSTTNNPNKLPKTGTASGAQTLLAAGIMF
FT                   IVGIFLGLKKKNQD"
FT   gene            600241..600717
FT                   /locus_tag="SPAP_0631"
FT   CDS_pept        600241..600717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0631"
FT                   /product="Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type)"
FT                   /note="Operon 283 Gene 1 COG1762 Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84224"
FT                   /protein_id="ADM84224.1"
FT                   /translation="MVLDYFFDKNLVFCLEADNQEQLFDQVASLLEEREIVTPTYREAL
FT                   ITREKSFPTGLDMEFLGKDLPNVAIPHTDIVHNLAEKVVVVRLEKPVTFHNMIAPGKEV
FT                   EVSLLFFIINNSSSSQTNILAQLMDFFTGNGHLEDLSKISEPEKLYAYIAEATA"
FT   gene            600755..601003
FT                   /locus_tag="SPAP_0632"
FT   CDS_pept        600755..601003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0632"
FT                   /product="Phosphotransferase system, galactitol-specific
FT                   IIB component"
FT                   /note="Operon 283 Gene 2 COG3414 Phosphotransferase system,
FT                   galactitol-specific IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84225"
FT                   /protein_id="ADM84225.1"
FT                   /translation="MIKILAACGAGVNSSHQIKSALEEELSNRGYDVHCDAVMVKDVNE
FT                   DLMKGYDIFTPIAATDLGFEPGIPVIEAGQSYSVSQQ"
FT   gene            601107..602582
FT                   /locus_tag="SPAP_0633"
FT   CDS_pept        601107..602582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0633"
FT                   /product="Phosphotransferase system, galactitol-specific
FT                   IIC component"
FT                   /note="Operon 283 Gene 3 COG3775 Phosphotransferase system,
FT                   galactitol-specific IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84226"
FT                   /protein_id="ADM84226.1"
FT                   /translation="MDAIFDLIGKVFNPILEMGGPVIMLIILTVLALLFGVKFSKALEG
FT                   GIKLAIALTGIGAIIGMLNTAFSASLAKFVENTGIQLSITDVGWAPLATITWGSAWTLY
FT                   FLLIMLIVNVVMLAMKKTDTLDVDIFDIWHLSITGLLIKWYADNNGVSQGVSLFIATAA
FT                   IVLVGVLKIINSDLMKPTFDDLLNAPSSSPMTSTHMNYMMNPVIMVLDKIFEKFFPGLD
FT                   KYDFDAAKLNKKIGFWGSKFFIGFILGIVIGIMGTPHPIAGVADADKWRLVIKGWLSLG
FT                   LTAGVSLELFSLIGSWFIAAVEPLSQGITNVATKRLQGRKFNIGLDWPFIAGRAEIWAC
FT                   ANVLAPIMLIEAVLLSKVGNGILPLAGIIAMGVTPALLVVTRGKLLRMIIFGTLLLPLF
FT                   LLSGTLIAPFATELAKGVGAFPEGVSQTQLITHSTLEGPIEKLLGWTIGNTTTGDIKAI
FT                   LGAVVFLVFYIGIFAWYRKQMIKRNEEYATKAK"
FT   gene            602608..602799
FT                   /locus_tag="SPAP_0634"
FT   CDS_pept        602608..602799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0634"
FT                   /product="hypothetical protein"
FT                   /note="Operon 283 Gene 4 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84227"
FT                   /protein_id="ADM84227.1"
FT                   /translation="MKIKEQTRKLAAGCSKHSFEVVDKTDEVSSKHGFEVVDETDEVSN
FT                   HIYGKATLTKFELDFRRV"
FT   gene            602887..609588
FT                   /locus_tag="SPAP_0635"
FT   CDS_pept        602887..609588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0635"
FT                   /product="Beta-galactosidase/beta-glucuronidase"
FT                   /note="Operon 283 Gene 5 COG3250
FT                   Beta-galactosidase/beta-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84228"
FT                   /protein_id="ADM84228.1"
FT                   /translation="MGKGHWNRKRVYSIRKFAVGACSVMIGTCAVLLGGNIAGESVVYA
FT                   DETLITHTAEKPKEEKMIVEEKADKALETKNVVERTEQSEPSSTEAIASEKKEDEAVTP
FT                   KEEKVSAKLEEKAPRIESQASSQEKPLKEDAKAVTNEEMNQMIEDRKVDFNQNWYFKLN
FT                   ANSKEAIKPDADVSTWKKLDLPYDWSIFNDFDHESPAQNEGGQLNGGEAWYRKTFKLDE
FT                   KDLKKNVRLTFDGVYMDSQVYVNGQLVGHYPNGYNQFSYDITKYLQKDGRENVIAVHAV
FT                   NKQPSSRWYSGSGIYRDVTLQVTDKVHVEKNGTTILTPKLEEQQHGKVETHVTSKIINT
FT                   DDKDHELVAEYQIVERGGHAVTGLVRTASRTLKAHESTSLDAILEVERPKLWTVLNDKP
FT                   ALYELITRVYRDGQLVDAKKDLFGYRYYHWTPNEGFSLNGERIKFHGVSLHHDHGALGA
FT                   EENYKAEYRRLKQMKEMGVNSIRTTHNPASEQTLQIAAELGLLVQEEAFDTWYGGKKPY
FT                   DYGRFFEKDATHPEARKGEKWSDFDLRTMVERGKNNPAIFMWSIGNEIGEANGDAHSLA
FT                   TVKRLVKVIKDVDKTRYVTMGADKFRFGNGSGGHEKIADELDAVGFNYSEDNYKALRAK
FT                   HPKWLIYGSETSSATRTRGSYYRPERELKHSNGPERNYEQSDYGNDRVGWGKTATASWT
FT                   FDRDNAGYAGQFIWTGTDYIGEPTPWHNQNQTPVKSSYFGIVDTAGIPKHDFYLYQSQW
FT                   VSVKKKPMVHLLPHWNWENKELASKVADSEGKIPVRAYSNASSVELFLNGKSLGLKTFN
FT                   KKQTSDGRTYQEGANANELYLEWKVAYQPGTLEAIARDESGKEIARDKITTAGKPAAVR
FT                   LIKEDHAIAADGKDLTYIYYEIVDSQGNVVPTANNLVRFQLHGQGQLVGVDNGEQASRE
FT                   RYKAQADGSWIRKAFNGKGVAIVKSTEQAGKFTLTAHSDLLKSNQVTVFTGKKEGQEKT
FT                   VLGTEVPKVQTIIGEAPEMPTTVPFVYSDGSRAERPVTWSSVDVSKPGIVTVKGMADGR
FT                   EVEARVEVIALKSELPVVKRIAPNTDLNSVDKSVSYVLTDGSVQEYEVDSWEIAEEDKA
FT                   KLAIPGSRIQATGYLEGQPIHATLVVEEGNPAAPVVPTVTVGGEAVTGLTSRQPMQYRT
FT                   LSYGAQLPEVTASAENADVTVLQASAANGMRAIIFIQPKDGGPLQTYAIQFLEEAPKIA
FT                   HLSLQVEKADSLKEDQTVKLSVRAHYQDGTQAVLPADKVTFSTSGEGEVAIRKGMLELH
FT                   KPGAVTLKAEYEGATGQITLTIQANTEKKIAQSIRPVNVVTDLHQKPTLPTTVTVEYDK
FT                   GFPKAHKVTWQAIPKEKLDSYQTFEVLGKVEGIDLEARAKVSVEGIVSVEEVSVTTPIA
FT                   EAPQLPESVRTYDSNGHVSSAKVAWDAIRIEQYAKEGVFTVNGRLEGTQLTTKLHVRVS
FT                   AQTEQGANISDQWTGSELPLAFASDSNPSDPVSNVNDKLISYNNQPANRWTNWNRSNPE
FT                   ASVGVLFGDSGILSKRSVDNLSVGFHEDHGVGAPKSYVIEYYVGKTVPTAPKNPSFVGN
FT                   EDHVFNDSANWKPVTNLKAPAQLKAGEMNHFSFDKVETYAIRIRMVKADNKRGTSITEV
FT                   QIFAKQVAAAKQGQTRIQVDGKDLANFNPDLTDYYLESVDGKVPAVTANVSNNGLATVV
FT                   PSVREGEPVRVIAKAENGDILGEYRLHFTKDKNLLSHKPVAAVKQARLLQVGQALELPT
FT                   KVPVYFTGKDGYETKDLSVEWEEVPAENLTKAGQFTVRGHVLGSDLVAEVTVRVTDKLG
FT                   EALSDNPNYDENSNQAFASATNDIDKNSHDRVDYLNDGDHSENRRWTNWSPTPSSNPEV
FT                   SAGVIFRENGKIVERTVAQAKLHFFADSGTDAPTKLVLERYVGPEFEVPTYYSNYQAYD
FT                   ADHPFNNPENWEAVPYRADKDIAAGDEINVTFKAVKAKAMRWRMERKADKSGVAMIEMT
FT                   FLAPSELPQESTQSKILVDGKELADFAENRQDYQITYKGQRPKVSVEENNQVASTVVDS
FT                   GEDSLPVLVRLVSESGKQVKEYRIHLTKEKPVSEKTVAAVQEDLPKLEFVEKDLAYKTV
FT                   EKKDSTLYLGETRVEQEGKTGKERIFTAINPDGSKEEKLREVVEAPTDRIVLVGTKPVA
FT                   QEAKKPQVSEKADTKPIDSSEASQTNKAQLPNTGSASSQAAVAAGLALLGLSAGLVVTK
FT                   GKKED"
FT   gene            complement(609898..610452)
FT                   /locus_tag="SPAP_0636"
FT   CDS_pept        complement(609898..610452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0636"
FT                   /product="Transposase-like protein, ISSpn_AP200_2"
FT                   /note="Operon 284 Gene 1 COG3666 Transposase and
FT                   inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84229"
FT                   /protein_id="ADM84229.1"
FT                   /translation="MEELVTLDCLFIDGTKIEANANKYSFVWKKTTEKFSAKLQEQIQV
FT                   YFQEEITPLLIKYAMFDKKQKRGYKESAKNLANWHYNDKEDSYTHPDGWYYRFHHTKHQ
FT                   KTQTDFQQEIKVYYADEPESAPQKGLYMNERYQNLKAKECQALLSPQGRQIFAQRKIDV
FT                   EPVFGQIKASLGYKRCNLRGK"
FT   gene            complement(610440..610685)
FT                   /locus_tag="SPAP_0637"
FT   CDS_pept        complement(610440..610685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0637"
FT                   /product="Transposase-like protein, ISSpn_AP200_2"
FT                   /note="Operon 284 Gene 2 COG3666 Transposase and
FT                   inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84230"
FT                   /protein_id="ADM84230.1"
FT                   /translation="MHIHYNTNQTTLPLEISSFLPQDHLVFTIEKVVNTLEDCHFHAFY
FT                   HAFDRLSYHLKMLVSTLLFAYSQGIFSGRKIEKWKS"
FT   gene            complement(610643..610846)
FT                   /locus_tag="SPAP_0638"
FT   CDS_pept        complement(610643..610846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0638"
FT                   /product="hypothetical protein"
FT                   /note="Operon 284 Gene 3 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84231"
FT                   /protein_id="ADM84231.1"
FT                   /translation="MNDLGIQFYTKKRVWDNSLLSPKKATDLPLLFLHGYDSLGKIELP
FT                   NKPFRKAIPCIFTITQIKQLYH"
FT   gene            complement(611024..612367)
FT                   /locus_tag="SPAP_0639"
FT   CDS_pept        complement(611024..612367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0639"
FT                   /product="Transposase-like protein, IS1380 ISSpn5"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84232"
FT                   /protein_id="ADM84232.1"
FT                   /translation="MNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQELFSQLKLKER
FT                   ISKYLVTNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQLAS
FT                   QPTLSRFLSRTDEETVHSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEGVAY
FT                   NAHYRAHGYHPLYAFEGKTGYCFNAQLRPGNRYCSEEADSFITPVLERFNQLLFRMDSG
FT                   FATPKLYDLIEKTGQYYLIKLKKNTVLSRLGDLSLPCPQDEDLTILPHSAYSETLYQAG
FT                   SWSHKRRVCRSLTKEGNLFYDVISLVTNMTSGTSQDQFQLYRGRGQAENFIKEMKEGFF
FT                   GDKTDSSTLIKNEVRMMMSCIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLHVVGKCVRT
FT                   GRKQLLKLSSLYAYSELFSALYSRIRKVNLNLPVPYEPPRRKASLMMH"
FT   gene            complement(612602..612946)
FT                   /locus_tag="SPAP_0640"
FT   CDS_pept        complement(612602..612946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0640"
FT                   /product="hypothetical protein"
FT                   /note="Operon 286 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84233"
FT                   /protein_id="ADM84233.1"
FT                   /translation="MKLASILLLILTLVVCIILTKLFRLKKLGRNFADLAFPVLVFEYY
FT                   LITAKTFTHNFLPRLGLALSILAIILVFFFLLKKRSFYYPKFIKFFWRAGFLLTLIMYV
FT                   EMIVELFLMK"
FT   gene            613062..613562
FT                   /locus_tag="SPAP_0641"
FT   CDS_pept        613062..613562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0641"
FT                   /product="Predicted Fe-S oxidoreductase"
FT                   /note="Operon 287 Gene 1 COG1242 Predicted Fe-S
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84234"
FT                   /protein_id="ADM84234.1"
FT                   /translation="MKSYNTLNDYYRKFFGEKTFKVPIDAGFDCPNRDGTVAHGGCTFC
FT                   TVSGSGDAIVAPDAPIREQFYKEIDFMHRKWPDVQKYLVYFQNFTNTHEKVEVIRERYE
FT                   QAINKPGVVGINIGTRPDCLPDETIEYLAELSECMHVTVELGLQTTYEATSDLINRVHS
FT                   YEL"
FT   gene            613563..614009
FT                   /locus_tag="SPAP_0642"
FT   CDS_pept        613563..614009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0642"
FT                   /product="Predicted Fe-S oxidoreductase"
FT                   /note="Operon 287 Gene 2 COG1242 Predicted Fe-S
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84235"
FT                   /protein_id="ADM84235.1"
FT                   /translation="METVKRLRKYPKIEIVSHLINGLPGETHEMMVENVRRCVTDNDIQ
FT                   GIKLHLLHLMTNTRMQRDYHEGRLQLMSQDEYVRVICDQLEIIPKHIVIHRITGDAPRD
FT                   MLIGPMWSLKKWEVLNSIEMEMRRRGSVQGCKAVKQEFENEKTT"
FT   gene            613993..614550
FT                   /locus_tag="SPAP_0643"
FT   CDS_pept        613993..614550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0643"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="Operon 287 Gene 3 COG0500 SAM-dependent
FT                   methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84236"
FT                   /protein_id="ADM84236.1"
FT                   /translation="MKRPLEMAHDFLAEVVTKEDVVVDATMGNGHDTLFLAKLAKQVYA
FT                   FDIQKQALEKTQERLHQAGLTNAQLILQGHETLDQFVTKAKAGIFNLGYLPSADKSVIT
FT                   RPQTTIEALEKLCGLLVKGGRIAIMIYYGHEGGDLERDAVLDFVIQLNQQEYTAAIYRT
FT                   LNQVNNPPFLVMIEKLERYRHG"
FT   gene            614543..614797
FT                   /locus_tag="SPAP_0644"
FT   CDS_pept        614543..614797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0644"
FT                   /product="hypothetical protein"
FT                   /note="Operon 287 Gene 4 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84237"
FT                   /protein_id="ADM84237.1"
FT                   /translation="MDKQYLHEKLDAMRQNFVESTHHERAVGVLDQAHMSKKMLKIKKK
FT                   LVALEMERCQRKIEHKDCSKIDQKIKEQKEIFESCCKKD"
FT   gene            614809..616863
FT                   /locus_tag="SPAP_0645"
FT   CDS_pept        614809..616863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0645"
FT                   /product="NhaP-type Na+/H+ and K+/H+ antiporter"
FT                   /note="Operon 287 Gene 5 COG0025 NhaP-type Na+/H+ and K+/H+
FT                   antiporters"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84238"
FT                   /protein_id="ADM84238.1"
FT                   /translation="MELLIYLILFLLVLIVSSTTNKLLPFLPLPLVQILLGIVIGLFLP
FT                   NTDFHLNTELFLALVIGPLLFREAEEADVTAILKHWRIIVYLIFPVIFISTLSLGGLAH
FT                   LIWFSLPLAACLAVGAALGPTDLVAFASLSERFSFPKRVSNILKGEGLLNDASGLVAFQ
FT                   VALTAWTTGAFSLGQASSSLIFSILGGFLIGFLTAMTNRFLHSFLLSVRATDIASELLL
FT                   ELSLPLVTFFLAEEVHVSGIIAVVVAGILKASRFKKITLLEAQVDTVTETVWHTVTFML
FT                   NGSVFVILGMELEMIAEPILTNPIYNPLLLLLSLIALTFVLFVIRFIMIYGYYAYRTRR
FT                   LKKKLNKYMKDMFLLTFSGVKGTVSIATILLIPSNLEQEYPLLLFLVAGVTLVSFLTGL
FT                   LVLPHLSDEEEESKDYLMHIAILNEVTLELEKELEDTRNKLPLYAAIDNYHGRIENLIL
FT                   SQENQDDQEDWAALKLLILSIESDGLEQAYEEGNISNRAYRVYQRYLKNIEQGINRKLA
FT                   SRLTYYFLVSLRILRFLLHEVFTLGKTFRSWKNKEQSRLRALDYDQIAELYLANTEMII
FT                   ESLENLKGVYRRSLISFMQESRLRETAIISSGAFVERVINRVKPNNIDEMLRGYYLERK
FT                   LIFEYEEKRLITTKYAKKLRQNVNNLENYSLKEAANTLPYDMVELVRRN"
FT   gene            617047..617907
FT                   /locus_tag="SPAP_0646"
FT   CDS_pept        617047..617907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0646"
FT                   /product="Predicted membrane protein"
FT                   /note="Operon 288 Gene 1 COG1295 Predicted membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84239"
FT                   /protein_id="ADM84239.1"
FT                   /translation="MKKWWKELIDKPLLKAFLHYYQASDSELTSVAVAYYWLISIFPLL
FT                   LVVVNILPYFQIPVGEFLGFMKDVLPPSLYEGVEKIAREVLTQPSTGLLSFSVLSALWS
FT                   FSKSMNFLQKAFNKAYGVEKSRGLISHQMLSLLVSFGLQLLFAFALFLILFGQMILALL
FT                   AHYWTKDGIIYQALQGLAGPLIYALLFAILVMLYYFLPNLSNRKISYTLPGSAFVLLVI
FT                   LGLLTLFSSYLNYYVHHLVDVRILGSVLLVVMMFWFILIAKIVILGAVINASMQSLKDP
FT                   VFKKD"
FT   gene            618118..618828
FT                   /locus_tag="SPAP_0647"
FT   CDS_pept        618118..618828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0647"
FT                   /product="Cytochrome c biogenesis protein"
FT                   /note="Operon 289 Gene 1 COG0785 Cytochrome c biogenesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84240"
FT                   /protein_id="ADM84240.1"
FT                   /translation="MGHIFFFLSVFLAGILSFFSPCILPLLPVYTGVLLDDKDGAQASS
FT                   GKFSISVTSLLRTLAFIAGISFIFILLGYGAGFLGDLLYASWFQYLTGAIIILLGLHQM
FT                   EILHFKGLYKEKRLQLQGQGQNGKGYSQAFLLGLTFSFAWTPCVGPVLGSVLALAASGG
FT                   SGAWQGAGLMLVYTLGLALPFLLLALTSSYVLKHFRKLHPYLGILKKVGGFLIIVMGLL
FT                   VLFGNASILSQLFE"
FT   gene            618848..619414
FT                   /locus_tag="SPAP_0648"
FT   CDS_pept        618848..619414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0648"
FT                   /product="Thiol-disulfide isomerase and thioredoxin"
FT                   /note="Operon 289 Gene 2 COG0526 Thiol-disulfide isomerase
FT                   and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84241"
FT                   /protein_id="ADM84241.1"
FT                   /translation="MKKWQTCVLGAGSLLCLTACSGKSVTSEHQTKDEMKTEQTASKTS
FT                   AAKGKEVADFELMGVDGKTYRLSDYKGKKVYLKFWASWCSICLASLPDTDEIAKEAGDD
FT                   YVVLTVVSPGHKGEQSEADFKNWYKGLDYKNLPVLVDPSGKLLETYGVRSYPTQAFIDK
FT                   EGKLVKTHPGFMEKDAILQTLKELA"
FT   gene            619425..620537
FT                   /locus_tag="SPAP_0649"
FT   CDS_pept        619425..620537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0649"
FT                   /product="Peptide methionine sulfoxide reductase"
FT                   /note="Operon 289 Gene 3 COG0225 Peptide methionine
FT                   sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84242"
FT                   /protein_id="ADM84242.1"
FT                   /translation="MNDKLKIFLLLGVFFLAITGFYVLLIRNAGQTDASQIEKAAVSQG
FT                   GKTVKKTEISKDADLHEIYLAGGCFWGVEEYFSRVPGVTDAVSGYANGRGETTKYELIN
FT                   QTGHAETVHVTYDAKQISLKEILLHYFRIINPTSKNKQGNDVGTQYRTGVYYTDDKDLE
FT                   VINQVFDEVAKKYDQPLAVEKENLKNFVVAEDYHQDYLKKNPNGYCHINVNQAAYPVID
FT                   ASKYPKPSDEELKKTLSPEEYAVTQENQTERAFSNRYWDKFESGIYVDIATGEPLFSSK
FT                   DKFESGCGWPSFTQPISPDVVTYKEDKSYNMTRMEVRSRVGDSHLGHVFTDGPQDKGGL
FT                   RYCINSLSIRFIPKDQMEEKGYAYLLDYVD"
FT   gene            620805..621542
FT                   /locus_tag="SPAP_0650"
FT   CDS_pept        620805..621542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0650"
FT                   /product="Response regulator containing CheY-like receiver
FT                   domain and AraC-type DNA-binding domain"
FT                   /note="Operon 290 Gene 1 COG4753 Response regulator
FT                   containing CheY-like receiver domain and AraC-type
FT                   DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84243"
FT                   /protein_id="ADM84243.1"
FT                   /translation="MTYTILIVEDEYLVRQGLTKLVNVAAYDMEIIGQAENGRQAWELI
FT                   QKQVPDIILTDINMPHLNGIQLASLVRETYPQVHLVFLTGYDDFDYALSAVKLGVDDYL
FT                   LKPFSRQDIEEMLGKIKQKLDKEEKEEQLQDLLTNRFEGNMAQKIQSHLADSQFSLKSL
FT                   ASDLGFSPTYLSSLIKKELGLPFQDYLVRERVKQAKLLLLTTDLKIYEIAEKVGFEDMN
FT                   YFTQRFKQIAGVTPRQFKKGEDR"
FT   gene            621539..623230
FT                   /locus_tag="SPAP_0651"
FT   CDS_pept        621539..623230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0651"
FT                   /product="Predicted signal transduction protein with a
FT                   C-terminal ATPase domain"
FT                   /note="Operon 290 Gene 2 COG2972 Predicted signal
FT                   transduction protein with a C-terminal ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84244"
FT                   /protein_id="ADM84244.1"
FT                   /translation="MKRSSLLVRMVISIFLVFLILLALVGTFYYQSSSSAIEATIEGNS
FT                   QTTISQTSHFIQSYIKKLETTSTGLTQQTDVLAYAENPSQDKVEGIRDLFLTILKSDKD
FT                   LKTVVLVTKSGQVISTDDSVQMKTSSDMMAEDWYQKAIHQGAMPVLTPARKSDSQWVIS
FT                   VTQELVDAKGANLGVLRLDISYETLEAYLNQLQLGQQGFAFIINENHEFVYHPQHTVYS
FT                   SSSKMEAMKPYIDTGQGYTPGHKSYVSQEKIAGTDWTVLGVSSLEKLDQVRSQLLWTLL
FT                   GASVTSLLVCLCLVWFSLKRWIAPLKDLRETMLEIASGAQNLRAKEVGAYELREVTRQF
FT                   NAMLNQIDQLMVAIRSQEETTRQYQLQALSSQINPHFLYNTLDTIIWMAEFHDSQRVVQ
FT                   VTKSLATYFRLALNQGKDLICLSDEINHVRQYLFIQKQRYGDKLEYEINENVAFDNLVL
FT                   PKLVLQPLVENALYHGIKEKEGQGHIKLSVQKQDSGLVIRIEDDGVGFQDAGDSSQSQL
FT                   KRGGVGLQNVDQRLKLHFGANYQMKIDSRPQKGTKVEIYINRIETS"
FT   gene            623346..623909
FT                   /locus_tag="SPAP_0652"
FT   CDS_pept        623346..623909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0652"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 291 Gene 1 COG4475 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84245"
FT                   /protein_id="ADM84245.1"
FT                   /translation="MNETQIQRETRQVVEDVLEKTNLKQGALFVLGLSSSEVLGGQIGK
FT                   ESSQEIGELIVETILGILGSRGIHLAVQGCEHVNRALVVERQVAEQFGLEIVSVHPTLH
FT                   AGGSGQLAAFKFMQDPVEVEFIKAHAGLDIGDTAIGMHVKHVQVPIRPILREIGHAHVT
FT                   ALTSRPKLIGGARAHYPQDAIRKF"
FT   gene            623931..629594
FT                   /locus_tag="SPAP_0653"
FT   CDS_pept        623931..629594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0653"
FT                   /product="hypothetical protein"
FT                   /note="zinc metalloprotease ZmpB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84246"
FT                   /protein_id="ADM84246.1"
FT                   /translation="MFKKDRFSIRKIKGVVGSVFLGSLLMAPSVVDAATYHYVNKEIIS
FT                   QEAKDLIQTGKPDRNEVVYGLVYQKDQLPQTGTEASVLTAFGLLTVGSLLLIYKRKKIA
FT                   SVFLVGTMGLVVLPSAGAVDPVATLALASREGVVEMEGYRYVGYLSGDILKTLGLDTVL
FT                   EETSAKPGEVTVVEVETPQSTTNQEQARTENQVVETEEAPKEEAPKTEESPKEEPKSEV
FT                   KPTDDTLPKVEEGKEDSAEPAPVEEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEQA
FT                   GEPVAPRKDEQAPVEPENQPEAPEEEKAVEETPKQEESTPDTKAEETVEPKEETKTAKG
FT                   TQEEDYVGEALVPEQLPEYKVTEGTLVEESTTELDYKTETTEDPTKYTDEETVLRNGEK
FT                   GSQVTKTTYKTIGGVKTDQVLSTSTEVTKEPVNQQVIRGTKPIEGTTVETREEIIPFET
FT                   KEQEDDTLKRGTRQVTQEGVNDKKQITETYKTIRGEKTSDAPTITETVIEKPQDKIIKN
FT                   GTKELEKPTLEWAKTDKDVLKKSATASYTLTKPAGVEIKSIKVALKDNTGTVVKEVTVE
FT                   ENNLQATLDNLKYYQGYTLSTTMVYDRGNGEETEILEDKEVQLDLKKVEIKDIKETRLM
FT                   KVDENGNETDSSLLETVPENLTSYYLKITTNHNKVTRLAITNIEEVTEEETSLFKVTAS
FT                   APDLIQRDSNNSLSQTYTYYIEKPKASQNNVYYNFKDLVDAMQKNPNGEFKLGSDLNAT
FT                   NVPTPSKSYVTGKFTGHLTSVDGKHFSIHNTARPLFDRVEGGSIKNINLINVNINMPWA
FT                   NQLASLAQTVKNATVENIKVTGTIVGNNNVAGILDKLDDAGIMTNVAFIGKVQSVGDKG
FT                   WNLAGIASEIYRGNLNKAYADVELKGLNTRAGAIVGHLAHDFNPRDVGAWSNVRNSVAK
FT                   GTIDVARGDVGGLIGKDWPWGTIDNNISLVNVKRGDIFFGSNDMDDEFVSNWIKPNNAT
FT                   VIGVSSGDKTHKQSSKIKEISQVEADKKIKDMGITADTFEVTEHLVDKLNRRILRDEEY
FT                   KTIQDYNANRELVYRNVEKLQPFYNKEWIVNQGNKLTTDSPLMNKEVLSVTAMKGNDFI
FT                   TDLTDADHIMVHYADKTKDIFTISPKDSQVKQVKEYSVAELGEVVYTPNMVVKDRADLI
FT                   SAIEGILSPIELQSDPIYQRLGRTGDNRVNAIKNLYLEESFKEVKDHLNTFVTKLVENE
FT                   DHQLNTDEAAKRALIKKIEDNKAAVLLGLTYLNRYYGVKFDNFNIKELMLFKPDFYGKN
FT                   VSVLDRLIEIGSKEDYIKGSRTQESFREVVAKNTLSGNLHDFLTYNMKLFTNETDINVW
FT                   FKKAIENNAYVVEQPSTNPAFANKKYRLYEGLNNGQHGRMILSLLNLKDAHLFMISTYN
FT                   TISFSSFEKYGKDTEEKRETFKSEINKRAKEQVNYLDFWSRLATDNVRDKLLKSQNVVP
FT                   TPVWDNHGAPGGWPDRFGHRKDKPDYAPIREFFGRIDKYHDYKYGYGAYAYIFADPQPM
FT                   DAVYFVMSDLISEYGTSAFTHETTHVNDRMAYLGGHRHRQGTDLEAFAQGMLQTPAEHG
FT                   HQGEYGALGLNMAFERSNDGNQWYNPDPTKLQTRDQIDHYMKNYNEAMMMLDYAEAEAV
FT                   LPKVKGDNSKWFKKIDRETRRPMDRNKLSGPHQWDKVRDLIDAEKTTNLETIDDLVNNN
FT                   FMTIHGNPGNKVFHPEDFGTAYVNVNMMAGIYGGNTSQGAPGSLSFKHNAFRMWGYYGY
FT                   EHGFIDYVSSKHQGAANKENNGLLGDDFIIKKVSNNQFSNLEDWKKQWYGEVLTKSKKG
FT                   FAPIEINGTQISTYEQLKTMFDEAVTKDLTELNDSSIKDKYRNTVVLKSKVFKALLKNT
FT                   DGFSGDLFTAPQA"
FT   gene            629663..631384
FT                   /locus_tag="SPAP_0654"
FT   CDS_pept        629663..631384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0654"
FT                   /product="Anthranilate/para-aminobenzoate synthases
FT                   component I"
FT                   /note="Operon 292 Gene 1 COG0147
FT                   Anthranilate/para-aminobenzoate synthases component I"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84247"
FT                   /protein_id="ADM84247.1"
FT                   /translation="MHRKTVIDFRTLGERYTFTKPIKELKTRNVEEVADLLAQVESYQE
FT                   QGYYVVGYVSYEAAPAFEEKLAVHKDPLLGEYLLYFTVHDSVETSPIPLTYEDIDLPSN
FT                   WQEVTSAADYEKAIAQIHHHLRQGDTYQVNYTVQLKQKLNANPFAIYNRMVVEQEAGYN
FT                   AYVEHDEMAVISMSPELFFEQNDRELTTRPMKGTTQRGVTDQEDLEQASWLEQDPKNRS
FT                   ENMMIVDLLRNDMNRISEVGSEHVERLCQVEQYSTVWQMTSTIKSQLREDVDLVEIFRS
FT                   LFPCGSITGAPKIATMEIIKDLEPQPRGVYCGTIGLLLPNGRRIFNVAIRTIQLHKGQA
FT                   IYGVGGGITWDSTWESEYREVHQKAAVLYRKQARFQLITTGEISQKNLLFEDQHLERLR
FT                   KASRYFAFPFDAEDLGHKIEEECQDCEANRDYRLRISLSKSGEIEVNRQVLTPLSTSFC
FT                   QAQVCLQEAALNQSFTYFKTTHRPHLSLGEQEKIYHNKSGELLETSIGNLVLKIAGKLY
FT                   TPPIRLGILPGIYRQYLLETGQVEEKVLTLADLAQAEAIYGCNAVRGLYELSLEEN"
FT   gene            631385..632002
FT                   /locus_tag="SPAP_0655"
FT   CDS_pept        631385..632002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0655"
FT                   /product="Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /note="Operon 292 Gene 2 COG0596 Predicted hydrolases or
FT                   acyltransferases (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84248"
FT                   /protein_id="ADM84248.1"
FT                   /translation="MKLIFLHGLGQSAESWKEVRNLLTDYPSEAIELFPSGVSNYQQAK
FT                   ERVYQHLAQETEPFVLIGLSLGAALALELSSYDLPNLRALILSGCPLKLAGNILFYLQL
FT                   LIFKLLPKRVFEKQGADKALMVGVSEELKTLDLTDIAGTCPYPTLLICGIKDKPNLSSM
FT                   RSLHKLISESQFQIIPDGPHVLNKAKPKEFVEKTRSFLELLK"
FT   gene            632052..633050
FT                   /locus_tag="SPAP_0656"
FT   CDS_pept        632052..633050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0656"
FT                   /product="Choline binding protein"
FT                   /note="Operon 292 Gene 3 COG5263 FOG: Choline binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84249"
FT                   /protein_id="ADM84249.1"
FT                   /translation="MNKRLFLKMSLVTLPILALFSQPVLAEENIHFSSCKEAWANGYSD
FT                   LHEGEPGYSAKLDRDHDGVACELKNAPKGAFKAKQSTAIQINTSSATTSGWVKQDGAWY
FT                   YFDGNGNLVKNAWQGSYYLKADGKMAQSEWIYDSSYQAWYYLKSDGSYAKNAWQGAYYL
FT                   KSNGKMAQGEWVYDSSYQAWYYLKSDGSYARNAWQGNYYLKSDGKMAKGEWVYDATYQA
FT                   WYYLTSDGSYAYSTWQGNYYLKSDGKMAVNEWVDGGRYYVGADGVWKEGQASTASSSND
FT                   SNSEYSAALGKAKSYNSLFHMSKKRMYRQLTSDFDKFSNDAAQYAIDHLDD"
FT   gene            633177..634136
FT                   /locus_tag="SPAP_0657"
FT   CDS_pept        633177..634136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0657"
FT                   /product="hypothetical protein"
FT                   /note="Operon 293 Gene 1 protein supported
FT                   gi|116517028|ref|YP_816079.1| glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84250"
FT                   /protein_id="ADM84250.1"
FT                   /translation="MSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVD
FT                   DMIESIQHRLDLLGLAAADFQGIGMGSPGVVDREKGTVIGAYNLNWKTLQPIKQKIEKA
FT                   LGIPFFIDNDANVAALGERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGE
FT                   LGHITVDFDQPIACTCGKKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVT
FT                   AKTVFDLAKEGDDLALIVYRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGV
FT                   QKVYDENSFPQVRTSTKLALATLGNDAGVIGAASLVLQ"
FT   gene            634233..635072
FT                   /locus_tag="SPAP_0658"
FT   CDS_pept        634233..635072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0658"
FT                   /product="Thymidylate synthase"
FT                   /note="Operon 293 Gene 2 COG0207 Thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84251"
FT                   /protein_id="ADM84251.1"
FT                   /translation="MTKADTIFKENIERILKEGVFSEQARPKYKDGTVANSKYVTGAFS
FT                   EYDLSKGEFPITTLRPIAIKSAIKEVLWIYQDQSNSLEVLNDKYNVHYWNDWEVGDTGT
FT                   IGERYGAVVKKHDIINKLLKQLETNPWNRRNIISLWDYQAFEETDGLLPCAFQTMFDVR
FT                   RVDGEIYLDATLTQRSNDMLVAHHINAMQYVALQMMIAKHFGWKVGKFFYFINNLHIYD
FT                   NQFEQAQELLRREPSNCQPRLVLNVPDGTNFFDIKAEDFELVDYDPVKPQLKFDLAI"
FT   gene            complement(635120..635290)
FT                   /locus_tag="SPAP_0659"
FT   CDS_pept        complement(635120..635290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0659"
FT                   /product="hypothetical protein"
FT                   /note="Operon 294 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84252"
FT                   /protein_id="ADM84252.1"
FT                   /translation="MAKGFAKGLVTGVAGTVAAVAGAVYAFKKKVIEPEEQKAAFIEEN
FT                   RKKAARRRVSR"
FT   gene            635387..636295
FT                   /locus_tag="SPAP_0660"
FT   CDS_pept        635387..636295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0660"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /note="Operon 295 Gene 1 COG0324 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84253"
FT                   /protein_id="ADM84253.1"
FT                   /translation="MGIFQGKKMKTKIIVIVGPTAVGKTALAIEVAKRFNGEVVSGDSQ
FT                   QVYRGLDIGTAKASPEEQAAVSHHLIDVREITESYSAFDFVSEAKMTIEDIHSRGKLAI
FT                   IAGGTGLYIQSLLEGYHLGGETPHEEILAYRASLEPYSDEELAHLVDQAGLEIPQFNRR
FT                   RAMRALEIAHFGQDLENQETLYEPLIICLDDERSQLYERINNRVDLMFEAGLLDEAKWL
FT                   FDHSPNVQAAKGIGYKELFPYFRGEQTLEEASESLKQATRRFAKRQLTWFRNRMQVTFY
FT                   QIGESGVQDRILSQIEEFLDD"
FT   gene            636288..637526
FT                   /locus_tag="SPAP_0661"
FT   CDS_pept        636288..637526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0661"
FT                   /product="GTPase"
FT                   /note="Operon 295 Gene 2 COG2262 GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84254"
FT                   /protein_id="ADM84254.1"
FT                   /translation="MIETEKKEERVLLIGVELQGMDSFDLSMEELASLAKTAGAVVVDS
FT                   YRQKREKYDSKTFVGSGKLEEIALMVDAEEITTVIVNNRLTPRQNVNLEEVLGVKVIDR
FT                   MQLILDIFAMRARSHEGKLQVHLAQLKYLLPRLVGQGIMLSRQAGGIGSRGPGESQLEL
FT                   NRRSVRNQITDIERQLKVVEKNRATVREKRLESSTFKIGLIGYTNAGKSTIMNILTSKT
FT                   QYEADELFATLDATTKSIHLGGNLQVTLTDTVGFIQDLPTELVSSFKSTLEESKHVDLL
FT                   VHVIDASNPYHEEHEKTVLSIMKDLDMEDIPHLTLYNKADLVEDFTPTQTPYTLISAKS
FT                   EDSRENLQALLLDKIKEIFEAFTLRVPFSKSYKIHDLESVAILEERDYQEDGEVITGYI
FT                   SEKNKWRLEEFYD"
FT   gene            637519..638142
FT                   /locus_tag="SPAP_0662"
FT   CDS_pept        637519..638142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0662"
FT                   /product="hypothetical protein"
FT                   /note="Operon 295 Gene 3 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84255"
FT                   /protein_id="ADM84255.1"
FT                   /translation="MTDIKTLALKYGGYTSLDKVYLDQLLAGKTEQEQLTLITPPPSVV
FT                   NAYFAELYQKKSPQAATDYFAELSQELNLYNTEPSFTLENKSFIRLNLSGKSFGFCYES
FT                   DGFGRIFSENEEKISDDLLFEIAQIFPHQLVFEESGKIYMKPVEDEEVVSLESLTALTD
FT                   LERLADGRKRLKGYSQEDLLQEAAAFSGKRYFRSENRTAMLYID"
FT   gene            638157..639086
FT                   /locus_tag="SPAP_0663"
FT   CDS_pept        638157..639086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0663"
FT                   /product="Metal-dependent hydrolases of the beta-lactamase
FT                   superfamily III"
FT                   /note="Operon 295 Gene 4 COG1234 Metal-dependent hydrolases
FT                   of the beta-lactamase superfamily III"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84256"
FT                   /protein_id="ADM84256.1"
FT                   /translation="MDIQFLGTGAGQPSKARNVSSLALKLLDEINEVWLFDCGEGTQNR
FT                   ILETTIRPRKVSKIFITHLHGDHIFGLPGFLSSRAFQANEEQTDLEIYGPQGIKSFVLT
FT                   SLRVSGSRLPYRIHFHEFDQDSLGKILETDKFTVYAEELDHTIFCVGYRVMQKDLEGTL
FT                   DAEKLKAAGVPFGPLFGKIKNGQDLVLEDGTEIKAADYISAPRPGKIITILGDTRKTDA
FT                   SVRLAVNADVLVHESTYGKGDEKIARNHGHSTNIQAAQVAVEAGAKRLLLNHISARFLS
FT                   KDISKLKKDAATIFENVHVVKDLEEVEI"
FT   gene            639107..639862
FT                   /locus_tag="SPAP_0664"
FT   CDS_pept        639107..639862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0664"
FT                   /product="Short-chain dehydrogenase of various substrate
FT                   specificities"
FT                   /note="Operon 295 Gene 5 COG0300 Short-chain dehydrogenases
FT                   of various substrate specificities"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84257"
FT                   /protein_id="ADM84257.1"
FT                   /translation="MPTILITGASGGLAQEMVKLLPNDQLILLGRNKEKLAQLYGNYSH
FT                   AELIEIDITDDSALEALVTDLYLRYGKIDVLINNAGYGIFEGFDQIADKDIHQMFEVNT
FT                   FALMNLSRHLAARMKESSKGHIINIVSMAGLIATGKSSLYSATKFAAIGFSNALRLELM
FT                   PYGVYVTTVNPGPIRTGFFDQADPDGTYLKSVDRFLLEADAVAKKIVKIIGKNKRELNL
FT                   PILLNLAHKFYTLFPKLADKLAGETFNYK"
FT   gene            complement(639916..640884)
FT                   /locus_tag="SPAP_0665"
FT   CDS_pept        complement(639916..640884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0665"
FT                   /product="Transcriptional regulator"
FT                   /note="Operon 296 Gene 1 COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84258"
FT                   /protein_id="ADM84258.1"
FT                   /translation="MLLIFLSSLAILRQVWYNKNMRIQQLHYIIKIVETGSMNEAAKQL
FT                   FITQPSLSNAVRDLENEMGIEIFIRNPKGITLTRDGMEFLSYARQVVEQTQLLEERYKN
FT                   PVAHRELFSVSSQHYAFVVNAFVSLLKKSDMEKYELFLRETRTWEIIDDVKNFRSEVGV
FT                   LFLNSYNRDVLTKMLDDNHLLSHHLFTAQPHIFVSKTNPLAKKDKVKLSDLENFPYLSY
FT                   DQGTHNSFYFSEEILSQEHHKKSIVVSDRATLFNLLIGLDGYTIATGILNSNLNGDNIV
FT                   SIPLDIDDPIELVYIQHEKTSLSKMGERFIDYLLEEVQFDS"
FT   gene            640888..641157
FT                   /locus_tag="SPAP_0666"
FT   CDS_pept        640888..641157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0666"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 297 Gene 1 COG4483 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84259"
FT                   /protein_id="ADM84259.1"
FT                   /translation="MSLFLKKTQNFARMSLMKTFYDVQQFLKRFGIIVYMGKRLYDIEL
FT                   MKLELSRIYDAGLMDKLDYLEAEAVLRREHKVELDYIEKNGEKN"
FT   gene            641157..641537
FT                   /locus_tag="SPAP_0667"
FT   CDS_pept        641157..641537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0667"
FT                   /product="Rhodanese-related sulfurtransferase"
FT                   /note="Operon 297 Gene 2 COG0607 Rhodanese-related
FT                   sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84260"
FT                   /protein_id="ADM84260.1"
FT                   /translation="MVTWILWALILAMLAWMGFNYLRIRRAAKIVDNEEFEALIRTGQL
FT                   IDLRDPAEFHRKHILGARNIPSSQLKTSLAALRKDKPVLLYENQRAQRVTNAALYLKKQ
FT                   GFSEIYILSYGLDSWKGKVKTS"
FT   gene            641626..641853
FT                   /locus_tag="SPAP_0668"
FT   CDS_pept        641626..641853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0668"
FT                   /product="hypothetical protein"
FT                   /note="Operon 297 Gene 3 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84261"
FT                   /protein_id="ADM84261.1"
FT                   /translation="MKEKKKNPLFVGILSIILGLLFPIVGLILGIIGLVLAISYQKESQ
FT                   LDYKIEKILNILGIVISVVNWIVAIALIFR"
FT   gene            complement(641893..642618)
FT                   /locus_tag="SPAP_0669"
FT   CDS_pept        complement(641893..642618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0669"
FT                   /product="16S rRNA uridine-516 pseudouridylate
FT                   synthase-like pseudouridylate synthase"
FT                   /note="Operon 298 Gene 1 COG1187 16S rRNA uridine-516
FT                   pseudouridylate synthase and related pseudouridylate
FT                   synthases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84262"
FT                   /protein_id="ADM84262.1"
FT                   /translation="MRLDNLLAQEKISRKAMKQALLKGDILVDGCPARSLAQNIDTGLQ
FT                   ELLFQDRIIQGYEHTYLMLHKPAGVVTANKDKELPTVMDLLPSDIQSDKLYAVGRLDRD
FT                   TTGLLLLTDNGPLGFQLLHPQYHVDKTYQVEVNGLLTPDHIQTFQKGIVFLDGTICKPA
FT                   RLEILSASPSLSQASITISEGKFHQIKKMFLSVGVKVTILKRIQFGDFTLNPDLAEGNY
FT                   RPLNQKELQIIKNYLEMSR"
FT   gene            642780..644621
FT                   /locus_tag="SPAP_0670"
FT   CDS_pept        642780..644621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0670"
FT                   /product="Predicted membrane GTPase involved in stress
FT                   response"
FT                   /note="Operon 299 Gene 1 COG1217 Predicted membrane GTPase
FT                   involved in stress response"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84263"
FT                   /protein_id="ADM84263.1"
FT                   /translation="MTKLREDIRNIAIIAHVDHGKTTLVDELLKQSETLDARTELAERA
FT                   MDSNDIEKERGITILAKNTAVAYNGTRINIMDTPGHADFGGEVERIMKMVDGVVLVVDA
FT                   YEGTMPQTRFVLKKALEQDLVPIVVVNKIDKPSARPAEVVDEVLELFIELGADDDQLDF
FT                   PVVYASAINGTSSLSDDPADQETTMAPIFDTIIDHIPAPVDNSDEPLQFQVSLLDYNDF
FT                   VGRIGIGRVFRGTVKVGDQVTLSKLDGTTKNFRVTKLFGFFGLERREIQEAKAGDLIAV
FT                   SGMEDIFVGETITPTDAVEALPILHIDEPTLQMTFLVNNSPFAGKEGKWVTSRKVEERL
FT                   QAELQTDVSLRVDPTDSPDKWTVSGRGELHLSILIETMRREGYELQVSRPEVIVKEIDG
FT                   VKCEPFERVQIDTPEEYQGSVIQSLSERKGEMLDMISTGNGQTRLVFLVPARGLIGYST
FT                   EFLSMTRGYGIMNHTFDQYLPLIPGEIGGRHRGALVSIDAGKATTYSIMSIEERGTIFV
FT                   NPGTEVYEGMIIGENSRENDLTVNITKAKQMTNVRSATKDQTAVIKTPRILTLEESLEF
FT                   LNDDEYMEVTPESIRLRKQILNKAEREKANKKKKSAE"
FT   gene            644641..644895
FT                   /locus_tag="SPAP_0671"
FT   CDS_pept        644641..644895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0671"
FT                   /product="hypothetical protein"
FT                   /note="Operon 299 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84264"
FT                   /protein_id="ADM84264.1"
FT                   /translation="MVYLVLGILLLLLYVFATPESIKGTVNIVAMVCILVALLILLVLS
FT                   FLKIFQLPTEIFLAIAMLILAYFSVRDITLMPVKKSKRR"
FT   gene            645629..646669
FT                   /locus_tag="SPAP_0672"
FT   CDS_pept        645629..646669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0672"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 300 Gene 1 COG4652 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84265"
FT                   /protein_id="ADM84265.1"
FT                   /translation="MKKLFILLSTFFLSFFLAWIIVLRAPQYLYASYDSVSLLRVKKDT
FT                   QEPTREVFEQELENFANSEQSLIARRIVEPSKDGTTHFTYATYGQGTLPKEFQEASQES
FT                   RERSDPLNSYLLLSGSLTKEKLADKLGDLGYKASADRKIPPYFLAFRILLNPLILISLA
FT                   IFGLSFFALVIITRIKEMRAAGIKLFSGQTLLSIMGDSLSTDIKWLLLSALLSFLGGGV
FT                   VLFSQGLFYPILLATYGFGISFYLLFLLAISILLMLLYLMSLSYKALVPVIKGRLPLKR
FT                   LMILTLLCQLVAVFTVGYAVKTGLTSYQRLKELEISKQAWQDRADYYQISFGLGDRGKD
FT                   TENQSK"
FT   gene            646844..647650
FT                   /locus_tag="SPAP_0673"
FT   CDS_pept        646844..647650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0673"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 301 Gene 1 COG4652 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84266"
FT                   /protein_id="ADM84266.1"
FT                   /translation="MVDAETKQKLAHLQKGEFILLLPEHLRSREAELKKVFEERLSYYG
FT                   KSGEEASAPLDYEMKAHVSYLSMGEKRFVYNNGENPVSTQYLTDPILVVFTPTSTGDSF
FT                   ISLSSWSINAGKQLFIKGYESGLELLKKAGIYEQVSYLKEGRSVYLTRYNEVQTETATL
FT                   ILGAIVGIASSLLLFYSVNLLYFEQFRRDILIKRISGLRFFETHAQYMVSQFASFVFGA
FT                   SLFILSSRDLVIGLLTLLVFLASAVLTLYRQAQKESRVSMTIMKGK"
FT   gene            647652..648293
FT                   /locus_tag="SPAP_0674"
FT   CDS_pept        647652..648293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0674"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /note="Operon 301 Gene 2 COG1136 ABC-type antimicrobial
FT                   peptide transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84267"
FT                   /protein_id="ADM84267.1"
FT                   /translation="MIELKNISKKFGSRQLFSDMNLHFEGGKIYALIGTSGCGKTTLLN
FT                   MIGRLEPYDKGQIIYDGTSLKDIKPSVFFRDYLGYLFQDFGLIESQTVKENLNLGLVGK
FT                   KLKEKEKISLMKQALNRVNLSYLDLKQPIFELSGGEAQRVALAKIILKDPPLILADEPT
FT                   ASLDPKNSEELLSILESLKNPNRTIIIATHNPLIWEQVDQVIRVTDLSHR"
FT   gene            648397..649749
FT                   /locus_tag="SPAP_0675"
FT   CDS_pept        648397..649749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0675"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /note="Operon 302 Gene 1 COG0771
FT                   UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84268"
FT                   /protein_id="ADM84268.1"
FT                   /translation="MKVIDQFKNKKVLVLGLAKSGESAARLLDKLGAIVTVNDGKPFED
FT                   NPAAQSLLEEGIKVITGGHPLELLDEEFALMVKNPGIPYNNPMIEKALAKGIPVLTEVE
FT                   LAYLISEAPIIGITGSNGKTTTTTMIGEVLTAAGEHGLLSGNIGYPASQVAQIASDKDT
FT                   LVMELSSFQLMGVQEFHPEIAVITNLMPTHIDYHGSFSEYVAAKWNIQNKMTAADFLVL
FT                   NFNQDLAKDLASKTEATVVPFSTLEKVDGAYLEDGQLYFRGEVVMAANEIGVPGSHNVE
FT                   NALATIAVAKLRGVDNQTIKETLSAFGGVKHRLQFVDDIKGVKFYNDSKSTNILATQKA
FT                   LSGFDNSKVVLIAGGLDRGNEFDELVPDITGLKKMVILGQSAERVKRAADKAGVAYVEA
FT                   TDIADATRKAYELATQGDVVLLSPANASWDMYANFEVRGDLFIDTVAELKE"
FT   gene            649753..650811
FT                   /locus_tag="SPAP_0676"
FT   CDS_pept        649753..650811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0676"
FT                   /product="UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase"
FT                   /note="Operon 302 Gene 2 COG0707
FT                   UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84269"
FT                   /protein_id="ADM84269.1"
FT                   /translation="MKKIVFTGGGTVGHVTLNLLLMPKFIEDGWEVHYIGDKRGIEHQE
FT                   ILKSGLDVTFHSIATGKLRRYFSWQNMLDVFKVGWGIVQSLFIMLRLRPQTLFSKGGFV
FT                   SVPPVIAARVSGVPVFIHESDLSMGLANKIAYKFATKMYSTFEQASSLAKVEHVGAVTK
FT                   VSDKNTPEPDELVDIQTHFNPKLPTVLFVGGSAGARVFNQLVTDHKKELTERYNIINLT
FT                   GDSSLNELRQNLFRVDYVTDLYQPLMELADIVVTRGGANTIFELLAIAKLHVIVPLGRE
FT                   ASRGDQIENAAYFVKKGYAEDLQESDLTLDSLEEKLSHLLSHKEDYQAKMKASKELKSL
FT                   ADFYQLLKKDLS"
FT   gene            650821..652050
FT                   /locus_tag="SPAP_0677"
FT   CDS_pept        650821..652050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0677"
FT                   /product="Cell division septal protein"
FT                   /note="Operon 302 Gene 3 COG1589 Cell division septal
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84270"
FT                   /protein_id="ADM84270.1"
FT                   /translation="MSKDKKNEDKEILEELKELSEWQKRNQEYLKKKAEEEAALAEEKE
FT                   KERQARMGEESEKSEDKQDQESETDQEDSESAKEESEEKVASSEADKEKEEKEEIEESE
FT                   SKEKEEQDKKLAKKAIKEKPAKAKIPGIHILRAFTILFPSLLLLIVSAYLLSPYATMKD
FT                   IRVEGTVQTTADDIRQASGIQDSDYTINLLLDKAKYEKQIKSNYWVESAQLVYQFPTKF
FT                   TIKVKEYDIVAYYISGENHYPILSSGQLETSSVSLNSLPETYLSVLFNDSEQIKAFVSE
FT                   LAQISPELKAAIQKVELAPSKVTSDLIRLTMNDSDEVLVPLSEMSKKLPYYSKIKPQLS
FT                   EPSVVDMEAGIYSYTVADKLIMEAEEKAKQEAKEAEKKQEEEQKRLEEEQKKQEEESNR
FT                   NQTTQRSSRR"
FT   gene            652283..652984
FT                   /locus_tag="SPAP_0678"
FT   CDS_pept        652283..652984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0678"
FT                   /product="Orotidine-5'-phosphate decarboxylase"
FT                   /note="Operon 303 Gene 1 COG0284 Orotidine-5'-phosphate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84271"
FT                   /protein_id="ADM84271.1"
FT                   /translation="MREHRPIIALDFPSFEAVKEFLALFPAEESLYLKVGMELYYAAGP
FT                   EIVSYLKGLGHSVFLDLKLHDIPNTVKSAMKVLSQLGVDMTNVHAAGGVEMMKAAREGL
FT                   GSQAKLIAVTQLTSTSEAQMQEFQNIQTSLQESVIHYAKKTAEAGLDGVVCSAQEVQVI
FT                   KQATNPDFICLTPGIRPAGVAVGDQKRVMTPADAYQIGSDYIVVGRPITQAEDPVAAYH
FT                   AIKDEWTQDWN"
FT   gene            653018..653650
FT                   /locus_tag="SPAP_0679"
FT   CDS_pept        653018..653650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0679"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /note="Operon 303 Gene 2 COG0461 Orotate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84272"
FT                   /protein_id="ADM84272.1"
FT                   /translation="MTLAKDIASHLLKIQAVYLKPEEPFTWASGIKSPIYTDNRVTLAY
FT                   PETRTLIENGFVEAIKEAFPEVEVIAGTATAGIPHGAIIADKMDLPFAYIRSKPKDHGA
FT                   GNQIEGRVAQGQKMVVVEDLISTGGSVLEAVAAAKREGADVLGVVAIFSYQLPKADKNF
FT                   ADAGVKLVTLSNYSELIHLAQEEGYITPEGLDLLKRFKEDQENWQEG"
FT   gene            653883..654233
FT                   /locus_tag="SPAP_0680"
FT   CDS_pept        653883..654233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0680"
FT                   /product="hypothetical protein"
FT                   /note="Operon 304 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84273"
FT                   /protein_id="ADM84273.1"
FT                   /translation="MFLPTVLARQIGNYDLTLPRWGSDTTSELEKENASAGINNSDSTG
FT                   GGKRLSTSIRSAYSGSDITPVYSLGSGSRIVMYYNGGGDNYIGSGTRLAMAPQFGNHVR
FT                   IHTSGSWSPDSY"
FT   gene            654330..655094
FT                   /locus_tag="SPAP_0681"
FT   CDS_pept        654330..655094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0681"
FT                   /product="hypothetical protein"
FT                   /note="Operon 304 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84274"
FT                   /protein_id="ADM84274.1"
FT                   /translation="MEFFICNLVRVVQSPRFYMSLFLTLLCMSLGNFLAFNGIYKIEGL
FT                   SIFFAASSIRGFSPISLVAALICTLPYSSQIIEDAESHFLTAQLCRISKKRYLAIVGST
FT                   AIISSFLVFFLPYLLLLGINLLVTPYQEIYIGDYSGALKELFDSNQLLYSLVTTLWYGV
FT                   WGAVFSIFGLASALLVKKKIGAIFIPVAYMMVGGIFLAILGLSYLEPVTTLALGYQKDI
FT                   SLSLVSGHLAFILFVSCLVVYGTFFLHSEDYV"
FT   gene            656207..656554
FT                   /locus_tag="SPAP_0682"
FT   CDS_pept        656207..656554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0682"
FT                   /product="hypothetical protein"
FT                   /note="Operon 305 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84275"
FT                   /protein_id="ADM84275.1"
FT                   /translation="MVKVLVIQFMLQLPNWDIGVLFIVDSLNACVLSLLCFMLYALGAN
FT                   VQMNFACVSFFLLMIVFGGLFVGNRTNYLFYILNRGNGDIGRDLFLQLLFLVFLFKSIF
FT                   YFTRQKRRFIE"
FT   gene            656551..657198
FT                   /locus_tag="SPAP_0683"
FT   CDS_pept        656551..657198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0683"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="Operon 305 Gene 2 COG1131 ABC-type multidrug
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84276"
FT                   /protein_id="ADM84276.1"
FT                   /translation="MNEIITLKNIELKLKKTCVFQNLNFSCKQGEIIGITGANGSGKSV
FT                   LFKLIAGLYSPSYGEVLINGENIVPERKIPANLGALIEEPGFINYYSGFKNLQYLASIR
FT                   GVVGNQEINDTLKIVGLYEQKDQKVKTYSLGMRKKLGIAQAIMENPSILLLDEPMNALD
FT                   KSSVENMRTLFRKLSSEKGTTILIASHSEEDIRILCDKVYAIEDKVCTLCSD"
FT   gene            complement(657285..658151)
FT                   /locus_tag="SPAP_0684"
FT   CDS_pept        complement(657285..658151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0684"
FT                   /product="ABC-type amino acid transport/signal transduction
FT                   systems, periplasmic component/domain protein"
FT                   /note="Operon 306 Gene 1 COG0834 ABC-type amino acid
FT                   transport/signal transduction systems, periplasmic
FT                   component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84277"
FT                   /protein_id="ADM84277.1"
FT                   /translation="MKLFKPLLTVLVLAFALIFITACSSGGNAGSSSGKTTAKARTIDE
FT                   IKKSGELRIAVFGDKKLFGYVDNDGSYQGYDIELGNQLAQNLGVKVKYISVDAANRAEY
FT                   LISNKVDIILANFTVTDERKKQVDFALPYMKVSLGVVSPKTGLITDVKQLEGKTLIVTK
FT                   GTTAETYFEKNHPEIKLQKYDQYSDSYQALLDGRGDAFSTDNTEVLAWALENKGFEVGI
FT                   TSLGDPDTIAAAVQKGNQELLDFINKDIEKLGKENFFHKAYEKTLHPTYGDTAKADDLV
FT                   VEGGKVD"
FT   gene            complement(658163..658669)
FT                   /locus_tag="SPAP_0685"
FT   CDS_pept        complement(658163..658669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0685"
FT                   /product="hypothetical protein"
FT                   /note="Operon 306 Gene 2 protein supported
FT                   gi|163803615|ref|ZP_02197481.1| 50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84278"
FT                   /protein_id="ADM84278.1"
FT                   /translation="MVFQSYELFPHLDVLQNLILGPIKTQGRDKKEVTEEALQLLDRVG
FT                   LLDKQHSFARQLSGGQKQRVAIVRALLMHPEIILFDEVTASLDPEMVREVLELINDLAQ
FT                   EGRTMILVTHEMQFAQAIADRIIFLDQGKIAEEGTAQAFFTNPQTKRAQEFLNVFDFSQ
FT                   FGSYL"
FT   gene            complement(658810..658920)
FT                   /locus_tag="SPAP_0686"
FT   CDS_pept        complement(658810..658920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0686"
FT                   /product="ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /note="Operon 306 Gene 3 COG1126 ABC-type polar amino acid
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84279"
FT                   /protein_id="ADM84279.1"
FT                   /translation="MSETILEIKELKKSFGDNPILKGLSLEIKKGKLLSS"
FT   gene            complement(658921..659598)
FT                   /locus_tag="SPAP_0687"
FT   CDS_pept        complement(658921..659598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0687"
FT                   /product="ABC-type amino acid transport system, permease
FT                   component"
FT                   /note="Operon 306 Gene 4 COG0765 ABC-type amino acid
FT                   transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84280"
FT                   /protein_id="ADM84280.1"
FT                   /translation="MQDSGIQVLFQGNNLLRILQGLGVTIEISILSVLLSMMFRTVMGI
FT                   IMTSHSRIIRFLTRLYLEFIRIMPQLVLLFIVYFGLARNFNINISGETSAIIVFTLWGT
FT                   AEMGDLVRGAITSLPKHQFESGQALGLTNVQLYYHIIIPQVLRRLLPQAINLVTRMIKT
FT                   TSLVVLIGVVEVTKVGQQIIDSNRLTIPTASFWIYGTILVLYFAVCYPISKLSTHLEKH
FT                   WRN"
FT   gene            complement(659558..660238)
FT                   /locus_tag="SPAP_0688"
FT   CDS_pept        complement(659558..660238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0688"
FT                   /product="ABC-type amino acid transport system, permease
FT                   component"
FT                   /note="Operon 306 Gene 5 COG0765 ABC-type amino acid
FT                   transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84281"
FT                   /protein_id="ADM84281.1"
FT                   /translation="MDWSIVEQYLPLYQKAFFLTLHIAVWGILGSFLLGLIVSIIRHYR
FT                   IPVLAQVATAYIELSRNTPLLIQLFFLYFGLPRIGIVLSSEVCATLGLVFLGGSYMAES
FT                   FRSGLEAISQTQQEIGLAIGLTPLQVFRYVVLPQATAVALPSFSANVIFLIKETSVFSA
FT                   VALADLMYVAKDLIGLYYETDIALAMLVVAYLIMLLPISLVFSWIERRLRHAGFGNPST
FT                   LSGK"
FT   gene            660453..660599
FT                   /locus_tag="SPAP_0689"
FT   CDS_pept        660453..660599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0689"
FT                   /product="L-lactate dehydrogenase (FMN-dependent)-like
FT                   alpha-hydroxy acid dehydrogenase"
FT                   /note="Operon 307 Gene 1 COG1304 L-lactate dehydrogenase
FT                   (FMN-dependent) and related alpha-hydroxy acid
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84282"
FT                   /protein_id="ADM84282.1"
FT                   /translation="MSYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAEDTFT
FT                   SFQ"
FT   gene            660727..662217
FT                   /locus_tag="SPAP_0690"
FT   CDS_pept        660727..662217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0690"
FT                   /product="Lysyl-tRNA synthetase (class II)"
FT                   /note="Operon 308 Gene 1 COG1190 Lysyl-tRNA synthetase
FT                   (class II)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84283"
FT                   /protein_id="ADM84283.1"
FT                   /translation="MSTEHMEELNDQQIVRREKMAALCEQGIDPFGKRFERTANSQELK
FT                   DKYANLDKEQLHDKNETATIAGRLVTKRGKGKVGFAHLQDREGQIQIYVRKDAVGEENY
FT                   EIFKKADLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRK
FT                   RYLDLISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNEAGGAAARPFITHHN
FT                   AQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADF
FT                   QDIMDLTEGIIQHAAKSVKGDGPVNYQGTEIKINEPFKRVHMVDAIREITGVDFWQDMT
FT                   LEEAKVIAAEKKVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNP
FT                   EDQRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYIEA
FT                   LEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK"
FT   gene            662841..663977
FT                   /locus_tag="SPAP_0691"
FT   CDS_pept        662841..663977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0691"
FT                   /product="L-lactate dehydrogenase (FMN-dependent)-like
FT                   alpha-hydroxy acid dehydrogenase"
FT                   /note="Operon 309 Gene 1 COG1304 L-lactate dehydrogenase
FT                   (FMN-dependent) and related alpha-hydroxy acid
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84284"
FT                   /protein_id="ADM84284.1"
FT                   /translation="MSYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAEDTFT
FT                   LRENIRAFNHKLIVPHTLCNVENPSTEIEFAGEKLSSPIIMAPVAAHKLANEQGEVATA
FT                   RGVHEFGSLYTTSSYSTVDLPEISEALQGTPHWFQFYFSKDDGINRHIMDRVKAEGYKA
FT                   IVLTADATVGGNREVDKRNGFVFPVGMPIVEEYLPEGAGKSMDFVYKSAKQRLSPRDVE
FT                   FIAEYSGLPVYVKGPQCREDVERSLAAGASGIWVTNHGGRQIDGGPAAFDSLQEVAEAV
FT                   DRRVPIVFDSGVRRGQHVFKALASGADLVAIGRPVIYGLALGGSVGVRQVFEHLNAELK
FT                   TVMQLSGAQTIEDVKHFKLRHNPYNPTFPVDPRDLKLY"
FT   gene            664532..665200
FT                   /locus_tag="SPAP_0692"
FT   CDS_pept        664532..665200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0692"
FT                   /product="Putative transcription activator"
FT                   /note="Operon 310 Gene 1 COG0819 Putative transcription
FT                   activator"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84285"
FT                   /protein_id="ADM84285.1"
FT                   /translation="METQDYAFQPGLTVGELLKSSQKDWQAAINHRFVKELFAGTIENK
FT                   VLKDYLIQDYHFFDAFLSMLGACVAHADKLESKLRFAKQLGFLEADEDGYFQKAFKELK
FT                   VAENDYLEVTLHPVTKAFQDLMYSAVASSDYAHLLVMLVIAEGLYLDWGSKDLALPEVY
FT                   IHSEWINLHRGPFFAEWVQFLVDELNRVGKNREDLTELQQRWNQAVALELAFFDIGYDV
FT                   "
FT   gene            665562..666308
FT                   /locus_tag="SPAP_0693"
FT   CDS_pept        665562..666308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0693"
FT                   /product="Hydroxyethylthiazole kinase, sugar kinase family"
FT                   /note="Operon 311 Gene 1 COG2145 Hydroxyethylthiazole
FT                   kinase, sugar kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84286"
FT                   /protein_id="ADM84286.1"
FT                   /translation="MVICITNDVVKNFTANGLVALGASPAMSEFPADLEDLLKYAGGLL
FT                   INIGTLTDENWKLYQAALKIAEKYNVPAVLDPVACGAGEYRKKVADDLINNYKLAAIRG
FT                   NAGEIASLVGIDVASKGVDSAGVDNIDEIALAANEKFNIPIVVTGEVDVIAVNGEVVTI
FT                   HNGSAMMPKVIGTGCLLGAVVASFIGLEKGQELKSLETAMLVYNIAGEMAEKRPNGHLP
FT                   GTFKVEFINALYEITDEDVKEFKRVK"
FT   gene            666310..666939
FT                   /locus_tag="SPAP_0694"
FT   CDS_pept        666310..666939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0694"
FT                   /product="Thiamine monophosphate synthase"
FT                   /note="Operon 311 Gene 2 COG0352 Thiamine monophosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84287"
FT                   /protein_id="ADM84287.1"
FT                   /translation="MFHKELLKLYFICGTTTCQGKNLYTVVEEALKGGITLFQFREKGE
FT                   GALEGLEKLELAIQIKELCKKYNVPFIVNDDIDLAMEIDADGVHVGQDDIGVDEIRKLM
FT                   PDKIIGLSIRNEEEFQQSKVEYVDYVGVGPVFDTQSKDDAGGAIGYEGLELMRKLLPQM
FT                   PLVAIGGIQTKHIKDIIKTNMDGVSIISAISYAKNIEKTVREMSEQ"
FT   gene            667498..668058
FT                   /locus_tag="SPAP_0695"
FT   CDS_pept        667498..668058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0695"
FT                   /product="Predicted membrane protein"
FT                   /note="Operon 312 Gene 1 COG4721 Predicted membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84288"
FT                   /protein_id="ADM84288.1"
FT                   /translation="MLKKWQLKDVILLAFLSIFFGGVFVGSGYVYNILSLLLTPLGLQA
FT                   FANEILFGLWCMAAPIAAIFVPRVGSATIGEVLAALAEVLYGSQFGLGALLSGLVQGLG
FT                   SEFGFIVTKNRYESWLSLTANSIGITLVSFVYEYIKLGYYAFSLPFVLSLLVVRFISVY
FT                   FFCTILVRAIVKLYHQFATGGKA"
FT   gene            668059..669444
FT                   /locus_tag="SPAP_0696"
FT   CDS_pept        668059..669444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0696"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /note="Operon 312 Gene 2 COG1122 ABC-type cobalt transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84289"
FT                   /protein_id="ADM84289.1"
FT                   /translation="MGLELRAIQSPIFSEPFDFTFHAQAFTLLVGSSGSGKSSLFQMIA
FT                   QVSSLPYSGQVLIDGSEVSQLSIIARVQKVGILLQNPNHQFTMENLFEELIFTLENIGY
FT                   HLQEIDSKIAEVVQQCRCEAILHRPIHHLSGGEKQKAALAVLFAMNPRVYLLDEPFASI
FT                   DRKSRIEILEILKELALDGKTVILCDHDLSDYKTYIDYMVELRDGKLREVFQIPSYEMT
FT                   QVASKEVAASPELFHMNRVTGELGNRPLFSIADFTFYQGISCILGDNGVGKSTLFRSIL
FT                   QFQKYKGSIAWKGTVLKKKKSLYRDLTGVVQEAEKQFIRVSLREELQLDGPDSERNQRI
FT                   FQALRYFDLEQAVDKSPYQLSGGQQKILQLLTILTIKASVILLDEPFAGLDDRACHYFC
FT                   KWIVEERNQGRTFLLISHRLDPLISVVDYWIEMTSQGLRHVKEVTITKPLTSQSSNTQG
FT                   EVR"
FT   gene            669446..670096
FT                   /locus_tag="SPAP_0697"
FT   CDS_pept        669446..670096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0697"
FT                   /product="hypothetical protein"
FT                   /note="Operon 312 Gene 3 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84290"
FT                   /protein_id="ADM84290.1"
FT                   /translation="MVKVATQTPIISLFLLILSLETSFIPSIALNLSVVAFCILFMLYY
FT                   RRFKMLAWMIILAILPSFANYWAVQLHGDASQAVMLGTRAFVTVCIGLVFVSSISLKEL
FT                   LLYLAQKGLSRSWSYALIVVFNSFPLIQQEIKSLKEACLLRGQELHFWSPLIYSKVLMT
FT                   VFRWRHLYLRALSAHGYDEHAQLKNSYRTFYIPKKTKLIYLLFFLLLQTSLFL"
FT   gene            670107..670799
FT                   /locus_tag="SPAP_0698"
FT   CDS_pept        670107..670799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0698"
FT                   /product="Putative transcription activator"
FT                   /note="Operon 312 Gene 4 COG0819 Putative transcription
FT                   activator"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84291"
FT                   /protein_id="ADM84291.1"
FT                   /translation="MEFTDIAMELSKKAWQASFHHPFILQLQEGNLEPAIFRYYLIQDA
FT                   YYLKAFSEIYHLLADKASNQEMKRLLKQNAQGLVEGELFIRQQFFKELEISDQEMEQHP
FT                   IAPTCYHYISHIYRQFAEPNLAIAFASLLPCPWLYHDIGKSLNLKPSPNPLYQQWIETY
FT                   ITDELEQQIREEGALVNQLYRESDETDKQKMLDAFHISVHMEAKFWEMAYQHQTWKSDL
FT                   QSLEKGEE"
FT   gene            670804..671328
FT                   /locus_tag="SPAP_0699"
FT   CDS_pept        670804..671328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0699"
FT                   /product="Predicted membrane protein"
FT                   /note="Operon 312 Gene 5 COG4732 Predicted membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84292"
FT                   /protein_id="ADM84292.1"
FT                   /translation="MRKHQLQVHKLTILSMMIALDVVLTPIFRIEGMAPMSSVVNILAG
FT                   IMMGPVYALAMATVTAFIRMTTQGIPPLALTGATFGALLAGLFYKYGRKFYFSALGEIV
FT                   GTGIIGSIVSYPVMVLFTGSAAKLSWFIYTPRFFGATLIGTAISFIAFRFLIKQEFFKK
FT                   VQGYFFSERID"
FT   gene            671328..672131
FT                   /locus_tag="SPAP_0700"
FT   CDS_pept        671328..672131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0700"
FT                   /product="Hydroxyethylthiazole kinase, sugar kinase family"
FT                   /note="Operon 312 Gene 6 COG2145 Hydroxyethylthiazole
FT                   kinase, sugar kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84293"
FT                   /protein_id="ADM84293.1"
FT                   /translation="MQEFTNPFPIGSSSLIHCMTNEISCEMLANGILALGCKPVMADDP
FT                   REVLDFTKQSQALFINLGHLSAEKEKAIRMAASYANQSSLPMVVDAVGVTTSSIRKSLV
FT                   KDLLDYRPTVIKGNMSEIRSLVGLKHHGVGVDASAKDQETEDLLQVLKDWCQTYPGMSF
FT                   LVTGPKDLVVSKNQVAVLGNGCTELDWITGTGDLVGALTAVFLSQGKTGFEASCLAVSY
FT                   LNIAAEKIVVQGMGLEEFRYQVLNQLSLLRRDENWLDTIKGEVYE"
FT   gene            672124..672756
FT                   /locus_tag="SPAP_0701"
FT   CDS_pept        672124..672756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0701"
FT                   /product="Thiamine monophosphate synthase"
FT                   /note="Operon 312 Gene 7 COG0352 Thiamine monophosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84294"
FT                   /protein_id="ADM84294.1"
FT                   /translation="MNREALRLYLVTNRYQDSVESFLAKIETACRSGVTIVQLREKNLT
FT                   TNQYYQLAKQVKEITDAYQVPLIIDDRLDVCLAVDAAGLHIGDDELPVSVARKVLGPEK
FT                   ILGVTAKTVKRALEAEKSGADYLGTGAIFPTTTKENAPITLISTLKTICQTVAIPVVAI
FT                   GGLTSENIDQLMGTGIAGVAVVRDLMQAEDIEAKTQAFLTKLHDILS"
FT   gene            complement(672966..673757)
FT                   /locus_tag="SPAP_0702"
FT   CDS_pept        complement(672966..673757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0702"
FT                   /product="Hydroxymethylpyrimidine/phosphomethylpyrimidine
FT                   kinase"
FT                   /note="Operon 313 Gene 1 COG0351
FT                   Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84295"
FT                   /protein_id="ADM84295.1"
FT                   /translation="MTYLPVALTIAGTDPSGGAGIMADLKSFQARDAYGMAVVTSLVAQ
FT                   NTRGVQLIEHVSPQMLKAQLDSVFSDIPPQAVKTGMLATTEIMEIIQPYLKKLDCPYVL
FT                   DPVMVATSGDALIDSSARDYLKTNLLPLATIITPNLPEAEEIVGFSIHDPEDMQRAGRL
FT                   ILKEFGPQSVVIKGGHLKGGAKDFLFTKNEQFVWESPRIQTCHTHGTGCTFAAVITAEL
FT                   AKGKSLYQAVDKAKAFITKAIQDAPQLGHGSGPVNHTTFKD"
FT   gene            674123..674518
FT                   /locus_tag="SPAP_0703"
FT   CDS_pept        674123..674518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0703"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="Operon 314 Gene 1 COG3682 Predicted transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84296"
FT                   /protein_id="ADM84296.1"
FT                   /translation="MQISDAEWQVMKIIWMQGEQTSTDLIRVLAERFDWSKSTVQTLLS
FT                   RLVEKECLTRKKEGKSFVYSALLTLDQSRDLLVQDIKDKVCSRRIRNLLADLIVECEFT
FT                   QTDLEDLEAVISEKKSSAVTEVRCNCM"
FT   gene            674529..674900
FT                   /locus_tag="SPAP_0704"
FT   CDS_pept        674529..674900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0704"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 314 Gene 2 COG4633 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84297"
FT                   /protein_id="ADM84297.1"
FT                   /translation="MLNSIVTIICIALIAFILFWFFKKPEKSGQKAQQKNGYQEIRVEV
FT                   MGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHTNLPMGEEYVVEITPEQA
FT                   GEFGFACGMNMMHGKMIVE"
FT   gene            674910..677153
FT                   /locus_tag="SPAP_0705"
FT   CDS_pept        674910..677153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0705"
FT                   /product="Cation transport ATPase"
FT                   /note="Operon 314 Gene 3 COG2217 Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84298"
FT                   /protein_id="ADM84298.1"
FT                   /translation="MTEIVKASLENGIQKIRIRAEKGYHPAHIQLQKGIPAEITFHRAT
FT                   PSNCYKEILFEEEGILEPIGVDEEKVIRFTPQELGRHEFSCGMKMQKGSYTVVEKTRKS
FT                   LSLLQRFWITSIFTVPLVILMIGMLTGSISHQVMHWGTFLATTTIMLVAGKPYIQSAWA
FT                   SFKKHNANMDTLVALGTLVAYFYSLVALFAGLPVYFESAGFILFFVLLGAVFEEKMRKN
FT                   TSQAVEKLLDLQAKTAEVLSDDSYVQVPLEQVKVGDLIRVRPGEKIAVDGVVVEGVSSI
FT                   DESMVTGESLPVDKTVGDTVIGSTINHSGTLVFRAEKVGSETVLAQIVDFVKKAQTSRA
FT                   PIQDLTDKISGIFVPVVVILGIMTFWVWFVLLRDSVVVLGASFVSSLLYGVAVLIIACP
FT                   CALGLATPTALMVGTGRSAKMGVLLKNGTVLQEIQKVQTLVFDKTGTLTEGKPVVTDVI
FT                   GDEVEVFRLAASLEDASQHPLAEAIVKRASEAGLEFQTVENFQTLHGKGVSGRINGKQV
FT                   LLGNAKMLDGMDISNTYQDKLEELEKEAKTVVFLAVDNEIKGLLALQDIPKENAKLAIS
FT                   QLKKRGLRTVMLTGDNAGVARAIADQIGIEEVIAGVLPEEKAHEIHKLQQSGKVAFVGD
FT                   GINDAPALSVADVGIAMGAGTDIAIESADLVLTTNNLLGVVRAFDMSKKTFHRILLNLF
FT                   WAFIYNVVGIPIAAGVFSGVGLALNPELAGLAMAFSSVSVLTSSLLLNFSKID"
FT   gene            677360..679135
FT                   /locus_tag="SPAP_0706"
FT   CDS_pept        677360..679135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0706"
FT                   /product="thiamine pyrophosphate-requiring enzyme"
FT                   /note="acetolactate synthase; pyruvate dehydrogenase
FT                   (cytochrome); glyoxylate carboligase; phosphonopyruvate
FT                   decarboxylase; Operon 315 Gene 1 COG0028 Thiamine
FT                   pyrophosphate-requiring enzymes [acetolactate synthase,
FT                   pyruvate dehydrogenase (cytochrome), glyoxylate
FT                   carboligase, phosphonopyruvate decarboxylase]"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84299"
FT                   /protein_id="ADM84299.1"
FT                   /translation="MTQGKITASAAMLNVLKTWGVDTIYGIPSGTLSSLMDALAEDKDI
FT                   RFLQVRHEETGALAAVMQAKFGGSIGVAVGSGGPGATHLINGVYDAAMDNTPFLAILGS
FT                   RPVNELNMDAFQELNQNPMYNGIAVYNKRVAYAEQLPKVIDEACRAAISKKGPAVVEIP
FT                   VNFGFQEIDENSYYGSGSYERSFIAPALNEVEIDKAVEILNNAERPVIYAGFGGVKAGE
FT                   VITELSRKIKAPIITTGKNFEAFEWNYEGLTGSAYRVGWKPANEVVFEADTVLFLGSNF
FT                   PFAEVYEAFKNTEKFIQVDIDPYKLGKRHALDASILGDAGQAAKAILDKVNPVESTPWW
FT                   RANVKNNQNWRDYMNKLEGKTEGELQLYQVYNAINKHADQDAIYSIDVGNTTQTSTRHL
FT                   HMTPKNMWRTSPLFATMGIALPGGIAAKKDNPDRQVWNIMGDGAFNMCYPDVITNVQYD
FT                   LPVINLVFSNAEYGFIKNKYEDTNKHLFGVDFTNADYAKIAEAQGAVGFTVDRIEDIDA
FT                   VVAEAVKLNKEGKTVVIDARITQHRPLPVEVLELDPKLHSEEAIKAFKEKYEAEELVPF
FT                   RLFLEEEGLQSRAIK"
FT   gene            679246..679593
FT                   /locus_tag="SPAP_0707"
FT   CDS_pept        679246..679593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0707"
FT                   /product="Lactoylglutathione lyase-like lyase"
FT                   /note="Operon 316 Gene 1 COG0346 Lactoylglutathione lyase
FT                   and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84300"
FT                   /protein_id="ADM84300.1"
FT                   /translation="MNLNQLDIIVSNVPQVCADLEHILDKKADYADDGFAQFTIGSHCL
FT                   MLSQNHLVPLENFQSGIIIHIEVEDVDQNYKRLNELGIKVLHGPTVTDWGTESLLVQGP
FT                   AGLVLDFYRMK"
FT   gene            complement(679805..680218)
FT                   /locus_tag="SPAP_0708"
FT   CDS_pept        complement(679805..680218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0708"
FT                   /product="Transposase-like protein, ISSpn2"
FT                   /note="Operon 317 Gene 1 COG3335 Transposase and
FT                   inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84301"
FT                   /protein_id="ADM84301.1"
FT                   /translation="MYQDEAGFGRISKLGSCWSPIGVGPHVHSHYIREFRYCYGAVDAH
FT                   TGESFFLIAGGCNTEWMNAFLEELSQAYPDDYLLLVMDNAIWHKSSTLKIPTNIGFTFI
FT                   PPYTPEMNPLNKCGKRFVNVDLRIKPFELWKMS"
FT   gene            complement(680250..680516)
FT                   /locus_tag="SPAP_0709"
FT   CDS_pept        complement(680250..680516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0709"
FT                   /product="Transposase-like protein, ISSpn2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84302"
FT                   /protein_id="ADM84302.1"
FT                   /translation="MTVEEEKVFLARHLKAAEAGEFVTIDALFQAYKKELGRSYTRDAF
FT                   YQLLKRHGWRNIMPRPEHPKKADAQTIVASKNKISIQEDKKAF"
FT   gene            complement(680872..680967)
FT                   /locus_tag="SPAP_0710"
FT   CDS_pept        complement(680872..680967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0710"
FT                   /product="Transposase-like protein, ISSpn2"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84303"
FT                   /protein_id="ADM84303.1"
FT                   /translation="MKSTKEEIQTIKTLFKDSRTAKYHKRLQIVL"
FT   gene            681032..681313
FT                   /locus_tag="SPAP_0711"
FT   CDS_pept        681032..681313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0711"
FT                   /product="Beta-glucosidase/6-phospho-beta-glucosidase/
FT                   beta-galactosidase"
FT                   /note="Operon 319 Gene 1 COG2723
FT                   Beta-glucosidase/6-phospho-beta-glucosidase/beta-
FT                   galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84304"
FT                   /protein_id="ADM84304.1"
FT                   /translation="MDTPDENGYVADDYRITYLEAHIKAMRDAIYKDGVDLLGYTTWGC
FT                   IDSVSAGTGEMNKRYGFIYVDRDNVGNGTLKRSKKKSFYWYMSFIAMV"
FT   gene            681445..682389
FT                   /locus_tag="SPAP_0712"
FT   CDS_pept        681445..682389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0712"
FT                   /product="Phosphomannose isomerase"
FT                   /note="Operon 320 Gene 1 COG1482 Phosphomannose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84305"
FT                   /protein_id="ADM84305.1"
FT                   /translation="MSEPLFLQSVMQEKIWGGAKLRDEFGYDIPSEKIGEYWAISAHPN
FT                   GVSKVANGRYEGTDLATLYAEHRELFGNRPEPVFPLLTKILDANDWLSVQVHPDDAYGL
FT                   EHEGELGKTECWYIIAADEGSEIIYGHNAKSKEELRQQIEDKNWDDLLTKVPVKAGDFF
FT                   YVPSGTMHAIGAGIFILETQQSSDTTYRVYDFDRKDDKGNLRELHLEKSIDVLNIGEPA
FT                   NSRPVTVKADDLRSTLLVSNDFFAVYKWEITGKVDFEKTADYSLLSVLAGQGQLTVDGK
FT                   NYPIQKGSHFILPSDVEAWTLEGQGLELIVSHP"
FT   gene            complement(682410..683888)
FT                   /locus_tag="SPAP_0713"
FT   CDS_pept        complement(682410..683888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0713"
FT                   /product="Na+-dependent transporters of the SNF family"
FT                   /note="Operon 321 Gene 1 COG0733 Na+-dependent transporters
FT                   of the SNF family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84306"
FT                   /protein_id="ADM84306.1"
FT                   /translation="MVFLTDLRKHDRIVKSINQTEGYLTTQVAFSYFEKGDQSLTMSEK
FT                   SQWGSKLGFILASAGSAIGLGSVWKFPYMTAANGGGGFLLIFLISTILIGFPLLLAEFA
FT                   LGRSAGVSAIKTFGKLGKNNKYNFIGWIGAFALFILLSFYSVIGGWILVYLGIEFGKLF
FT                   QLGGTGDYAQLFTSIISNPAIALVAQAAFILLNIFIISRGVQKGIERASKVMMPLLFII
FT                   FVFIIGRSLSLPNAMEGVLYFLKPDFSKLTSAGLLYALGQSFFALSLGVTVMLTYASYL
FT                   DKKTNLVQSGISIVAMNISISIMAGLAIFQARSPFNIQSEGGPSLLFIVLPQLFDKMPF
FT                   GTIFYVLFLFATVTSSVVMLEINVGNITNQDNSKRAKWSVILGILTFVFGIPSALSYGV
FT                   MADVHIFGKTFFDAMDFLVSNLLMPFGALYLSLFTGYIFKKALAMEELHLDERAWKQGL
FT                   FQVWLFLLRFFVPSFQSSSLWSSLPNLCNQKGLE"
FT   gene            684054..684725
FT                   /locus_tag="SPAP_0714"
FT   CDS_pept        684054..684725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0714"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="Operon 322 Gene 1 COG0789 Predicted transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84307"
FT                   /protein_id="ADM84307.1"
FT                   /translation="MVPLKSENGYRTYSQEDLERLQVILYYKYLGFSLEKIAELLKEER
FT                   TDLLPHLTRQLDYLTRERQHLDTLISTLQKTIQEQKGERKMTIEEKFTGFSYQDNQKYH
FT                   QEAVEKYGQEVMGQALERQKGHEDEATAAFNQVFQTLAQNLQVGLPATATENQEQAAKL
FT                   LQAIRTYGFDCSIEVFGHIGKGYVYNPEFKENIDKFGSGTAQYTSDAIAAYVQTNAEKI
FT                   G"
FT   gene            complement(684745..685200)
FT                   /locus_tag="SPAP_0715"
FT   CDS_pept        complement(684745..685200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0715"
FT                   /product="NTP pyrophosphohydrolase including oxidative
FT                   damage repair enzymes"
FT                   /note="Operon 323 Gene 1 COG0494 NTP pyrophosphohydrolases
FT                   including oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84308"
FT                   /protein_id="ADM84308.1"
FT                   /translation="MNRREAVEFVNMCMIKNGDKVLVQDRVSPDWPGITFPGGHVERGE
FT                   SFVDAVIREVKEETGLIISKPQLCGIKNWYDDKDYRYVVLFYKTEHFTGELQSSDEGKV
FT                   WWEDFENLSHLKLATDDMSDMLRVFLEEDLSEFFYYKNGDDWLYDLK"
FT   gene            complement(685220..686395)
FT                   /locus_tag="SPAP_0716"
FT   CDS_pept        complement(685220..686395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0716"
FT                   /product="Predicted flavoprotein"
FT                   /note="Operon 323 Gene 2 COG2081 Predicted flavoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84309"
FT                   /protein_id="ADM84309.1"
FT                   /translation="MKHFDTIVIGGGPAGMMATISSSFYGQKTLLIEKNRKLGKKLAGT
FT                   GGGRCNVTNNGSLDNLLAGIPGNGRFLYSVFSQFDNHDIINFFTENGVKLKVEDHGRVF
FT                   PASDKSRTIIEALEKKITELGGQVATQIEIVSVKKVDNQFVLKSADQTFTCEKLIVTTG
FT                   GKSYPSTGSTGFGHEIARHFKHTITDLEAAESPLLTDFPHKALQGISLDDVTLSYGKHV
FT                   ITHDLLFTHFGLSGPAALRMSSFVKGGEVLSLDVLPQLSEKDLVTFLEKNREKSLKNAL
FT                   KTLLPERLAEFFVQGYPEKVKQLTEKEREQLVQSIKELKIPVTGKMSLAKSFVTKGGVS
FT                   LKEINPKTLESKLVPGLHFAGEVMDINAHTGGFNITSALCTGWVAGSLHYD"
FT   gene            complement(686454..687299)
FT                   /locus_tag="SPAP_0717"
FT   CDS_pept        complement(686454..687299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0717"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 323 Gene 3 COG1307 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84310"
FT                   /protein_id="ADM84310.1"
FT                   /translation="MTWKIIADSGCDYRQLPTPAINTTFVSVPLTIQVADQVFVDDASL
FT                   DIDQMMETMYATAEASKSACPSPDDYLRAFEGAENIFLVTITGTLSGSHYSAQLAKNIY
FT                   LEDHPDTKIHVIDSLSAGGEVDLLVEKLNDLIDQGLSFEEVVEAITAYQEKTKLLFVLA
FT                   KVDNLVKNGRLSKLIGTVVGLLNIRMVGKASETGTLELLQKARGSKKSVQAAYDELVKA
FT                   GYAGGRIVMAQRNNEKCCQQLSERIRETFPQADIKILPTSGLCSFYAEEGGLLMGYEID
FT                   "
FT   gene            687424..687981
FT                   /locus_tag="SPAP_0718"
FT   CDS_pept        687424..687981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0718"
FT                   /product="Transcriptional regulator"
FT                   /note="Operon 324 Gene 1 COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84311"
FT                   /protein_id="ADM84311.1"
FT                   /translation="MSERRISEKSLENLRKSNQESNLLTREAIETALLQLLEKKELTKI
FT                   SISELVKRAGVSRAAFYRNYDSKEEILESVFKRTVHNIMEQLHHYDLKTDLYLVWVHLF
FT                   REARKEARVIQLALDYHLEKIFVQAMQEFLEKYHGKSKGVSSYLHSFWSSAIVSVLLKW
FT                   IKDGMKVPAEKIADLGLPFFKK"
FT   gene            688000..688467
FT                   /locus_tag="SPAP_0719"
FT   CDS_pept        688000..688467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0719"
FT                   /product="Deoxycytidylate deaminase"
FT                   /note="Operon 324 Gene 2 COG2131 Deoxycytidylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84312"
FT                   /protein_id="ADM84312.1"
FT                   /translation="MTEKRLAWDEYFAAQALLIANRSTCKRAKVGAILVKDNKVISTGY
FT                   NGSVSGTEHCIDHECLVIEGHCVRTLHAEVNAILQGAERGVPKGFTAYVTHFPCLNCTK
FT                   QLLQVGCKRVVYINQYRMDDYAQYLYQEKGTELTHLPLETVQTALKEADLM"
FT   gene            688556..689185
FT                   /locus_tag="SPAP_0720"
FT   CDS_pept        688556..689185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0720"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /note="Operon 324 Gene 3 COG0035 Uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84313"
FT                   /protein_id="ADM84313.1"
FT                   /translation="MGKIEVINHPLIQHKLSILRRTDTSTKAFRELVDEIAMLMGYEVL
FT                   RDLPLEDVEIETPITKTVQKQLAGKKLAIVPILRAGIGMVDGLLSLVPAAKVGHIGMYR
FT                   DEETLQPVEYLVKLPEDIDQRQIFVVDPMLATGGSAILAVDSLKKRGASNIKFVCLVSA
FT                   PEGVKALQEAHPDVEIFTAALDERLNEHGYIVPGLGDAGDRLFGTK"
FT   gene            689359..689949
FT                   /locus_tag="SPAP_0721"
FT   CDS_pept        689359..689949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0721"
FT                   /product="Protease subunit of ATP-dependent Clp proteases"
FT                   /note="Operon 325 Gene 1 COG0740 Protease subunit of
FT                   ATP-dependent Clp proteases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84314"
FT                   /protein_id="ADM84314.1"
FT                   /translation="MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQ
FT                   LLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDTMNFIKADVQTIVMGMAASMGTVIASS
FT                   GAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRNTLEKILAENSGQSME
FT                   KVHADAERDNWMSAQETLEYGFIDEIMANNSLN"
FT   gene            690028..690276
FT                   /locus_tag="SPAP_0722"
FT   CDS_pept        690028..690276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0722"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 325 Gene 2 COG4471 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84315"
FT                   /protein_id="ADM84315.1"
FT                   /translation="MFEKVNRSGLIIYLYYNRDAKKLQDYGDITYHSKKHRYLQLYVPT
FT                   QEVEQLVGRLSKEKFIKKVRVCHIQELETPFVGNLYR"
FT   gene            690377..691537
FT                   /locus_tag="SPAP_0723"
FT   CDS_pept        690377..691537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0723"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component"
FT                   /note="Operon 326 Gene 1 COG0683 ABC-type branched-chain
FT                   amino acid transport systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84316"
FT                   /protein_id="ADM84316.1"
FT                   /translation="MKKKFALSFVALASVALLAACGEVKSGAVNTAGNSVEEKTIKIGF
FT                   NFEESGSLAAYGTAEQKGAQLAVDEINAAGGIDGKQIEVVDKDNKSETAEAASVTTNLV
FT                   TQSKVSAVVGPATSGATAAAVANATKAGVPLISPSATQDGLTKGQDYLFIGTFQDSFQG
FT                   KIISNYVSEKLNAKKVVLYTDNASDYAKGIAKSFRESYKGEIVADETFVAGDTDFQAAL
FT                   TKMKGKDFDAIVVPGYYNEAGKIVNQARGMGIDKPIVGGDGFNGEEFVQQATAEKASNI
FT                   YFISGFSTTVEVSAKAKAFLDAYRAKYNEEPSTFAALAYDSVHLVANAAKGAKNSGEIK
FT                   NNLAKTKDFEGVTGQTSFDADHNTVKTAYMMTMNNGKVEAAEVVKP"
FT   gene            691805..692674
FT                   /locus_tag="SPAP_0724"
FT   CDS_pept        691805..692674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0724"
FT                   /product="Branched-chain amino acid ABC-type transport
FT                   system, permease component"
FT                   /note="Operon 326 Gene 2 COG0559 Branched-chain amino acid
FT                   ABC-type transport system, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84317"
FT                   /protein_id="ADM84317.1"
FT                   /translation="MLQQLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDIYMMGAF
FT                   IGYFLINSFQMNFFVALIVAMLVTAILGVVIEFLAYRPLRHSTRIAVLITAIGVSFLLE
FT                   YGMVYLVGANTRAFPQAIQTVRYDLGPISLTNVQLMILAISLILMILLQVIVQKTKMGK
FT                   AMRAVSVDSDAAQLMGINVNRTISFTFALGSALAGAAGVLIALYYNSLEPLMGVTPGLK
FT                   SFVAAVLGGIGIIPGAALGGFVIGLLETFATAFGMSDFRDAIVYGILLLILIVRPAGIL
FT                   GKNVKEKV"
FT   gene            692678..693634
FT                   /locus_tag="SPAP_0725"
FT   CDS_pept        692678..693634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0725"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   system, permease component"
FT                   /note="Operon 326 Gene 3 COG4177 ABC-type branched-chain
FT                   amino acid transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84318"
FT                   /protein_id="ADM84318.1"
FT                   /translation="MKENLKVNILWLLLLLAGYSLISVLVSVGVLNLFYVQILQQIGIN
FT                   IILAVGLNLIVGFSGQFSLGHAGFMAIGAYAAAIIGSKSPTYGAFFGAMLVGALLSGAV
FT                   ALLVGIPTLRLKGDYLAVATLGVSEIIRIFIINGGSLTNGAAGILGIPNFTTWQMVYFF
FT                   VVITTIATLNFLRSPIGRSTLSVREDEIAAESVGVNTTKIKIIAFVFGAITASIAGSLQ
FT                   AGFIGSVVPKDYTFINSINVLIIVVFGGLGSITGAIVSAIVLGILNMLLQDVASVRMII
FT                   YALALVLVMIFRPGGLLGTWELSLSRFFKKSKKEEQN"
FT   gene            693634..694398
FT                   /locus_tag="SPAP_0726"
FT   CDS_pept        693634..694398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0726"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component"
FT                   /note="Operon 326 Gene 4 COG0411 ABC-type branched-chain
FT                   amino acid transport systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84319"
FT                   /protein_id="ADM84319.1"
FT                   /translation="MALLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTL
FT                   FNLLTGVYEPSEGTVTLDGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFG
FT                   NHHKQHVFTSFLRLPAFYKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIV
FT                   RALATEPKILFLDEPAAGMNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERI
FT                   YVLEYGRLIAQGTPDEIKTNKRVIEAYLGGEA"
FT   gene            694398..695108
FT                   /locus_tag="SPAP_0727"
FT   CDS_pept        694398..695108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0727"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component"
FT                   /note="Operon 326 Gene 5 COG0410 ABC-type branched-chain
FT                   amino acid transport systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84320"
FT                   /protein_id="ADM84320.1"
FT                   /translation="MSMLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTI
FT                   LRTLSGLVRPSSGKIEFLGQEIQKMPAQKIVASGLSQVPEGRHVFPGLTVMENLEMGAF
FT                   LKKNREENQANLKKVFSRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEP
FT                   SMGLAPIFIQEIFDIIQDIQKQGTTVLLIEQNANKALAISDRGYVLETGRIVLSGTGKE
FT                   LASSEEVRKAYLGG"
FT   gene            695416..696072
FT                   /locus_tag="SPAP_0728"
FT   CDS_pept        695416..696072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0728"
FT                   /product="CBS domain protein"
FT                   /note="Operon 327 Gene 1 COG0517 FOG: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84321"
FT                   /protein_id="ADM84321.1"
FT                   /translation="MAVKDFMTRKVVYISPDTTVSHAADLMREQGLHRLPVIENDQLVG
FT                   LVTEGTIAQASPSKATSLSIYEMNYLLNKTKVKDVMIRDVVTVSGYASLEDATYLMLKN
FT                   KISILPVVDNHQVYGVITDRDVFQAFLEIAGYGEEGIRVRFVTEDEVGVLGKIVSLIVE
FT                   ENLNISHTVNIPRKDGKVIIEVQIDGSIDLPALKEKFEANGIQVEEIARTSAKVL"
FT   gene            696286..697275
FT                   /locus_tag="SPAP_0729"
FT   CDS_pept        696286..697275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0729"
FT                   /product="Protein chain release factor B"
FT                   /note="Operon 328 Gene 1 COG1186 Protein chain release
FT                   factor B"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84322"
FT                   /protein_id="ADM84322.1"
FT                   /translation="MENKMTEPDFWNDNIAAQKTSQELNELKNTYNTFHKMEELQDEVE
FT                   ILLDFLAEDESVHDELVAQLAELDKIMTSYEMTLLLSEPYDHNNAILEIHPGSGGTEAQ
FT                   DWGDMLLRMYTRYGNAKGFKVEVLDYQAGDEAGIKSVTLSFEGPNAYGLLKSEMGVHRL
FT                   VRISPFDSAKRRHTSFTSVEVMPELDDTIEVEIREDDIKMDTFRSGGAGGQNVNKVSTG
FT                   VRLTHIPTGIVVQSTVDRTQYGNRDRAMKMLQAKLYQMEQDKKAAEVDSLKGEKKEITW
FT                   GSQIRSYVFTPYTMVKDHRTSFEVAQVDKVMDGDLDGFIDAYLKWRIS"
FT   gene            697293..697985
FT                   /locus_tag="SPAP_0730"
FT   CDS_pept        697293..697985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0730"
FT                   /product="Predicted ATPase involved in cell division"
FT                   /note="Operon 328 Gene 2 COG2884 Predicted ATPase involved
FT                   in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84323"
FT                   /protein_id="ADM84323.1"
FT                   /translation="MSIIEMRDVVKKYDNGTTALRGVSVSVQPGEFAYIVGPSGAGKST
FT                   FIRSLYREVKIDKGSLSVAGFNLVKIKKKDVPLLRRSVGVVFQDYKLLPKKTVYENIAY
FT                   AMEVIGENRRNIKKRVMEVLDLVGLKHKVRSFPNELSGGEQQRIAIARAIVNNPKVLIA
FT                   DEPTGNLDPDNSWEIMNLLERINLQGTTILMATHNSQIVNTLRHRVIAIENGRVVRDES
FT                   KGEYGYDD"
FT   gene            697978..698904
FT                   /locus_tag="SPAP_0731"
FT   CDS_pept        697978..698904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0731"
FT                   /product="Cell division protein"
FT                   /note="Operon 328 Gene 3 COG2177 Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84324"
FT                   /protein_id="ADM84324.1"
FT                   /translation="MISRFFRHLFEALKSLKRNGWMTVAAVSSVMITLTLVAIFASVIF
FT                   NTAKLATDIENNVRVVVYIRKDVEDNSQTIEKEGQTVTNNDYHKVYDSLKNMSTVKSVT
FT                   FSSKEEQYEKLTEIMGDNWKIFEGDANPLYDAYIVEANAPNDVKTIAEDAKKIEGVSEV
FT                   QDGGANTERLFKLASFIRVWGLGIAALLIFIAVFLISNTIRITIISRSREIQIMRLVGA
FT                   KNSYIRGPFLLEGAFIGLLGAIAPSVLVFIVYQIVYQSVNKSLVGQNLSMISPDLFSPL
FT                   MIALLFVIGVFIGSLGSGISMRRFLKI"
FT   gene            698973..699068
FT                   /locus_tag="SPAP_0732"
FT   CDS_pept        698973..699068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0732"
FT                   /product="hypothetical protein"
FT                   /note="Operon 329 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84325"
FT                   /protein_id="ADM84325.1"
FT                   /translation="MRRRKELPKKSPREDFLMANLNLKFGALEIF"
FT   gene            699190..701370
FT                   /locus_tag="SPAP_0733"
FT   CDS_pept        699190..701370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0733"
FT                   /product="Phosphotransferase system IIC component,
FT                   glucose/maltose/N-acetylglucosamine-specific"
FT                   /note="Operon 330 Gene 1 COG1263 Phosphotransferase system
FT                   IIC components,
FT                   glucose/maltose/N-acetylglucosamine-specific"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84326"
FT                   /protein_id="ADM84326.1"
FT                   /translation="MMKDTFKNVLSFEFWQKFGKALMVVIAVMPAAGLMISIGKSIVMI
FT                   NPTFTPLVITGGILEQIGWGVIGNLHILFALAIGGSWAKERAGGAFAAGLAFILINRIT
FT                   GTIFGVSGDMLKNPDAMVTTFFGGSIKVADYFISVLEAPALNMGVFVGIISGFVGATAY
FT                   NKYYNFRKLPDALSFFNGKRFVPFVVILRSAIAAILLAAFWPVVQTGINNFGIWIANSQ
FT                   ETAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGAAKGTQVFGQDPLW
FT                   LAWVTDLVNLKGTDASQYQHLLDTVHPARFKVGQMIGSFGILMGVIVAIYRNVDADKKH
FT                   KYKGMMIATALATFLTGVTEPIEYMFMFIATPMYLVYSLVQGAAFAMADVVNLRMHSFG
FT                   SIEFLTRTPIAISAGIGMDIVNFVWVTVLFAVIMYFIANFMIQKFNYATPGRNGNYETA
FT                   EGSEETSSEVKVAAGSQAVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKA
FT                   EGAMGLVMKGQGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEAQQNTVHFKDL
FT                   TEEVYSVADGQVVALEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAF
FT                   GIVTEAGLEVLVHIGLDTVSLEGKPFTVHVAEGQKVAAGDLLVTADLDAIRAAGRETST
FT                   VVVFTNGDAIKSVKLEKTGSLAAKTAVAKVEL"
FT   gene            701422..702237
FT                   /locus_tag="SPAP_0734"
FT   CDS_pept        701422..702237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0734"
FT                   /product="Metal-dependent hydrolase"
FT                   /note="Operon 330 Gene 2 COG3568 Metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84327"
FT                   /protein_id="ADM84327.1"
FT                   /translation="MKFLTLNTHSWMEKEAEEKFQILLEDILEKDYDLICFQEINQEMT
FT                   SSEVEVNDLYQALPAAEPIHQDHYVRLLVEKLLEQGKNYYWTWAYNHIGYDRYHEGVAI
FT                   LSKTPIEAREILVSDVDDPTDYHTRRVALAETVVDGKELAVASVHLSWWDKGFQEEWAR
FT                   FEAVLKKLNKPLLLAGDFNNPAGQEGYQAILASPLGLQDAFEVAQEKSGSYTVPPEIDG
FT                   WKGNTEPLRIDYVFTTKELAVENLHVVFDGNKSPQVSDHYGLNAMLNWK"
FT   gene            702377..703720
FT                   /locus_tag="SPAP_0735"
FT   CDS_pept        702377..703720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0735"
FT                   /product="Superfamily II DNA and RNA helicase"
FT                   /note="Operon 331 Gene 1 COG0513 Superfamily II DNA and RNA
FT                   helicases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84328"
FT                   /protein_id="ADM84328.1"
FT                   /translation="MSFTKFQFKNYIREALKELKFTTPTEVQDKLIPIVLAGRDLVGES
FT                   KTGSGKTHTFLLPIFQQLDEASDSVQAVITAPSRELATQIYQVARQISAHSDVEVRVVN
FT                   YVGGTDKARQIEKLASNQPHIVIGTPGRIYDLVKSGDLAIHKAKTFVVDEADMTLDMGF
FT                   LETVDKIAGSLPKDLQFMVFSATIPQKLQPFLKKYLSNPVMEKIKTKTVISDTIDNWLI
FT                   STKGHDKNAQIYQLTQLMQPYLAMIFVNTKTRADELHSYLTAQGLKVAKIHGDIAPRER
FT                   KRIMNQVQNLDFEYIVATDLAARGIDIEGVSHVINDAIPQDLSFFVHRVGRTGRNGLPG
FT                   TAITLYQPSDDSDIRELEKLEIKFSPKMVKDGEFQDTYDRDRRANREKKQDKLDIEMIG
FT                   LVKKKKKKVKPGYKKKIQWAVDEKRRKTKRAENRARGRAERKAKRQTF"
FT   gene            703935..705125
FT                   /locus_tag="SPAP_0736"
FT   CDS_pept        703935..705125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0736"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /note="Operon 332 Gene 1 COG0192 S-adenosylmethionine
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84329"
FT                   /protein_id="ADM84329.1"
FT                   /translation="MSERKLFTSESVSEGHPDKIADQISDAILDAILAKDPEAHVAAET
FT                   AVYTGSVHVFGEISTNAYVDINRVVRDTIAEIGYTNTEYGFSAETVGVHPSLVEQSPDI
FT                   AQGVNEALEVRGNADQDPLDLIGAGDQGLMFGFAVDETEELMPLPIALSHKLVRRLAEL
FT                   RKSGEISYLRPDAKSQVTVEYDENDRPVRVDTVVISTQHDPEATNEQIHQDVIDKVIKE
FT                   VIPSSYLDDKTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDAT
FT                   KVDRSASYAARYIAKNIVAADLAKKAEVQLAYAIGVAQPVSVRIDTFGTGTVAESQLEK
FT                   AARQIFDLRPAGIIQMLDLKRPIYRQTSAYGHMGRTDIDLPWERLDKVDALKEAVK"
FT   gene            705678..706613
FT                   /locus_tag="SPAP_0737"
FT   CDS_pept        705678..706613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0737"
FT                   /product="Dihydroorotate dehydrogenase"
FT                   /note="Operon 333 Gene 1 COG0167 Dihydroorotate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84330"
FT                   /protein_id="ADM84330.1"
FT                   /translation="MVSTKTQIAGFEFDNCLMNAAGVACMTIEELEEVKNSAAGTFVTK
FT                   TATLDFRQGNPEPRYQDVPLGSINSMGLPNNGLDYYLDYLLDLQEKESNRTFFLSLVGM
FT                   SPEETHTILKKVQESDFRGLTELNLSCPNVPGKPQIAYDFETTDRILAEVFAYFTKPLG
FT                   IKLPPYFDIVHFDQAAAIFNKYPLKFVNCVNSIGNGLYIEDESVVIRPKNGFGGIGGEY
FT                   IKPTALANVHAFYQRLNPQIQIIGTGGVLTGRDAFEHILCGASMVQVGTTLHKEGVSAF
FT                   DRITNELKAIMVEKGYESLEDFRGKLRYID"
FT   gene            706647..707684
FT                   /locus_tag="SPAP_0738"
FT   CDS_pept        706647..707684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0738"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /note="Operon 333 Gene 2 COG1466 DNA polymerase III, delta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84331"
FT                   /protein_id="ADM84331.1"
FT                   /translation="MLAIEESQKLTLSNLPSLSLFTGTDQGQFEVMKSQVLKQIGYDSA
FT                   DLNFAYFDMKEVVYKDVELELVSLPFFADEKIVILDYFMDITTAKKRFLTDDELKSFEE
FT                   YLDNPSPTTKLIIFAEGKLDSKRRLVKLLKRDAKVFDAVEVKEQELRQYFQKWSQKQGL
FT                   QFTNHSFENLLIKSGFQFSEIQKNLLFLQSYKADSVIEEEDIVNAIPKTLQDNIFDLTQ
FT                   FILTKKMDQARDLVRDLTLQGEDEIKLIAVMLGQFRTFTQVKILAESGQTESQIASSLG
FT                   SYLGRNPNPYQIKFALRDSRGLSLSFLKQAISYLIETDYQIKTGLYEKGFLFEKALLQI
FT                   ASQVN"
FT   gene            707857..708462
FT                   /locus_tag="SPAP_0739"
FT   CDS_pept        707857..708462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0739"
FT                   /product="hypothetical protein"
FT                   /note="Operon 334 Gene 1 protein supported
FT                   gi|15900660|ref|NP_345264.1| superoxide dismutase,
FT                   manganese-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84332"
FT                   /protein_id="ADM84332.1"
FT                   /translation="MAIILPELPYAYDALEPYIDAETMHLHHDKHHQTYVNNANAALEK
FT                   HPEIGEDLEALLADVESIPADIRQALINNGGGHLNHALFWELMTPEKTAPSAELAAAID
FT                   ATFGSFEEFQAAFTAAATTRFGSGWAWLVVNKEGKLEVTSTANQDTPISEGKKPILGLD
FT                   VWEHAYYVKYRNVRPDYIKAFFSVINWNKVDELYAAAK"
FT   gene            708619..709149
FT                   /locus_tag="SPAP_0740"
FT   CDS_pept        708619..709149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0740"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 335 Gene 1 COG4470 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84333"
FT                   /protein_id="ADM84333.1"
FT                   /translation="MRKEIAPELYNYNKFPGPEFHLHGDKVETEGIAFSLVENIKDAFD
FT                   VTTFNQRFSEVLTKFDYIVGDWSNEQLRLRGFYKDDRTEEKLEKISRLQDYLLEYCSYG
FT                   CAYFVLENEAPKRASFDKKMRKTEEETPSRKGKKPTQTKRKSNADKKNRRRQKDQHSQK
FT                   EDKEQRHFVIRQK"
FT   gene            709170..710255
FT                   /locus_tag="SPAP_0741"
FT   CDS_pept        709170..710255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0741"
FT                   /product="Predicted Fe-S-cluster redox enzyme"
FT                   /note="Operon 335 Gene 2 COG0820 Predicted Fe-S-cluster
FT                   redox enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84334"
FT                   /protein_id="ADM84334.1"
FT                   /translation="MKPSIHSLAHQTMQEWVLEQGEKKFRADQIWEWLYRKRVQSFEEM
FT                   TNLSKDLIAKLNDQFVVNPLKQRIVQESADGTVKYLFELPDGMLIETVLMCQHYGLSVC
FT                   VTTQVGCNIGCTFCSSGLIKKQRDLNNGEIVAQIMLVQKYFDERGQDERVSHIVVMGIG
FT                   EPFDNYNNVLNFFRTINDDKGMAIGARHITVSTSGLAHKIRDFADEGVQVNLAVSLHAP
FT                   NNELRSSIMKINRAFPIEKLFAAIEYYIETTNRRVTFEYIMLNEVNDGVEQALELTELL
FT                   KNIKKLSYVNLIPYNPVSEHDQYSRSPKERVLAFYDTLKKKGVNCVVRQEHGTDIDAAC
FT                   GQLRSNTMKRDRQKAVAAVNP"
FT   gene            710255..710737
FT                   /locus_tag="SPAP_0742"
FT   CDS_pept        710255..710737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0742"
FT                   /product="Glycopeptide antibiotics resistance protein"
FT                   /note="Operon 335 Gene 3 COG4767 Glycopeptide antibiotics
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84335"
FT                   /protein_id="ADM84335.1"
FT                   /translation="MVKKTYNHILVWGVIFYSICIVCFCFTPQEQSTVGVGTPGIQHLG
FT                   RLVFLLTPFNSLWKLGEVSDIGQLCWIFLQNILNVFLFFPLIFQLLYLFPNLRKTKKVL
FT                   LFSFLVSLGIECTQLILDFFFDFNRVFEIDDLWTNTLGGYLAWLLYKRLHKNKVRN"
FT   gene            710739..712280
FT                   /locus_tag="SPAP_0743"
FT   CDS_pept        710739..712280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0743"
FT                   /product="ATPase component of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /note="Operon 335 Gene 4 COG0488 ATPase components of ABC
FT                   transporters with duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84336"
FT                   /protein_id="ADM84336.1"
FT                   /translation="MSILEVKNLSHGFGDRAIFEDVSFRLLKGEHIGLVGANGEGKSTF
FT                   MSIVTGKMLPDEGKVEWSKYVTAGYLDQHSVLAERQSVRDVLRTAFDELFKAEARINDL
FT                   YMKMAEDGADVDALMEEVGELQDRLESRDFYTLDAKIDEVARALGIMDFGMDTDVTSLS
FT                   GGQRTKVLLAKLLLEKPDILLLDEPTNYLDAEHIDWLKRYLQNYENAFVLISHDIPFLN
FT                   DVINIVYHVENQQLTRYSGDYYQFQEVYAMKKSQLEAAYERQQKEIADLKDFVARNKAR
FT                   VATRNMAMSRQKKLDKMDIIELQSEKPKPSFDFKPARTPGRFIFQAKNLQIGYDRPLTK
FT                   PLNLTFERNQKVAIIGANGIGKTTLLKSLLGIISPIAGEVERGDYLELGYFEQEVEGGN
FT                   RQTPLEAVWNAFPALNQAEVRAALARCGLTTKHIESQIQVLSGGEQAKVRFCLLMNREN
FT                   NVLVLDEPTNHLDVDAKDELKRALKEYRGSILMVCHDPDFYEGWIDQIWDFNNLT"
FT   gene            712446..713474
FT                   /locus_tag="SPAP_0744"
FT   CDS_pept        712446..713474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0744"
FT                   /product="Transposase-like protein, IS1380 ISSpn5"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84337"
FT                   /protein_id="ADM84337.1"
FT                   /translation="MNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQELFSQLKLKER
FT                   ISKYLVTNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQLAS
FT                   QPTLSRFLSRTDEETVHSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEGVAY
FT                   NAHYRAHGYHPLYAFEGKTGYCFNAQLRPGNRYCSEEADSFITPVLERFNQLLFRMDSG
FT                   FATPKLYDLIEKTGQYYLIKLKKNTVLSRLGDLSLPCPQDEDLTILPHSAYSETLYQAG
FT                   SWSHKRRVCQFSERKERKLVLRCYFSRYKYDEWNKPRPVSALSWSGQPRFHQGDEGGIF
FT                   WR"
FT   gene            713344..713790
FT                   /locus_tag="SPAP_0745"
FT   CDS_pept        713344..713790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0745"
FT                   /product="Transposase-like protein, IS1380 ISSpn5"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84338"
FT                   /protein_id="ADM84338.1"
FT                   /translation="MFYDVISLVTNMTSGTSQDQFQLYRGVVSRDFIKEMKEGFFGDKT
FT                   DSSTLIKNEVRMMMSCIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLHVVGKCVRTGRKQ
FT                   LLKLSSLYAYSELFSALYSRIRKVNLNLPVPYEPPRRKASLMMH"
FT   gene            complement(714042..714845)
FT                   /locus_tag="SPAP_0746"
FT   CDS_pept        complement(714042..714845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0746"
FT                   /product="Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)-cyclophilin family"
FT                   /note="Operon 337 Gene 1 COG0652 Peptidyl-prolyl cis-trans
FT                   isomerase (rotamase) - cyclophilin family"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84339"
FT                   /protein_id="ADM84339.1"
FT                   /translation="MKKLATLLLLSTVALAGCSSVQRSLRGDDYVDSSLAAEESSKVAA
FT                   QSAKELNDALTNENANFPQLSKEVAEDEAEVILHTSQGDIRIKLFPKLAPLAVENFLTH
FT                   AKEGYYNGITFHRVIDGFMVQTGDPKGDGTGGQSIWHDKDKTKDKGTGFKNEITPYLYN
FT                   IRGALAMANTGQPNTNGSQFFINQNSTDTSSKLPTSKYPQKIIEAYKEGGNPSLDGKHP
FT                   VFGQVIGGMDVVDKIAKAEKDEKDKPTTAITIDSIEVVKDYDFKS"
FT   gene            complement(714959..715150)
FT                   /locus_tag="SPAP_0747"
FT   CDS_pept        complement(714959..715150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0747"
FT                   /product="hypothetical protein"
FT                   /note="Operon 338 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84340"
FT                   /protein_id="ADM84340.1"
FT                   /translation="MSFYGLFYNGIAITPNTYLSAWFVNFIAALPLNFLIVEPIARFIL
FT                   SSFQKPFTGEEVEEVEDF"
FT   gene            complement(715629..715838)
FT                   /locus_tag="SPAP_0748"
FT   CDS_pept        complement(715629..715838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0748"
FT                   /product="hypothetical protein"
FT                   /note="Operon 339 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84341"
FT                   /protein_id="ADM84341.1"
FT                   /translation="MLSVNTILEKFYKEHQVKPFISPERDLDTWLLSPKPVPKRNMDLL
FT                   VDDSLAGDIILLWRIQFGTFTTET"
FT   gene            716008..716280
FT                   /locus_tag="SPAP_0749"
FT   CDS_pept        716008..716280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0749"
FT                   /product="hypothetical protein"
FT                   /note="Operon 340 Gene 1 protein supported
FT                   gi|148997148|ref|ZP_01824802.1| ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84342"
FT                   /protein_id="ADM84342.1"
FT                   /translation="MAVKIRLTRMGSKKKPFYRINVADSRSPRDGRFIETVGTYNPLVA
FT                   ENQVTLKEDRVLTWLANGAQPSDTVRNILSKEGVLKKFHDSKFSK"
FT   gene            716300..716539
FT                   /locus_tag="SPAP_0750"
FT   CDS_pept        716300..716539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0750"
FT                   /product="Predicted RNA-binding protein (contains KH
FT                   domain)"
FT                   /note="Operon 340 Gene 2 COG1837 Predicted RNA-binding
FT                   protein (contains KH domain)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84343"
FT                   /protein_id="ADM84343.1"
FT                   /translation="MDTIENLIIAIVKPLISQPDALTIKIEDTPEFLEYHLNLDQSDVG
FT                   RVIGRKGRTISAIRTIVYSVPTEYKKVRIVIDEK"
FT   gene            717116..717904
FT                   /locus_tag="SPAP_0751"
FT   CDS_pept        717116..717904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0751"
FT                   /product="hypothetical protein"
FT                   /note="Operon 341 Gene 1 protein supported
FT                   gi|149007659|ref|ZP_01831276.1| 30S ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84344"
FT                   /protein_id="ADM84344.1"
FT                   /translation="MKRFEVSTEIGSLSVAYQKQKKVLVCLNGAGLLPSYENFSLILEK
FT                   PPPTIGYLTIDFPNTGRSPIYDQAGKNLDNLADVVYEALEELGISEYILCVHSWSGILA
FT                   CKLLEKPIKCQTLVAIEPTTKKVMFADFSENPYPEMEEQMRLIDECGPELYFKNLTQAT
FT                   FSPETNKKIWELMQEKGLELENQDPEFQISGEITEEDFENLSIESHVPIFIFCQTYREK
FT                   EYRESEYWTSNTKLILGGNHHYLQWSESEKIAAIIRELSE"
FT   gene            717935..718060
FT                   /locus_tag="SPAP_0752"
FT   CDS_pept        717935..718060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0752"
FT                   /product="RimM protein, required for 16S rRNA processing"
FT                   /note="Operon 341 Gene 2 COG0806 RimM protein, required for
FT                   16S rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84345"
FT                   /protein_id="ADM84345.1"
FT                   /translation="MNYFNVGKIVNTQGLQGEMRVLSVTDFAEERFKKGAELAFV"
FT   gene            718053..718454
FT                   /locus_tag="SPAP_0753"
FT   CDS_pept        718053..718454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0753"
FT                   /product="RimM protein, required for 16S rRNA processing"
FT                   /note="Operon 341 Gene 3 COG0806 RimM protein, required for
FT                   16S rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84346"
FT                   /protein_id="ADM84346.1"
FT                   /translation="MFDEKDQFVQTVTIASHRKQKNFDIIKFKDMYHINTIEKYKGYSL
FT                   KVAEEDLNDLDDGEFYYHEIIGLEVYEGDSLVGTIKEILQPGANDVWVVKRKGKRDLLL
FT                   PYIPPVVLNVDIPNKRVDVEILEGLDDED"
FT   gene            718444..719163
FT                   /locus_tag="SPAP_0754"
FT   CDS_pept        718444..719163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0754"
FT                   /product="tRNA-(guanine-N1)-methyltransferase"
FT                   /note="Operon 341 Gene 4 COG0336
FT                   tRNA-(guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84347"
FT                   /protein_id="ADM84347.1"
FT                   /translation="MKIDILTLFPEMFSPLEHSIVGKAREKGLLDIQYHNFRENAEKAR
FT                   HVDDEPYGGGQGMLLRAQPIFDSFDAIEKKNPRVILLDPAGKQFDQAYAEDLAQEEELI
FT                   FICGHYEGYDERIKTLVTDEISLGDYVLTGGELAAMTMIDATVRLIPEVIGKESSHQDD
FT                   SFSSGLLEYPQYTRPYDYRGMVVPDVLMSGHHEKIRQWRLYESLKKTYERRPDLLEHYQ
FT                   LTVEEEKMLAEIKENKE"
FT   gene            719175..719513
FT                   /locus_tag="SPAP_0755"
FT   CDS_pept        719175..719513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0755"
FT                   /product="Oxygen-sensitive ribonucleoside-triphosphate
FT                   reductase"
FT                   /note="Operon 341 Gene 5 COG1328 Oxygen-sensitive
FT                   ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84348"
FT                   /protein_id="ADM84348.1"
FT                   /translation="MQVIKRNGEIAEFNPDKIYQAILKAAQTVYVLTDDLRQNLAQVTK
FT                   KVVLDLQEAKVERATISMIQSMVEHRLLGAGYITIAEHYISYRLQRDLERSGYGDHIAV
FT                   HLHFEQIR"
FT   gene            complement(719543..719863)
FT                   /locus_tag="SPAP_0756"
FT   CDS_pept        complement(719543..719863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0756"
FT                   /product="hypothetical protein"
FT                   /note="Operon 342 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84349"
FT                   /protein_id="ADM84349.1"
FT                   /translation="MRHKFQQVLDKIHDFLNGHDQPDQTETNSLTATIEEAIQKQTAVH
FT                   LILSETSFTGDIIKYDQQGQQIIVKNFSKNVSRIIRISDIQRLRFVPSTVQTAQKNRFK
FT                   KE"
FT   gene            719961..720176
FT                   /locus_tag="SPAP_0757"
FT   CDS_pept        719961..720176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0757"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 343 Gene 1 COG4443 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84350"
FT                   /protein_id="ADM84350.1"
FT                   /translation="MAEFTFEIEEHLLTLSENEKGWTKEINRVSFNGAPAKFDIRAWSP
FT                   DHTKMGKGITLSNEEFQTMVDAFKGN"
FT   gene            complement(720380..720916)
FT                   /locus_tag="SPAP_0758"
FT   CDS_pept        complement(720380..720916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0758"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="Operon 344 Gene 1 COG1268 Uncharacterized conserved
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84351"
FT                   /protein_id="ADM84351.1"
FT                   /translation="MKKAHVYAIPAIGAALIAVLAQISLPIGPVPFTLQNFAIGLIATV
FT                   FRPREAVLSAGLYLLLGAIGLPVFAGGGAGFQALVGPTAGYLWFYLVYSGLTSSLTNSK
FT                   SGVVKIFLANLLGDALVFVGGILSLHFLAGMAFEKALVVGVLPFIIPDLGKLLAISFIS
FT                   RPLLQRLKNQTYFTN"
FT   gene            complement(721112..722458)
FT                   /locus_tag="SPAP_0759"
FT   CDS_pept        complement(721112..722458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0759"
FT                   /product="Pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dihydrolipoamide dehydrogenase (E3) component,-like enzyme"
FT                   /note="Operon 345 Gene 1 COG1249 Pyruvate/2-oxoglutarate
FT                   dehydrogenase complex, dihydrolipoamide dehydrogenase (E3)
FT                   component, and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84352"
FT                   /protein_id="ADM84352.1"
FT                   /translation="MREYDIIAIGGGSGGIATMNRAGEHGAKAAVIEEKKLGGTCVNVG
FT                   CVPKKIMWYGAQIAETFHQFGEDYGFKTTDLNFNFATLRRNREAYIDRARSSYDGSFKR
FT                   NGVDLIEGHAEFVDSHTVSVNGELIRAKHIVIATGAHPSIPNIPGAELGGSSDDVFAWE
FT                   ELPESVAILGAGYIAVELAGVLHTFGVKTDLFVRRDRPLRGFDSYIVEGLVKEMERTNL
FT                   PLHTHKVPVKLEKTTDGITIHFEDGTSHTASQVIWATGRRPNVKGLQLEKAGVTLNERG
FT                   FIQVDEYQNTVVEGIYALGDVTGEKELTPVAIKAGRTLSERLFNGKTTAKMDYSTIPTV
FT                   VFSHPAIGTVGLTEEQAIKEYGQDQIKVYKSSFASMYSACTRNRQESRFKLITAGSEEK
FT                   VVGLHGIGYGVDEMIQGFAVAIKMGATKADFDATVAIHPTSSEEFVTMR"
FT   gene            722744..723943
FT                   /locus_tag="SPAP_0760"
FT   CDS_pept        722744..723943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0760"
FT                   /product="Membrane-fusion protein"
FT                   /note="Operon 346 Gene 1 COG0845 Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84353"
FT                   /protein_id="ADM84353.1"
FT                   /translation="MKKKNGKAKKWQLYAAIGAASVVVLGAGGILLFRQPSQTALKDEP
FT                   THLVVANEGSVASSVLLSGTVTAKNEQYVYFDASKGDLDEILVSVGDKVSEGQALVKYS
FT                   SSEAQAAYDSASRAVAKADRHINELNQARNEAASAQAPQLPAPVGGEDATVQSPTPVAG
FT                   NSVASIDAQLGDARDARADAAAQLSKAQSQLDATTVLSTLEGTVVEVNSNVSKSPTGAS
FT                   QVMVHIVSNENLQVKGELSEYNLANLSVGQEVSFTSKVYPDKKWTGKLSYISDYPKNNG
FT                   EAASPAAGNNTGSKYPYTIDVTGEVGDLKQGFSVNIEVKSKTKAILVPVSSLVMDDSKN
FT                   YVWIVDEQQKAKKVEVSLGNADAENQEITSGLTNGAKVISNPTSSLEEGKEVKADEATN
FT                   "
FT   gene            723927..724628
FT                   /locus_tag="SPAP_0761"
FT   CDS_pept        723927..724628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0761"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /note="Operon 346 Gene 2 COG1136 ABC-type antimicrobial
FT                   peptide transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84354"
FT                   /protein_id="ADM84354.1"
FT                   /translation="MKQLISLKNIFRSYRNGDQELQVLKNINLEVNEGEFVAIMGPSGS
FT                   GKSTLMNTIGMLDTPTSGEYYLEGQEVAGLGEKQLAKVRNQQIGFVFQQFFLLSKLNAL
FT                   QNVELPLIYAGVSSSKRRKLAEEYLDKVELTERSHHLPSELSGGQKQRVAIARALVNNP
FT                   SIILADEPTGALDTKTGNQIMQLLVDLNKEGKTIIMVTHEPEIAAYAKRQIVIRDGVIS
FT                   SDSAQLGKEEN"
FT   gene            724630..725889
FT                   /locus_tag="SPAP_0762"
FT   CDS_pept        724630..725889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0762"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /note="Operon 346 Gene 3 COG0577 ABC-type antimicrobial
FT                   peptide transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84355"
FT                   /protein_id="ADM84355.1"
FT                   /translation="MQNLKFAFSSIMAHKMRSLLTMIGIIIGVSSVVVIMALGDSLSRQ
FT                   VNKDMTKSQKNISVFFSPKKSKDGSFTQKQSAFTVSGKEEEVPVEPPKPQESWVQEAAK
FT                   LKGVDSYYVTNSTNAILTYQDKKVENANLTGGNRTYMDAVKNEIIAGRSLREQDFKEFA
FT                   SVILLDEELSISLFESPQEAINKVVEVNGFSYRVIGVYTSPEAKRSKIYGFGGLPITTN
FT                   ISLAANFNVDEIANIVFRVNDTSLTPTLGPELARKMTELAGLQQGEYQVADESVVFAEI
FT                   QQSFSFMTTIISSIAGISLFVGGTGVMNIMLVSVTERTREIGLRKALGATRANILIQFL
FT                   IESMILTLLGGLIGLTIASGLTALAGLLLQGLIEGIEVGVSIPVALFSLAVSASVGMIF
FT                   GVLPANKASKLDPIEALRYE"
FT   gene            726013..728010
FT                   /locus_tag="SPAP_0763"
FT   CDS_pept        726013..728010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0763"
FT                   /product="Methionyl-tRNA synthetase"
FT                   /note="Operon 347 Gene 1 COG0143 Methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84356"
FT                   /protein_id="ADM84356.1"
FT                   /translation="MSEKNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVF
FT                   YLTGLDEHGQKIQQKAEEAGITPQAYVDGMAVGVKELWQLLDISYDKFIRTTDDYHEKV
FT                   VAQVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVE
FT                   WVSEESYFLRLSKYQDRLVEFFKAHPEFITPDGRLNEMLRNFIEPGLEDLAVSRTTFTW
FT                   GVPVPSNPKHVVYVWIDALLNYATALGYAQDEHGNFDKFWNGTVFHMVGKDILRFHSIY
FT                   WPILLMMLDVKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRNL
FT                   PVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDHVLA
FT                   EVAEQSIADFHTHMEAVDYPRALEAVWTLISRTNKYIDETAPWVLAKDEALRDQLASVM
FT                   SHLAASIRVVAHLIEPFMMETSRAVLTQLGLEEVSSLENLSLADFPADVTVVAKGTPIF
FT                   PRLNMEEEIAYIKEQMEGNKPAVEKEWNPDEVELKLNKDEIKFEDFDKVEIRVAEVKEV
FT                   SKVEGSDKLLQFCLDAGDGEDRQILSGIAKYYPNEQELVGKKVQIVANLKPRKMMKKYV
FT                   SQGMILSAEHDGKLTLLTVDPAVPNGSVIG"
FT   gene            728060..728341
FT                   /locus_tag="SPAP_0764"
FT   CDS_pept        728060..728341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0764"
FT                   /product="hypothetical protein"
FT                   /note="Operon 347 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84357"
FT                   /protein_id="ADM84357.1"
FT                   /translation="MKIKEQTRKLAAGCSKHCFEVVDRTDEVSSKHVFEVVDETDEVSS
FT                   KHCFEVVDETDEVSSKHCFEVVDETDEVSNHTYGRATLTWFEEIFEEY"
FT   gene            728431..728751
FT                   /locus_tag="SPAP_0765"
FT   CDS_pept        728431..728751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0765"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="Operon 347 Gene 3 COG1695 Predicted transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84358"
FT                   /protein_id="ADM84358.1"
FT                   /translation="MKETQLLKGVLEGCVLDMIGQKERYGYELVQTLREAGFDTIVPGT
FT                   IYPLLQKLEKNQWIRGDMRPSPDGPDRKYFSLMKEGEERVSVFWQQWDDLSQKVEGIKN
FT                   GG"
FT   gene            728755..729570
FT                   /locus_tag="SPAP_0766"
FT   CDS_pept        728755..729570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0766"
FT                   /product="hypothetical protein"
FT                   /note="Operon 347 Gene 4 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84359"
FT                   /protein_id="ADM84359.1"
FT                   /translation="MKKMKYYEETSALLHEFSEENQKYFEELWESFNLAGFLYDEDYLR
FT                   EQIYLMMLDFSEAERDGMSAEDYLGKNPKKIMKEILKGAPRSSIKESLLTPILVLAVLR
FT                   YYQLLSDFSKGPLLTVNLLTFLGQLLIFLIGFGLVATILRRSLVQDSPKMKIGTYIVVG
FT                   TIVLLVVLGYVGMASFIQEGAFYIPAPWDSLSVFTISLVIGIWNWKEAVFRPFVSMIIA
FT                   HLVVGSLLRYYEWMGISNVFLTKVIPLAVLFIGIFVLFRGFKKIKWSEV"
FT   gene            729645..730571
FT                   /locus_tag="SPAP_0767"
FT   CDS_pept        729645..730571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0767"
FT                   /product="Predicted oxidoreductase"
FT                   /note="Operon 347 Gene 5 COG4989 Predicted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84360"
FT                   /protein_id="ADM84360.1"
FT                   /translation="MRYITLGQDDKELSEIVLGMMRIKDKSVKEVEELVETALSVGINA
FT                   FDLADIYGRGRCEELLGLVLKNRPDLREKMWIQSKCGIRIEEFTYFDFSKDYIIKSVDG
FT                   ILQRLKIDHLDSLLLHRPDALMESDQVAEAFDLLYKQGKVRDFGVSNQNPMMMELLKKD
FT                   VKQPLAVNQLQLSAAFTPGFESAFHVNMEDSQAAMRDGSIFEYCKLHDVVIQAWSVLQF
FT                   GYFKGNFVGNEKFQALNQVLDRLAIKYGVTSSTIAISWILRYPAKMQAVVGTTNPKHLR
FT                   EVSRAANFSLTRKEWYEIYLAAGNNLP"
FT   gene            730671..730907
FT                   /locus_tag="SPAP_0768"
FT   CDS_pept        730671..730907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0768"
FT                   /product="hypothetical protein"
FT                   /note="Operon 348 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84361"
FT                   /protein_id="ADM84361.1"
FT                   /translation="MTFEEILPGLKAKKKYVRTGWGGAENYVQLFDTIEQNGLALEVTP
FT                   YFLINVSGEGEGFSMWSPTACDVLATDWVEVHD"
FT   gene            730900..731598
FT                   /locus_tag="SPAP_0769"
FT   CDS_pept        730900..731598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0769"
FT                   /product="fehydrogenase"
FT                   /note="Operon 348 Gene 2 COG1028 Dehydrogenases with
FT                   different specificities (related to short-chain alcohol
FT                   dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84362"
FT                   /protein_id="ADM84362.1"
FT                   /translation="MTKRVLITGVSSGIGLAQARLFLEKGYQVYGVDQGEKPLLEGDFH
FT                   FLQRDLTLDLEPIFDWCPQVDVLCNTAGVLDDYKPLLEQTAQDIQEIFEINYIIPVELT
FT                   RYYLTQMLENKKGIIINMCSIASSLAGGGGHAYTSSKHALAGFTKQLALDYAEAGIQVF
FT                   GIAPGAVKTAMTAADFEPGGLADWVASETPIKRWIEPEEIAELSLFLASGKASAMQGQI
FT                   LTIDGGWSLK"
FT   gene            731609..732109
FT                   /locus_tag="SPAP_0770"
FT   CDS_pept        731609..732109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0770"
FT                   /product="NTP pyrophosphohydrolase including oxidative
FT                   damage repair enzymes"
FT                   /note="Operon 348 Gene 3 COG0494 NTP pyrophosphohydrolases
FT                   including oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84363"
FT                   /protein_id="ADM84363.1"
FT                   /translation="MEIKKHFGVYCVCFENGKLLCIEKTRGPYQHRYDLPGGSQQLGEG
FT                   LTETLTREVMEETRFTVRSYSNPRIYDVFVREELKNFMVHHVMALYDVEMNESAPQVTT
FT                   SEAVSDGANDSLGYIWMDIQEITEENASPLVLKVKSELLGFPELDKTSYMNWKVNDEKS
FT                   TCP"
FT   gene            732087..732956
FT                   /locus_tag="SPAP_0771"
FT   CDS_pept        732087..732956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0771"
FT                   /product="Phosphoenolpyruvate synthase/pyruvate phosphate
FT                   dikinase"
FT                   /note="Operon 348 Gene 4 COG0574 Phosphoenolpyruvate
FT                   synthase/pyruvate phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84364"
FT                   /protein_id="ADM84364.1"
FT                   /translation="MRNQLALSGEKILEKIYPQLFHHVGMIRGEYLLRELNQNIILASC
FT                   QQFVKDYLETICSLYSDEEVWYRFSELTNTEANCLVGTREFFDEGHPLFGYRGTRRLLA
FT                   CLDEFQAEAHVVTEVYQTNPNLSVIFPFVNDDDQLKQAITVLRQQGFTGKVGTMIELPS
FT                   AYFDLSSILETGISKIVVGMNDLTSFVFATMRNSQWHDMESPIMLDMLRDMQDKARKNK
FT                   IDFAVAGYLNTSFIQKMNQLGIKCIIHYSSIPEIFDLEIDHPDHLKHIKEESKKLQRST
FT                   HDTARNVE"
FT   gene            732931..733371
FT                   /locus_tag="SPAP_0772"
FT   CDS_pept        732931..733371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0772"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 348 Gene 5 COG4405 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84365"
FT                   /protein_id="ADM84365.1"
FT                   /translation="MIPQEMWNKYKQINPLIGDEIDAWAFGVEPDLLADLVFKGEKTAT
FT                   ASAYDLYVLEDEPLPQVGTFDIILDSQNQSVCIVEITKVSVELFNQVSAQHAFKEGEGD
FT                   KSLAYWRQVHEDFFTDCLGEVGLTFTSESKVVLEEFRKVYPL"
FT   gene            733494..736040
FT                   /locus_tag="SPAP_0773"
FT   CDS_pept        733494..736040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0773"
FT                   /product="Aminopeptidase N"
FT                   /note="Operon 349 Gene 1 COG0308 Aminopeptidase N"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84366"
FT                   /protein_id="ADM84366.1"
FT                   /translation="MQAVEHFIKQFVPEHYDLFLDLSRETKTFSGKVTITGKAQSDRIS
FT                   LHQKDLEITSVEVAGQARPFTVDHDNEALHIELAEAGQVELVLAFSGKITDNMTGIYPS
FT                   YYTVDGVKKEVLSTQFESHFAREAFPCVDEPEAKATFDLSLRFDQAEGELALSNMPEID
FT                   VENRKETGIWKFETTPRMSSYLLAFFAGDLQGVTAKTKNGTLVGVYSTKAHPLSNLDFS
FT                   LDIAVRSIEFYEDYYGVKYPIPQSLHIALPDFSAGAMENWGLVTYREVYLVVDENSTFA
FT                   SRQQVALVVAHELAHQWFGNLVTMKWWDDLWLNESFANMMEYVCVDTIEPSWNIFEDFQ
FT                   TGGVPLALERDATDGVQSVHVEVKHPDEINTLFDGAIVYAKGSRLMHMLRRWLGDADFA
FT                   KGLHAYFEKHQYSNTIGSDLWDALGQASGRDVAAFMDSWLEQPGYPVLTVKVENDVLKI
FT                   SQKQFFIGENEDKNRLWVVPLNSNWKGLPDTLETESIEIPGYAALLAENEGALRLNTEN
FT                   TAHYITDYQGDLLEAVLAELETLDNTSKLQIVQERRLLAEAGHISYADLLPVLDKLAKE
FT                   ESYLVVSAVSQVISALERFIDEGTDAETAFKGLVAKLARHNYDRLGFEAKDGESDEDEL
FT                   VRQLAVSMMIRSNDAEARQVASQIFATHKENLAELPAAIRSQVLINEMKHHETKDLLAL
FT                   YLDTYTHATDAVFKRQLTAALAYSTDADNIQNLITSWKDKFVVKPQDLSAWYYQFLAHQ
FT                   ATQKTAWSWARENWAWIKAALGGDMSFDSFVILPAHVFKTQQRLAEYKEFFEPQLSDLA
FT                   LSRNIGMGIKEIAARVDLISREKAAVEAVVLQYGNA"
FT   gene            736148..736822
FT                   /locus_tag="SPAP_0774"
FT   CDS_pept        736148..736822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0774"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /note="Operon 350 Gene 1 COG0745 Response regulators
FT                   consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84367"
FT                   /protein_id="ADM84367.1"
FT                   /translation="MIKILLVEDDLGLSNSVFDFLDDFADVMQVFDGEEGLYEAESGVY
FT                   DLILLDLMLPEKNGFQVLKELREKGITTPVLIMTAKESLDDKGHGFELGADDYLTKPFY
FT                   LEELKMRIQALLKRSGKFNENTLTYGNIVVNLSTNTVKVEDTPVELLGKEFDLLVYFLQ
FT                   NQNVILPKTQIFDRLWGFDSDTTISVVEVYVSKVRKKLKGTTFAENLQTLRSVGYLLKD
FT                   VQ"
FT   gene            736812..738146
FT                   /locus_tag="SPAP_0775"
FT   CDS_pept        736812..738146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0775"
FT                   /product="Signal transduction histidine kinase"
FT                   /note="Operon 350 Gene 2 COG0642 Signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84368"
FT                   /protein_id="ADM84368.1"
FT                   /translation="MFSKLKKTWYADDFSYFIRNFGVFTLIFSTMTLIILQVMHSSLYT
FT                   SVDDKLHGLSENPQAVIQLAINRATEEIKDLENARADASKVEIKPNVSSNTEVILFDKD
FT                   FTQLLSGNRFLGLDKIKLEKKELGHIYQIQVFNSYGQEEIYRVILMETNISSVSTNIKY
FT                   AAVLINTSQLEQASQKHEQLIVVVMASFWILSLLASLYLARVSVRPLLESMQKQQSFVE
FT                   NASHELRTPLAVLQNRLETLFRKPEATIMDVSESIASSLEEVRNMRFLTTSLLNLARRD
FT                   DGIKPELAEVPTSFFNTTFTNYEMIASENNRVFRFENRIHRTIVTDQLLLKQLMTILFD
FT                   NAVKYTEEDGEIDFLISATDRNLYLLVSDNGIGISTEDKKKIFDRFYRVDKARTRQKGG
FT                   FGLGLSLAKQIVDALKGTVTVKDNKPKGTIFEVKIAIQTPSKKKK"
FT   gene            complement(738180..738467)
FT                   /locus_tag="SPAP_0776"
FT   CDS_pept        complement(738180..738467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0776"
FT                   /product="hypothetical protein"
FT                   /note="Operon 351 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84369"
FT                   /protein_id="ADM84369.1"
FT                   /translation="MPVRKLQSYEVDYQEELNQQLPHYQAYTPEAQSDANLKEILFFIN
FT                   IAVFCICIAIFSFIFLALKLSTALAFAAAIGFSLLVLKVQRSIIKRKRRR"
FT   gene            738607..739536
FT                   /locus_tag="SPAP_0777"
FT   CDS_pept        738607..739536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0777"
FT                   /product="Collagenase-like protease"
FT                   /note="Operon 352 Gene 1 COG0826 Collagenase and related
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84370"
FT                   /protein_id="ADM84370.1"
FT                   /translation="MEKIVITATAESIEQVEQLLEAGVDRIYVGEKDFGLRLPTTFSYD
FT                   QLREIAKLVHDAGKELLVAVNALMHQDMMDRIKPFLDFLEEIKTDYITIGDAGVFYVVN
FT                   RDGYSFKTIYDASTMVTSSRQINFWGQKAGASEAVLAREIPSAELFKMPEILEIPAEVL
FT                   VYGASVIHHSKRPLLQNYYNFTHIDDEKTHKRDLFLAEPSDPESHYSIFEDNHGTHIFA
FT                   NNDLDLMIKLTELVEHGFTRWKLEGLYTPGQNFVEIAKLFIQARSLIQEGNFSHDQAFL
FT                   LDEEVRKLHPKNRFLDTGFYDYDPDMVK"
FT   gene            739736..742186
FT                   /locus_tag="SPAP_0778"
FT   CDS_pept        739736..742186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0778"
FT                   /product="Rad3-related DNA helicase"
FT                   /note="Operon 353 Gene 1 COG1199 Rad3-related DNA
FT                   helicases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84371"
FT                   /protein_id="ADM84371.1"
FT                   /translation="MKTIGNRYVVVDLEATSTGSKAKIIQVGIVVIEDGEIVDHYTTDV
FT                   NPHEPLDAHIKELTGLTDQRLAQAPDFSQVARKIFDLVEDGIFVAHNVQFDANLLAENL
FT                   FFEGYELRNPRVDTVELAQVFFPELEKYSLPILCRELGIPLKHAHTALSDAQATAELLL
FT                   FLREKMTQLPKGLLERLLEMADALLYESYLVIEETYRNQSILSSPDLVQVQGLYFKKTA
FT                   ASLELRKLSQDFSKNISLLNLEVREEQESFAKEVGLLLKDEPVSLIQAPTGIGKTYGYL
FT                   LPALSQSKERQIVLSVPTKILQNQIMEEEGKRLKEVFHTDIHSLKGPQNYLKLDAFYHS
FT                   LQENDENRLFRRFKMQVLVWLTETETGDLDEIGQLYRYQHFLADLRHDGNLSSHSLFVT
FT                   EDFWKRSQERAETCKLLVTNHAYLVTRLEDNPEFVSDRLLIIDEVQKILLALENLLQET
FT                   YDIQSIIDLIDKALVGEENRVQQRILESIRFECLYLIEQFQSGKSRKNILDSLDNLHQY
FT                   FSELEVEGFDELVRYFTAEGDYWLEVTETSQKKIQISSTKSGRTLLSSLLPESCQVLGV
FT                   SATLEISQRVSLADLLGYPEAKFVKIESRGKQEQEVVMVKDFPLVTETSLEVYAREVAA
FT                   LLVEIQAFQQPILVLFTAKDMLLAVSDLLTVSHLAQYKNGDVHQLKKRFEKGEQQILLG
FT                   AASFWEGVDFSSHPFVIQVVPRLPFQNPQEPLTKKINQELNQEGKNAFYDYQLPMAIIR
FT                   LKQALGRSMRREYQRSLTLILDRRIVGKRYGKQIVASLAEEATVKTISRSEVDEAIDRF
FT                   FNEL"
FT   gene            742223..743446
FT                   /locus_tag="SPAP_0779"
FT   CDS_pept        742223..743446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0779"
FT                   /product="Bacterial cell division membrane protein"
FT                   /note="Operon 353 Gene 2 COG0772 Bacterial cell division
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84372"
FT                   /protein_id="ADM84372.1"
FT                   /translation="MKRSLDSRVDYSLLLPVFFLLVIGVVAIYIAVSHDYPNNILPILG
FT                   QQVAWIALGLVIGFVVMLFNTEFLWKVTPFLYILGLGLMILPIVFYNPSLVASTGAKNW
FT                   VSINGITLFQPSEFMKISYILMLARVIVQFTKKHKEWRRTVPLDFLLIFWMILFTIPVL
FT                   VLLALQSDLGTALVFVAIFSGIVLLSGVSWKIIIPVFVTAVTGVAGFLAIFISKDGRAF
FT                   LHQIGMPTYQINRILAWLNPFEFAQTTTYQQAQGQIAIGSGGLFGQGFNASNLLIPVRE
FT                   SDMIFTVIAEDFGFIGSVLVIALYLMLIYRMLKITLKSNNQFYTYISTGLIMMLLFHIF
FT                   ENIGAVTGLLPLTGIPLPFISQGGSAIISNLIGVGLLLSMSYQTNLAEEKSGKVPFKRK
FT                   KVVLKQIK"
FT   gene            743457..744011
FT                   /locus_tag="SPAP_0780"
FT   CDS_pept        743457..744011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0780"
FT                   /product="Putative intracellular protease/amidase"
FT                   /note="Operon 353 Gene 3 COG0693 Putative intracellular
FT                   protease/amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84373"
FT                   /protein_id="ADM84373.1"
FT                   /translation="MVKVAVILAQGFEEIEALTVVDVLRRANITCDMVGFEEQVTGSHA
FT                   IQVRADHVFDGDLSDYDMIVLPGGMPGSAHLRDNQTLIQELQSFEQEGKKLAAICAAPI
FT                   ALNQAEILKNKRYTCYDGVQEQILDGHYVKETVVVDGQLTTSRGPSTALAFAYELVEQL
FT                   GGDAESLRTGMLYQDVFGKNQ"
FT   gene            744087..744659
FT                   /locus_tag="SPAP_0781"
FT   CDS_pept        744087..744659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0781"
FT                   /product="Predicted phosphatase"
FT                   /note="Operon 353 Gene 4 COG0546 Predicted phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84374"
FT                   /protein_id="ADM84374.1"
FT                   /translation="MKGMKYHDYIWDLGGTLLDNYETSTAAFVETLALYGITQDHDSVY
FT                   QALKVSTPFAIETFAPNLENFLEKYKENEARELEHPILFEGVSDLLEVISNQGGRHFLV
FT                   SHRNDQVLEILEKTSIAAYFTEVVTSSSGFKRKPNPESMLYLREKYQISSGLVIGDRPI
FT                   DIEAGQAAGLDTHLFTSIVNLRQVLDI"
FT   gene            744674..746620
FT                   /locus_tag="SPAP_0782"
FT   CDS_pept        744674..746620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0782"
FT                   /product="Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /note="Operon 353 Gene 5 COG0187 Type IIA topoisomerase
FT                   (DNA gyrase/topo II, topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84375"
FT                   /protein_id="ADM84375.1"
FT                   /translation="MTEEIKNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHH
FT                   LVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKTGRPAVETVFTV
FT                   LHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVHVHKNGKIHYQEYRRGHVVADLEI
FT                   VGDTDKTGTTVHFTPDPKIFTETTIFDFDKLNKRIQELAFLNRGLQISITDKREGLEQT
FT                   KHYHYEGGIASYVEYINENKDVIFDTPIYTDGEMDDITVEVAMQYTTGYHENVMSFANN
FT                   IHTHEGGTHEQGFRTALTRVINDYARKNKLLKDNEDNLTGEDVREGLTAVISVKHPNPQ
FT                   FEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVAAKRARE
FT                   VTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGK
FT                   ILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTL
FT                   LLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGR
FT                   TKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRRE
FT                   FIEENAVYSTLDV"
FT   gene            746702..748429
FT                   /locus_tag="SPAP_0783"
FT   CDS_pept        746702..748429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0783"
FT                   /product="Negative regulator of septation ring formation"
FT                   /note="Operon 353 Gene 6 COG4477 Negative regulator of
FT                   septation ring formation"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84376"
FT                   /protein_id="ADM84376.1"
FT                   /translation="MSNGQLIYLMVAIAVILVLAYVVAIFLRKRNEGRLEALEERKEEL
FT                   YNLPVNDEVEAVKNMHLIGQSQVAFREWNQKWVDLSLNSFADIENNLFEAEGYNHSFRF
FT                   LKASHQIDQIESQITLIEEDIAAIRNALADLEKQESKNSGRVLHALDLFEELQHRVAEN
FT                   SEQYGQALDEIEKQLENIQSEFSQFVTLNSSGDPVEAAVILDNTENHILALSHIVDRVP
FT                   ALVTTLSTELPDQLQDLEAGYRKLIDANYHFVETDIEARFHLLYEAFKKNQENIRQLEL
FT                   DNAEYENGQAQEEINALYDIFTREIAAQKVVENLLATLPTYLQHMKENNTLLGEDIARL
FT                   NKTYLLPETAASHVRRIQTELESFEAAIVEVTSNQEEPTQAYSVLEENLEDLQTQLKDI
FT                   EDEQISVSERLTQIEKDDINARQKANVYVNRLHTIKRYMEKRNLPGIPQTFLKLFFTAS
FT                   NNTEDLMVELEQKMINIESVTRVLEIATNDMEALETETYNIVQYATLTEQLLQYSNRYR
FT                   SFDERIQEAFNEALDIFEKEFDYHASFDKISQALEVAEPGVTNRFVTSYEKTRETIRF"
FT   gene            complement(749159..749482)
FT                   /locus_tag="SPAP_0784"
FT   CDS_pept        complement(749159..749482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0784"
FT                   /product="Transposase-like protein, ISSpn_AP200_7"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84377"
FT                   /protein_id="ADM84377.1"
FT                   /translation="MMILLSDLGQVHLVCGKTDMRQGIDSLAYVVKTHFELDPFSGQVF
FT                   LFCGGRKYRFKALYWDGQGFWLLYKRFENGRLTWPSTEKDVKALTSEQVDWLMKGFSIT
FT                   PQI"
FT   gene            complement(749743..750042)
FT                   /locus_tag="SPAP_0785"
FT   CDS_pept        complement(749743..750042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0785"
FT                   /product="hypothetical protein"
FT                   /note="Operon 355 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84378"
FT                   /protein_id="ADM84378.1"
FT                   /translation="MKLINTTNSHSQLVKSQLESTDATLVEVYSAGNTDVIFTQAPLHY
FT                   EILISNKHRAIREPEIETIQEFFLKRKIDKTSVDEANIKTLYSEKLIGISIPIK"
FT   gene            complement(750207..750470)
FT                   /locus_tag="SPAP_0786"
FT   CDS_pept        complement(750207..750470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0786"
FT                   /product="NTP pyrophosphohydrolase including oxidative
FT                   damage repair enzymes"
FT                   /note="Operon 356 Gene 1 COG0494 NTP pyrophosphohydrolases
FT                   including oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84379"
FT                   /protein_id="ADM84379.1"
FT                   /translation="MIEELGFTAEIGTYYGQADEYFYSRHRDTYYYNPAYLYEATSFKE
FT                   VQKPLENFNHIAWFPIDEAIQNLKRGSHKWAIESWKKQHKIG"
FT   gene            750722..751090
FT                   /locus_tag="SPAP_0787"
FT   CDS_pept        750722..751090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0787"
FT                   /product="Transposase-like protein, IS630"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84380"
FT                   /protein_id="ADM84380.1"
FT                   /translation="MWYNLLMAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWL
FT                   KLKEKTGELNHQVKGTKPRKVDRDRLKNYLTDNPDAYLTEIVSEFGCHPTTIHYALKAM
FT                   GYTRKKRTTPTMNKSQKK"
FT   gene            complement(751109..751369)
FT                   /locus_tag="SPAP_0788"
FT   CDS_pept        complement(751109..751369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0788"
FT                   /product="hypothetical protein"
FT                   /note="Operon 358 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84381"
FT                   /protein_id="ADM84381.1"
FT                   /translation="MVWLMLVRETSETKLQKSRSSSSLRKSLERLTHHLLDLQPKKSSD
FT                   IFFQILCLFLTDLLMSDHILDKNKYRILFRQSKQVLGALNY"
FT   gene            751510..751692
FT                   /locus_tag="SPAP_0789"
FT   CDS_pept        751510..751692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0789"
FT                   /product="Transposase-like protein, IS630"
FT                   /note="Operon 359 Gene 1 COG3335 Transposase and
FT                   inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84382"
FT                   /protein_id="ADM84382.1"
FT                   /translation="MGKLELLCEEFGHKLLPLPPYSPEYNPIEKTWAHIKKHLKKVLPS
FT                   CNTFYEALLSCSCFN"
FT   gene            complement(751899..754157)
FT                   /locus_tag="SPAP_0790"
FT   CDS_pept        complement(751899..754157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0790"
FT                   /product="hypothetical protein"
FT                   /note="Operon 360 Gene 1 protein supported
FT                   gi|163764771|ref|ZP_02171825.1| ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84383"
FT                   /protein_id="ADM84383.1"
FT                   /translation="MLCQNCKINDSTIHLYTNLNGKQKQIDLCQNCYKIIKTDPNNSLF
FT                   KGMTDLNNRDFDPFGDFFNDLNNFRPSSNTPPIPPTQSGGGYGGNGGYGSQNRGSAQTP
FT                   PPSQEKGLLEEFGINVTEIARRGDIDPVIGRDDEIIRVIEILNRRTKNNPVLIGEPGVG
FT                   KTAVVEGLAQKIVDGDVPHKLQGKQVIRLDVVSLVQGTGIRGQFEERMQKLMEEIRKRE
FT                   DIILFIDEIHEIVGAGSASDGNMDAGNILKPALARGELQLVGATTLNEYRIIEKDAALE
FT                   RRMQPVKVDEPTVDETITILKGIQKKYEDYHHVQYTDAAIEAAATLSNRYIQDRFLPDK
FT                   AIDLLDEAGSKMNLTLNFVDPKVIDQRLIEAENLKSQATREEDFEKAAYFRDQIAKYKE
FT                   MQKKKITDQDTPIISEKTIEHIIEQKTNIPVGDLKEKEQSQLIHLAEDLKSHVIGQDDA
FT                   VDKIAKAIRRNRVGLGTPNRPIGSFLFVGPTGVGKTELSKQLAIELFGSADSMIRFDMS
FT                   EYMEKHSVAKLVGAPPGYVGYDEAGQLTEKVRHNPYSLILLDEVEKAHPDVMHMFLQVL
FT                   DDGRLTDGQGRTVSFKDAIIIMTSNAGTGKTEASVGFGAAREGRTNSVLGELGNFFSPE
FT                   FMNRFDGIIEFKALSKDNLLQIVELMLADVNKRLSSNNIRLDVTDKVKEKLVDLGYDPK
FT                   MGARPLRRTIQDYIEDTITDYYLENPSEKDLKAVMTSKGNIQIKSAKKAEVKSSEKEK"
FT   gene            complement(754386..754616)
FT                   /locus_tag="SPAP_0791"
FT   CDS_pept        complement(754386..754616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0791"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 361 Gene 1 COG4703 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84384"
FT                   /protein_id="ADM84384.1"
FT                   /translation="MESHLVRIINRLEAMANDGGNLKRNFEREGVVVAEVAYSHDEENG
FT                   PIFTLRDVEDRETYTFDSIDLIAMEIYELLY"
FT   gene            754806..755489
FT                   /locus_tag="SPAP_0792"
FT   CDS_pept        754806..755489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0792"
FT                   /product="ABC-type amino acid transport system, permease
FT                   component"
FT                   /note="Operon 362 Gene 1 COG0765 ABC-type amino acid
FT                   transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84385"
FT                   /protein_id="ADM84385.1"
FT                   /translation="MNFSFLPKYLPYFNYGAVVTILISICVIFLGTILGVVLAFGQRSK
FT                   FKPLVWLANLYVWIFRGTPMMVQIMIAFALMHINAPTIQIGILGVDFSRLIPGILIISM
FT                   NSGAYVSETVRAGINAVPKGQLEAAYSLGIRPKNAMRYVILPQAVKNILPALGNEFITI
FT                   IKDSSLLSAIGVMELWNGATTVSTTTYLPLTPLLFAAFYYLIMTSILTVALKAFEKHMG
FT                   QGDKK"
FT   gene            755489..756223
FT                   /locus_tag="SPAP_0793"
FT   CDS_pept        755489..756223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0793"
FT                   /product="hypothetical protein"
FT                   /note="Operon 362 Gene 2 protein supported
FT                   gi|163803615|ref|ZP_02197481.1| 50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84386"
FT                   /protein_id="ADM84386.1"
FT                   /translation="MTETLIKIENLHKSFGKNEVLKGINLEIKRGEVVVIIGPSGSGKS
FT                   TLLRSMNLLEEATKGKLIFEGVDITDKKNDLFAMREKMGMVFQQFNLFPNMTVMENITL
FT                   SPIKTKGESREVAEKRAQELLEKVGLPDKADAYPQSLSGGQQQRIAIARGLAMEPDVLL
FT                   FDEPTSALDPEMVGEVLAVMQDLAKSGMTMVIVTHEMGFAREVADRVIFMADGVVVEDG
FT                   TPEQIFEQTQEQRTKDFLSKVL"
FT   gene            756377..757234
FT                   /locus_tag="SPAP_0794"
FT   CDS_pept        756377..757234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0794"
FT                   /product="5,10-methylene-tetrahydrofolate
FT                   dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase"
FT                   /note="Operon 363 Gene 1 COG0190
FT                   5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
FT                   tetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84387"
FT                   /protein_id="ADM84387.1"
FT                   /translation="MTQIIDGKALAAKLQGQLAEKTAKLKEETALVPGLVVILVGDNPA
FT                   SQVYVRNKERSALAAGSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHI
FT                   DEEAVLLAIDPEKDVDGFHPLNMGRLWSGHPVMIPSTPAGIMEMFHEYGIDLEGKNAVV
FT                   IGRSNIVGKPMAQLLLAKNATVTLAHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKP
FT                   GAVVIDVGMNRDENGKLCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRT
FT                   LDRK"
FT   gene            757376..758248
FT                   /locus_tag="SPAP_0795"
FT   CDS_pept        757376..758248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0795"
FT                   /product="Predicted sugar kinase"
FT                   /note="Operon 364 Gene 1 COG0063 Predicted sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84388"
FT                   /protein_id="ADM84388.1"
FT                   /translation="MKVINQTLLEKVIIERSRSSHKGDYGRLLLLGGTYPYGGAIIMAA
FT                   LAAVKSGAGLVTVGTDRENIPALHSHLPESMAFSLQDQQLLKEQLEKAEVVLLGPGLRD
FT                   DASGENLVKQVFVNLSQNQILIVDGGALTILARTSLSFPSSQLILTPHQKEWEKLSGIT
FT                   IEKQKEDATASVLTSFPQGTILVEKGPATRIWEVGQSDYYQLQVGGPYQATGGMGDTLA
FT                   GMIAGFVGQFRQASLYERVAVATHLHSAIAQELSQENYVVLPTEISRYLPKIMKIICQQ
FT                   ERVSKDKLV"
FT   gene            758530..759213
FT                   /locus_tag="SPAP_0796"
FT   CDS_pept        758530..759213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0796"
FT                   /product="Ribose 5-phosphate isomerase"
FT                   /note="Operon 365 Gene 1 COG0120 Ribose 5-phosphate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84389"
FT                   /protein_id="ADM84389.1"
FT                   /translation="MENLKKMAGIKAAEFVSDGMVVGLGTGSTAYYFVEEIGRRIKEEG
FT                   LQITAVTTSSVTTKQAEGLNIPLKSIDQVDFVDVTVDGADEVDSQFNGIKGGGGALLME
FT                   KVVATPSKEYIWVVDESKLVEKLGAFKLPVEVVQYGAEQVFRHFERAGYKPSFREKDGQ
FT                   RFVTDMQNFIIDLALDVIENPIAFGQELDHVVGVVEHGLFNQMVDKVIVAGRDGVQIST
FT                   SKKGK"
FT   gene            759227..760438
FT                   /locus_tag="SPAP_0797"
FT   CDS_pept        759227..760438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0797"
FT                   /product="Phosphopentomutase"
FT                   /note="Operon 365 Gene 2 COG1015 Phosphopentomutase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84390"
FT                   /protein_id="ADM84390.1"
FT                   /translation="MSKFNRIHLVVLDSVGIGAAPDANNFVNAGVPDGASDTLGHISKT
FT                   VGLNVPNMAKIGLGNIPRETPLKTVAAESNPTGYATKLEEVSLGKDTMTGHWEIMGLNI
FT                   TEPFDTFWNGFPEEILTKIEEFSGRKVIREANKPYSGTAVIDDFGPRQMETGELIIYTS
FT                   ADPVLQIAAHEDIIPLDELYRICEYARSITLERPALLGRIIARPYVGEPGNFTRTANRR
FT                   DLAVSPFSPTVLDKLNEADIDTYAVGKINDIFNGAGINHDMGHNKSNSHGIDTLLKTMG
FT                   LAEFEKGFSFTNLVDFDALYGHRRNAHGYRDCLHEFDERLPEIIAAMRENDLLLITADH
FT                   GNDPTYAGTDHTREYIPLLAYSPAFKGNGLIPVGHFADISATVADNFGVETAMIGESFL
FT                   DKLV"
FT   gene            760440..760982
FT                   /locus_tag="SPAP_0798"
FT   CDS_pept        760440..760982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0798"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="Operon 365 Gene 3 COG3797 Uncharacterized protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84391"
FT                   /protein_id="ADM84391.1"
FT                   /translation="MTRYALLVRGINVGSKNKVVMAELHQELTNLGLEKVESYINSGNI
FT                   FFASIDSKAQLVEKLETFFAVHYPFIQSFSLLSLEDFEAELENLPAWWSRDLARKDFLF
FT                   YTEGLDVDQVIATVESLELKDEVLYFGKLGIFWGKFSEESYSKTAYHKYLLKVPFYRHI
FT                   TIRNAKTFDKIGQMLKK"
FT   gene            760998..761807
FT                   /locus_tag="SPAP_0799"
FT   CDS_pept        760998..761807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0799"
FT                   /product="Purine nucleoside phosphorylase"
FT                   /note="Operon 365 Gene 4 COG0005 Purine nucleoside
FT                   phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84392"
FT                   /protein_id="ADM84392.1"
FT                   /translation="MTFLNKIHETATFLKEKGIAAPEFGLILGSGLGELAEEIENPVVV
FT                   DYAEIPNWGRSTVVGHAGKLVYGELAGRKVLALQGRFHFYEGNPLEVVTFPVRVMKVLG
FT                   CEGVIVTNAAGGIGFGPGTLMAISDHINMTGQNPLMGENLDDFGPRFPDMSRAYTPEYR
FT                   ATAHEVAKKLNIKLDEGVYIGVTGPTYETPAEIRSYKTLGADAVGMSTVPEVIVAAHSG
FT                   LKVLGISCITNFAAGFQEELNHEEVVEVTERVKGDFKGLLKAILAEL"
FT   gene            762283..762678
FT                   /locus_tag="SPAP_0800"
FT   CDS_pept        762283..762678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0800"
FT                   /product="hypothetical protein"
FT                   /note="Operon 366 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84393"
FT                   /protein_id="ADM84393.1"
FT                   /translation="MLDSKEELKESENDAPKLETPLREEPRLAPQTLPEASEVLENKRE
FT                   ESKVEITEPAQADDIRKVVGELAKDISITKLYMTGHSLGGYLAQIAAVEDYQKYPDFYN
FT                   HVLRKVTTFSAPKVITSRTVWDAKNGF"
FT   gene            762733..763263
FT                   /locus_tag="SPAP_0801"
FT   CDS_pept        762733..763263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0801"
FT                   /product="hypothetical protein"
FT                   /note="Operon 366 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84394"
FT                   /protein_id="ADM84394.1"
FT                   /translation="MVDNDNVVTPLIHNNRDIVTFTGNSRFKHRSRGYFESPMNDIPNF
FT                   NIGKQATLDKHGYRDPKLDKARFFKKQALPQSSSQPSAEPMENIALGKQVTQSSTAFGG
FT                   DARRAVDGKVDGNYGHNSVTHTNFQSKPWWQVDLAKEETIRQINIYNRTDTAQDRLANF
FT                   DVILLDGSGKEIE"
FT   gene            763288..763800
FT                   /locus_tag="SPAP_0802"
FT   CDS_pept        763288..763800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0802"
FT                   /product="hypothetical protein"
FT                   /note="Operon 366 Gene 3 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84395"
FT                   /protein_id="ADM84395.1"
FT                   /translation="MSAQITINHKKARYVRIELEGYNALSLAEVEVFRFIATNGETAIQ
FT                   VSKSVQPISQTPVKDKTLTIQHSGAYIARYSITWEEVTVDKDGNQVVRSHSWEGNGRNQ
FT                   TAGFVLNLPIKENMRNLRVKIEKKTGLLWNRWQTIYENRPILAQPHRKITHWGTTLNSK
FT                   VSDDDVL"
FT   gene            764454..765164
FT                   /locus_tag="SPAP_0803"
FT   CDS_pept        764454..765164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0803"
FT                   /product="Purine-nucleoside phosphorylase"
FT                   /note="Operon 367 Gene 1 COG0813 Purine-nucleoside
FT                   phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84396"
FT                   /protein_id="ADM84396.1"
FT                   /translation="MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLGDAVCFNEVRNM
FT                   FGYTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNEEVHVRELV
FT                   LAQAAATNSNIVRNDWPQYDFPQIASFDLLDKAYHIAKELGMTTHVGNVLSSDVFYSNY
FT                   FEKNIELGKWGVKAVEMEAAALYYLAAQYHVDALAIMTISDSLVNPDEDTTAEERQNTF
FT                   TDMMKVGLETLIAE"
FT   gene            complement(765187..765711)
FT                   /locus_tag="SPAP_0804"
FT   CDS_pept        complement(765187..765711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0804"
FT                   /product="Adenylate kinase-like kinase"
FT                   /note="Operon 368 Gene 1 COG0563 Adenylate kinase and
FT                   related kinases"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84397"
FT                   /protein_id="ADM84397.1"
FT                   /translation="MKITIIGYSGSGKSTLAEKLSNYYSIPKLHMDTLQFQPGWQDSDC
FT                   EWMLTEIKNFLTKHKAWVIDGNYSWCYYQERMQEADQIIFLNFLPLTCLFRAFKRYLKY
FT                   RGKVRESMAADCPERFDWEFIRWILWDGRSKTQKENYQKLCQEYSHKVTILRNQRELDQ
FT                   FLDKKRKSYNS"
FT   gene            complement(765764..766015)
FT                   /locus_tag="SPAP_0805"
FT   CDS_pept        complement(765764..766015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0805"
FT                   /product="hypothetical protein"
FT                   /note="Operon 369 Gene 1 protein supported
FT                   gi|242245117|ref|ZP_04799554.1| 30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84398"
FT                   /protein_id="ADM84398.1"
FT                   /translation="MEVRTLANIKSAIKRAELNVKQNEKNSAQKSAMRTAIKAFEANPS
FT                   EELFRAASSAIDKAETKGLIHKNKASRDKARLSTKLAK"
FT   gene            complement(766068..766988)
FT                   /locus_tag="SPAP_0806"
FT   CDS_pept        complement(766068..766988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0806"
FT                   /product="Panthothenate kinase"
FT                   /note="Operon 369 Gene 2 COG1072 Panthothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84399"
FT                   /protein_id="ADM84399.1"
FT                   /translation="MTNEFLHFEKISRQTWQSLHRKTTPPLTEEELESIKSFNDQISLQ
FT                   DVTDIYLPLAHLIQIYKRTKEDLAFSKGIFLQRESKSQPFIIGVSGSVAVGKSTTSRLL
FT                   QILLSRTFTDATVELVTTDGFLYPNQTLIEQGILNRKGFPESYDMEALLNFLDRIKNGQ
FT                   DVDIPVYSHEVYDIVPEKKQSVKAADFVIVEGINVFQNPQNDRLYITDFFDFSIYVDAG
FT                   VDDIESWYLDRFLKMLSLAQNDPDSYYYRFTQMPIGEVESFAHQVWISINLTNLQNYIE
FT                   PTRNRAEVILHKSKNHEIDEIYLKK"
FT   gene            767178..767414
FT                   /locus_tag="SPAP_0807"
FT   CDS_pept        767178..767414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0807"
FT                   /product="hypothetical protein"
FT                   /note="Operon 370 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84400"
FT                   /protein_id="ADM84400.1"
FT                   /translation="MKILKRYILELCFILSFALPFIKGTNADNGRCFVETYYGFTFLME
FT                   HAIVTAVFICSFLIAFLLKNDGRNGLLRVVIAF"
FT   gene            767788..768378
FT                   /locus_tag="SPAP_0808"
FT   CDS_pept        767788..768378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0808"
FT                   /product="16S RNA G1207 methylase RsmC"
FT                   /note="Operon 371 Gene 1 COG2813 16S RNA G1207 methylase
FT                   RsmC"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84401"
FT                   /protein_id="ADM84401.1"
FT                   /translation="MSKMYYAENPDAAHDIHELRVDLLGEKMTFLTDAGVFSKKMVDFG
FT                   SQLLLKCLDVNQGETVLDVGCGYGPLGLSLVKVYGVQATMVDINTRALDLAQRNAEKNN
FT                   AKATIFQSNIYARVQGRFDHVISNPPIRAGKQVVHEIIEKSKDFLEIGGDLTIVIQKKQ
FT                   GAPSAKSKMEDVFGNCEILKKDKGYYILRSVKE"
FT   gene            768375..769652
FT                   /locus_tag="SPAP_0809"
FT   CDS_pept        768375..769652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0809"
FT                   /product="Thymidine phosphorylase"
FT                   /note="Operon 371 Gene 2 COG0213 Thymidine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0809"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84402"
FT                   /protein_id="ADM84402.1"
FT                   /translation="MRAVDLIQKKRDGQELTSSEIEWLIEGYVSGTVPDYQMSAFAMAV
FT                   YFKGMTTREISDLTMNMVKTGQEFDLSAIDGVKVDKHSTGGVGDKVTLILAPLVASFGV
FT                   PVAKMSGRGLGHTGGTIDKLESIRGYQVERSQEDFIRQVQDIGVSVIGQSDQLVKADKL
FT                   LYALRDVTATVDTIPLIASSVMSKKIAAGADAILLDVTVGEGAFMKTVDEARELAQTMV
FT                   DLGKVVGRKTVAVITDMSQPLGRAIGNRLEILEALEILQGQGRQDITHFICELAQIMLG
FT                   LANVNKTVEEVRQHLENGQALAKFEEMVQAQGGDLEDLYRPVNVAHVVEIPAQETGVIS
FT                   ALPAMDFGLYAMRLGAGRAVKSDVLDYETGIVFEKKIGDSVQKGEIVAKVYTNEKIPPQ
FT                   LVTDFQKCVKISDEVKKIREIVEIIS"
FT   gene            769670..770332
FT                   /locus_tag="SPAP_0810"
FT   CDS_pept        769670..770332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0810"
FT                   /product="Deoxyribose-phosphate aldolase"
FT                   /note="Operon 371 Gene 3 COG0274 Deoxyribose-phosphate
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84403"
FT                   /protein_id="ADM84403.1"
FT                   /translation="MKLNKYIDHTLLKQDAKKKQIDSLLSEAREYGFASVCVNPTWVEH
FT                   AKKGLEGTDVKVCTVVGFPLGATTSTVKAFETKEAIQNGADEIDMVINVGALKSGDLAL
FT                   VESDIRAVVEASGDKLVKVIIEACLLTDQEKVLACQLAQKAGADFVKTSTGFSTGGATI
FT                   ADVRLMRETVGPDMGVKAAGGARSYADALTFVEAGATRIGTSAGVAILKGELADGDY"
FT   gene            770319..770708
FT                   /locus_tag="SPAP_0811"
FT   CDS_pept        770319..770708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0811"
FT                   /product="Cytidine deaminase"
FT                   /note="Operon 371 Gene 4 COG0295 Cytidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0811"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84404"
FT                   /protein_id="ADM84404.1"
FT                   /translation="MATTELIELAIETSKHAYVPYSHFPIGAVLVAKDGSVYTGVNIEN
FT                   ASYPLTNCGERTAIFKAISEGQREFSELIVYGQTEKPISPCGACRQVMVEFFEQDLKVT
FT                   LVAKDKSTVEMTVGELLPYSFTDLN"
FT   gene            770799..771851
FT                   /locus_tag="SPAP_0812"
FT   CDS_pept        770799..771851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0812"
FT                   /product="Uncharacterized ABC-type transport system,
FT                   periplasmic component/surface lipoprotein"
FT                   /note="Operon 371 Gene 5 COG1744 Uncharacterized ABC-type
FT                   transport system, periplasmic component/surface
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0812"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84405"
FT                   /protein_id="ADM84405.1"
FT                   /translation="MNKKQWLGLGLVAVAAVGLAACGNRSSRNAASSSDVKTKAAIVTD
FT                   TGGVDDKSFNQSAWEGLQDWGKEHNLSKDNGFTYFQSTSEADYANNLQQAAGSYNLIFG
FT                   VGFALHNAVEEAAKEHTDLNYVLIDDVIKDQKNVASVTFADNESGYLAGVAAAKTTKTK
FT                   QVGFVGGIESEVISRFEAGFKAGVASVDPSIKVQVDYAGSFGDAAKGKTIAAAQYAAGA
FT                   DIVYQVAGGTGAGVFAEAKSLNESRPENEKVWVIGVDRDQEAEGKYTSKDGKESNFVLV
FT                   STLKQVGTTVKDISNKAEKGEFPGGQVIVYSLKDKGVDLAVTNLSEEGKKAVEDAKAKI
FT                   LDGSVKVPEK"
FT   gene            771995..773530
FT                   /locus_tag="SPAP_0813"
FT   CDS_pept        771995..773530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0813"
FT                   /product="ABC-type uncharacterized transport systems,
FT                   ATPase component"
FT                   /note="Operon 371 Gene 6 COG3845 ABC-type uncharacterized
FT                   transport systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0813"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84406"
FT                   /protein_id="ADM84406.1"
FT                   /translation="MAHENVIEMRDITKVFGGFVANDKINLHLRKGEIHALLGENGAGK
FT                   STLMNMLAGLLEPTSGEIAVNGQVVNLDSPSKAASLGIGMVHQHFMLVEAFTVAENIIL
FT                   GSELTKNGVLDIAGASKEIKALSERYGLAVDPSAKVADISVGAQQRVEILKTLYRGADI
FT                   LIFDEPTAVLTPSEIDELMAIMKNLVKEGKSIILITHKLDEIRAVSDRVTVIRRGKSIE
FT                   TVEIAGATNADLAEMMVGRSVSFKTEKQASKPKEVVLSIKDLVVNENRGVPAVKNLSLD
FT                   VRAGEIVGIAGIDGNGQSELIQAITGLRKVESGSIELKGDSIVGLHPRQITELSVGHVP
FT                   EDRHRDGLILEMMISENIALQTYYKEPHSKNGILNYSNITSYAKKLMEEFDVRAASELV
FT                   PAAALSGGNQQKAIIAREIDRDPDLLIVSQPTRGLDVGAIEYIHKRLIEERDNGKAVLV
FT                   VSFELDEILNVSDRIAVIHDGKIQGIVSPETTNKQGLGVLMAGGNLGKEKSDV"
FT   gene            773523..774581
FT                   /locus_tag="SPAP_0814"
FT   CDS_pept        773523..774581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0814"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /note="Operon 371 Gene 7 COG4603 ABC-type uncharacterized
FT                   transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0814"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84407"
FT                   /protein_id="ADM84407.1"
FT                   /translation="MSKKLQQISVPLISVFLGILLGAIVMWIFGYDAIWGYEELFYTAF
FT                   GSLRGIGEIFRAMGPLVLIGLGFAVASRAGFFNVGLPGQALAGWILSGWFALSHPDMPR
FT                   PLMILATIVIALIAGGIVGAIPGILRAYLGTSEVIVTIMMNYIVLYVGNAFIHAFPKDF
FT                   MQSTDSTIRVGANATYQTPWLAELTGNSRMNIGIFFAIIAVAVIWFMLKKTTLGFEIRA
FT                   VGLNPHASEYAGISAKRTIILSMIISGALAGLGGAVEGLGTFQNVYVQGSSLAIGFNGM
FT                   AVSLLAANSPIGILFAAFLFGVLQVGAPGMNAAQVPSELVSIVTASIIFFVSVHYLIER
FT                   FVKPKKQVKGGK"
FT   gene            774584..775540
FT                   /locus_tag="SPAP_0815"
FT   CDS_pept        774584..775540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0815"
FT                   /product="Uncharacterized ABC-type transport system,
FT                   permease component"
FT                   /note="Operon 371 Gene 8 COG1079 Uncharacterized ABC-type
FT                   transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0815"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84408"
FT                   /protein_id="ADM84408.1"
FT                   /translation="MSIITLLPLLVSSMLIYSAPLIFTSIGGVFSERGGVVNVGLEGIM
FT                   VMGAFSGVVFNLEFAEQFGAATPWLSLLVAGLVGSVFSIIHAAATVHFRADHVVSGTVL
FT                   NLMAPALAVFLVKVLYNKGQTDNLSQTFGRFDFPVLANIPVIGDIFFKSTSLLGYLAIA
FT                   FSFLAWFILFKTQFGLRLRSVGEHPQAADTLGINVYKMRYLGVIISGFLGGIGGAIYAQ
FT                   SISVNFSVTTIVGPGFIALAAMIFGKWNPIGAMLSSLFFGLSQSLAVIGSQLPFLQGVP
FT                   AVYLQIAPYVLTILVLAAFFGKAVAPKADGINYIKSK"
FT   gene            775625..775837
FT                   /locus_tag="SPAP_0816"
FT   CDS_pept        775625..775837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0816"
FT                   /product="Transposase-like protein, ISSpn1 ISSpn3"
FT                   /note="Operon 371 Gene 9 COG2963 Transposase and
FT                   inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0816"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84409"
FT                   /protein_id="ADM84409.1"
FT                   /translation="MKLTYDDKVQIYELRKQGYSLEKLSNKFGINNSNLRYMIKLIDRY
FT                   GIEFVKKGKNRYYSPDLKQEMIHKV"
FT   gene            775974..776141
FT                   /locus_tag="SPAP_0817"
FT   CDS_pept        775974..776141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0817"
FT                   /product="hypothetical protein"
FT                   /note="Operon 372 Gene 1 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0817"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84410"
FT                   /protein_id="ADM84410.1"
FT                   /translation="MGRKPKKRPEERTELEHLQAENEYLRAENAILKKLRELRLKEEKE
FT                   KEERQKLFKN"
FT   gene            776141..776974
FT                   /locus_tag="SPAP_0818"
FT   CDS_pept        776141..776974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0818"
FT                   /product="Transposase-like protein, ISSpn1 ISSpn3"
FT                   /note="Operon 372 Gene 2 COG2801 Transposase and
FT                   inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0818"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84411"
FT                   /protein_id="ADM84411.1"
FT                   /translation="MTEFSLDILLKAIKLARSTYYYHLKQLDKPDKDQELKAEIQSIFI
FT                   EHKGNYAYRRIYLELRNRGYLVNHKRVQGLMKVLNLQAKMRQKRKYSSHKGDVGKKAEN
FT                   LIQGQFEGSKTMEQCYTDVTEFAIPVSTQKLYLSPVLDGFNSEIIAYNLSTSPNLEQVQ
FT                   TMLEQAFTEKHYENTILHSDQGWQYQHDSYHQFLEGKGIQASMSRKGNSPDNGMMESFF
FT                   GILKSEMFYGYEKSFQSLKQLEQAIVDYIDYYNNKRIKVKLKGLSPVQYRTKSFG"
FT   gene            complement(777017..777658)
FT                   /locus_tag="SPAP_0819"
FT   CDS_pept        complement(777017..777658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0819"
FT                   /product="Predicted membrane protein"
FT                   /note="Operon 373 Gene 1 COG0344 Predicted membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0819"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84412"
FT                   /protein_id="ADM84412.1"
FT                   /translation="MITIVLLILAYLLGSIPSGLWIGQVFFQINLREHGSGNTGTTNTF
FT                   RILGKKAGMATFVIDFFKGTLATLLPIIFHLQGVSPLIFGLLAVIGHTFPIFAGFKGGK
FT                   AVATSAGVIFGFAPIFCLYLAIIFFGALYLGSMISLSSVTASIAAVIGVLLFPLFGFIL
FT                   SNYDSLFIAIILALASLIIIRHKDNIARIKNKTENLVPWGLNLTHQDPKK"
FT   gene            777794..779737
FT                   /locus_tag="SPAP_0820"
FT   CDS_pept        777794..779737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0820"
FT                   /product="Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /note="Operon 374 Gene 1 COG0187 Type IIA topoisomerase
FT                   (DNA gyrase/topo II, topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0820"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84413"
FT                   /protein_id="ADM84413.1"
FT                   /translation="MSKKEININNYNDDAIQVLEGLDAVRKRPGMYIGSTDGAGLHHLV
FT                   WEIVDNAVDEALSGFGDRIDVTINKDGSLTVQDHGRGMPTGMHAMGIPTVEVIFTILHA
FT                   GGKFGQGGYKTSGGLHGVGSSVVNALSSWLEVEITRDGAVYKQRFENGGKPVTTLKKIG
FT                   TAPKSKTGTKVTFMPDATIFSTTDFKYNTISERLNESAFLLKNVTLSLTDKRTDEAIEF
FT                   HYENGVQDFVSYLNEDKEILTPVLYFEGEDNGFQVEVALQYNDGFSDNILSFVNNVRTK
FT                   DGGTHETGLKSAITKVMNDYARKTGLLKEKDKNLEGSDYREGLAAVLSILVPEEHLQFE
FT                   GQTKDKLGSPLARPVVDGIVADKLTFFLMENGELASNLIRKAIKARDAREAARKARDES
FT                   RNGKKNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGK
FT                   VVNTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTL
FT                   LLTFFYRYMRPLVEAGHVYIALPPLYKMSKGKGKKEEVAYAWTDGELEELRKQFGKGAT
FT                   LQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIED
FT                   NVKFTLEEATVF"
FT   gene            779752..779844
FT                   /locus_tag="SPAP_0821"
FT   CDS_pept        779752..779844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0821"
FT                   /product="hypothetical protein"
FT                   /note="Operon 374 Gene 2 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0821"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84414"
FT                   /protein_id="ADM84414.1"
FT                   /translation="MLVNWKLESDVNDYVKKQFENLGLKKLQDY"
FT   gene            779858..779983
FT                   /locus_tag="SPAP_0822"
FT   CDS_pept        779858..779983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0822"
FT                   /product="hypothetical protein"
FT                   /note="Operon 374 Gene 3 Putative gene predicted by
FT                   FgenesB"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0822"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84415"
FT                   /protein_id="ADM84415.1"
FT                   /translation="MSAYLKEAFKGAAKTQTKTNFGKPYFHIEKYKQDSLVTYRN"
FT   gene            780193..782628
FT                   /locus_tag="SPAP_0823"
FT   CDS_pept        780193..782628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPAP_0823"
FT                   /product="Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit"
FT                   /note="Operon 375 Gene 1 COG0188 Type IIA topoisomerase
FT                   (DNA gyrase/topo II, topoisomerase IV), A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPAP_0823"
FT                   /db_xref="EnsemblGenomes-Tr:ADM84416"
FT                   /protein_id="ADM84416.1"
FT                   /translation="MGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDK
FT                   SYRKSAKSVGNIMGNFHPHGDSSIYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAM
FT                   RYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFPNLLVNGSTGISAGYA
FT                   TDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKG
FT                   RVVVRSKTEIEKLKGGKEQIVITEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDR
FT                   DGLRIAIELKKDANTELVLNYLFKYTDLQINYNFNMVAIDNFTPRQVGIVPILSSYIAH
FT                   RREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKADAKENLKVSYDF
FT                   TEEQAEAIVTLQLYRLTNTDVVVLQEEEAEL